Release Notes For GenBank Release 168
GBREL.TXT Genetic Sequence Data Bank
October 15 2008
NCBI-GenBank Flat File Release 168.0
Distribution Release Notes
96400790 loci, 97381682336 bases, from 96400790 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 168.0
1.2 Cutoff Date
1.3 Important Changes in Release 168.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 168.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for GenBank's web-based submission tool (BankIt) :
http://www.ncbi.nlm.nih.gov/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 168.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:
ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/ (Japan)
ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/ (Korea)
ftp://bio-mirror.sg.apan.net/biomirrors/genbank/ (Singapore)
1.2 Cutoff Date
This full release, 168.0, incorporates data available to the collaborating
databases as of October 27, 2008 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 168.0
1.3.1 Organizational changes
The total number of sequence data files increased by 60 with this release:
- the BCT division is now comprised of 32 files (+2)
- the CON division is now comprised of 103 files (+6)
- the EST division is now comprised of 802 files (+40)
- the GSS division is now comprised of 309 files (+3)
- the HTG division is now comprised of 122 files (+2)
- the PAT division is now comprised of 47 files (+1)
- the PLN division is now comprised of 32 files (+2)
- the STS division is now comprised of 18 files (+4)
The total number of index files increased by 1 with this release:
- the JOU index is now comprised of 6 files (+1)
1.3.2 Changes related to ncRNA features, /ncRNA_class, and /moltype
The list of allowed values for the /ncRNA_class qualifier, which is
mandatory for all ncRNA features, has been expanded to include:
/ncRNA_class="ribozyme"
Non-coding RNAs which are not yet in the INSDC's controlled vocabulary:
http://www.insdc.org/page.php?page=rna_vocab
previously required /ncRNA_class="other" plus an accompanying /note
qualifer to describes the nature of the ncRNA. This requirement will
be changed, such that *either* a /product or a /note qualifier must
accompany "other" ncRNAs features.
The list of allowed /mol_type qualifiers for the source feature
currently includes:
/mol_type="snoRNA"
/mol_type="snRNA"
/mol_type="scRNA"
/mol_type="tmRNA"
All of these molecule types have been collapsed into a single value:
/mol_type="transcribed RNA"
Sequence records which represent one of these four types of molecules
will thus have:
an ncRNA feature with /ncRNA_class of "snoRNA", "scRNA" or "snRNA"
a source feature with /mol_type of "transcribed RNA"
or
a tmRNA feature
a source feature with /mol_type of "transcribed RNA"
All of these changes take effect with this October 2008 release.
1.3.3 Merging the satellite and repeat_unit features into repeat_region
Satellites, minisatellites and microsatellites are comprised of repetitive
units of DNA, with a variety of lengths and repeat patterns. With the
addition of a new qualifier (/satellite), the satellite and repeat_unit
features are now represented by the repeat_region feature.
Qualifier /satellite=
Definition identifier for satellite DNA marker; many tandem repeats
(identical or related) of a short basic repeating unit; many
have a base composition or other property different from the
genome average that allows them to be separated from the bulk
genomic DNA;
Value format "<satellite_type>[:<class>][ <identifier>]"
where satellite_type is one of the following
"satellite", "microsatellite", "minisatellite"
Example /satellite="satellite: S1a"
/satellite="satellite: alpha"
/satellite="satellite: gamma III"
/satellite="microsatellite: DC130"
As of this October 2008 GenBank release, all satellite and repeat_unit
features have been transformed into repeat_region features with an
appropriate /satellite qualifier.
1.3.4 New /gene_synonym qualifier
Gene symbols are presented via the /gene qualifier. When synonymous or
alternative gene symbols are available, they have often been presented via
multiple /gene qualifiers.
To distinguish what might be an approved or official gene symbol from its
synonyms or alternatives, a new /gene_synonym qualifier has been introduced
for GenBank Release 168.0 .
Qualifier /gene_synonym=
Definition synonymous or alternative symbol for a gene corresponding to
a sequence region
Value format "text"
Examples /gene="CF"
/gene="ABCC7"
1.3.5 New /mating_type qualifier
Because the /sex qualifier has a free-text value format, is has been
innapropriately utilized for certain organisms, such as bacteria, fungi,
and some insects and worms. In such cases, a more appropriate term would
be 'mating type'.
A new qualifier has been made available for non-sexual reproductive
strategies as of October 2008:
Qualifier /mating_type=
Definition mating type of the organism from which the sequence was
obtained; mating type is used for prokaryotes, and for
eukaryotes that undergo meiosis without sexually dimorphic
gametes
Value format "text"
Examples /mating_type="MAT-1"
/mating_type="plus"
/mating_type="-"
/mating_type="odd"
/mating_type="even"
Comment /mating_type="male" and /mating_type="female" are
valid in the prokaryotes, but not in the eukaryotes;
for more information, see the entry for /sex.
In light of the above, the definition for the /sex qualifier has been
refined:
Qualifier /sex=
Definition sex of the organism from which the sequence was obtained;
sex is used for eukaryotic organisms that undergo meiosis
and have sexually dimorphic gametes
Value format "text"
Examples /sex="female"
/sex="male"
/sex="hermaphrodite"
/sex="unisexual"
/sex="bisexual"
/sex="asexual"
/sex="monoecious" [or monecious]
/sex="dioecious" [or diecious]
Comment /sex should be used (instead of /mating_type)
in the Metazoa, Embryophyta, Rhodophyta & Phaeophyceae;
/mating_type should be used (instead of /sex)
in the Bacteria, Archaea & Fungi;
neither /sex nor /mating_type should be used
in the viruses;
outside of the taxa listed above, /mating_type
should be used unless the value of the qualifier
is taken from the vocabulary given in the examples
above
Records which inappropriately used the /sex qualifier have been updated,
to utilize the new /mating_type qualifier.
1.3.6 Renaming of /specific_host as /host
The /specific_host qualifier has been renamed as /host for Release 168.0 .
From the Feature Table document:
Qualifier /host=
Definition natural (as opposed to laboratory) host to the organism from
which sequenced molecule was obtained
Value format "text"
Example /host="Homo sapiens"
/host="Homo sapiens 12 year old girl"
/host="Rhizobium NGR234"
In contrast:
Qualifier /lab_host=
Definition scientific name of the laboratory host used to propagate the
source organism from which the sequenced molecule was obtained
Value format "text"
Example /lab_host="Gallus gallus"
/lab_host="Gallus gallus embryo"
/lab_host="Escherichia coli strain DH5 alpha"
/lab_host="Homo sapiens HeLa cells"
Comment the full binomial scientific name of the host organism should
be used when known; extra conditional information relating to
the host may also be included
1.3.7 New value for /organelle
As of October 2008, the list of allowed values for /organelle has been expanded
to include:
/organelle="chromatophore"
1.3.8 Modification to value format for /frequency
As of October 2008, the definition of /frequency has been expanded to
accomodate both the fraction of a population carrying a variation expressed
as a decimal value, and as the number of observed instances vs. the total
number of sequenced isolates:
Qualifier /frequency=
Definition frequency of the occurrence of a feature
Value format text representing the proportion of a population carrying the
feature expressed as a fraction
Example /frequency="23/108"
/frequency="1 in 12"
/frequency=".85"
1.3.9 /cons_splice qualifier removed
The /cons_splice qualifier has almost no usage within the sequence
database. In addition, it does not account for the variation in splice
signals that might be used by different classes of introns. So this
qualfier has been removed from sequence records, and the Feature Table
document, as of Release 168.0 .
1.3.10 /virion qualifier removed
The intent of /virion was to indicate that a sequenced molecule
originates from an encapsidated viral particle (as opposed to the
proviral form of a virus, integrated into the host's genome). Viral
sequences derived from a blood sample taken from an infected organism
might be flagged with /virion, if it is believed that the sample
contained viral particles.
However, a review of the database revealed that /virion was not
used consistently, and furthermore, submitters are often unable to
conclusively state that a virus sequence derives from the encapsidated
form. So the /virion qualifier has been removed from sequence records,
and the Feature Table document, as of Release 168.0 .
1.3.11 Updated value format for /exception
Only three values for the /exception qualifier have been approved
for use by the INSDC :
"rearrangement required for product"
"RNA editing"
"reasons given in citation"
However, the definition of /exception in the Feature Table document
does not indicate that the contents of /exception are controlled.
This oversight has been corrected, and the definition of the qualifier
is now:
Qualifier /exception=
Definition indicates that the coding region cannot be translated using
standard biological rules
Value format "RNA editing", "reasons given in citation",
"rearrangement required for product"
Example /exception="RNA editing"
/exception="reasons given in citation"
/exception="rearrangement required for product"
Comment only to be used to describe biological mechanisms such
as RNA editing; where the exception cannot easily be described
a published citation must be referred to; protein translation of
/exception CDS will be different from the according conceptual
translation;
- must not be used where transl_except would be adequate,
e.g. in case of stop codon completion use:
/transl_except=(pos:6883,aa:TERM)
/note="TAA stop codon is completed by addition of 3' A residues to
mRNA".
- must not be used for ribosomal slippage, instead use join operator,
e.g.: CDS join(486..1784,1787..4810)
/note="ribosomal slip on tttt sequence at 1784..1787"
1.3.12 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.13 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
sixty of the GSS flatfiles in Release 168.0. Consider gbgss250.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
October 15 2008
NCBI-GenBank Flat File Release 168.0
GSS Sequences (Part 1)
87217 loci, 64373883 bases, from 87217 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "250" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 PROJECT linetype to be replaced by DBLINK (April 2009)
The PROJECT linetype allows a sequence record to be linked to information
about the sequencing project that generated the data which ultimately
resulted in the record's submission to the International Nucleotide Sequence
Database ( INSD; see http://www.insdc.org ) .
This complete bacterial GenBank record illustrates the use of the PROJECT
line:
LOCUS CP000964 5641239 bp DNA circular BCT 24-SEP-2008
DEFINITION Klebsiella pneumoniae 342, complete genome.
ACCESSION CP000964
VERSION CP000964.1 GI:206564770
PROJECT GenomeProject:28471
When viewed on the web in NCBI's Entrez:Nucleotide, the record's project
identifier (28471) links to an entry in the Genome Project Database (GPDB) :
http://www.ncbi.nlm.nih.gov/sites/entrez?db=genomeprj&cmd=Retrieve&dopt=Overview&uid=28471
where information about the sequencing center, the bacterium, and other
GenBank records (eg, plasmids) associated with the sequencing project
can be found.
Since the introduction of PROJECT, the scope of the "Genome" Project
Database has expanded, to include projects that are not necessarily targetted
to the sequencing of a complete genome.
In addition, there can be other resources which underlie an INSD sequence
record, such as the Trace Assembly Archive at the NCBI:
http://www.ncbi.nlm.nih.gov/Traces/assembly/assmbrowser.cgi?cmd=show&f=tree&m=main&s=tree
Because of the expanded scope of the GPDB, and because we anticipate a need
to link to more resources than just the GPDB, the PROJECT linetype is going to
be replaced by a new linetype:
DBLINK
Modifications to linetypes can be disruptive, so the switch to DBLINK
will occur in several stages. Starting in October 2008, links to the
NCBI Trace Assembly Archive will be supported via a line of text in the
COMMENT section of sequence records. Here is a mock-up, based on CP000964,
to illustrate this change:
LOCUS CP000964 5641239 bp DNA circular BCT 24-SEP-2008
DEFINITION Klebsiella pneumoniae 342, complete genome.
ACCESSION CP000964
VERSION CP000964.1 GI:206564770
PROJECT GenomeProject:28471
....
COMMENT Trace Assembly Archive:123456
The source for the DNA and/or cells is: Professor Eric W.
Triplett, Chair, Department of Microbiology and Cell Science,
Institute of Food and Agricultural Sciences, University of Florida,
P.O. Box 110700, Gainesville, FL 32611-0700, [email protected].
Note: Use of the Trace Assembly Archive is still in its early stages, so only
a few records are expected to have these links in the short term.
The new DBLINK linetype will be introduced as of GenBank Release 170.0 ,
on or near February 15, 2009 .
The Genome Project ID and the Trace Assembly Archive ID will be presented
via DBLINK, and the existing PROJECT line will continue to be displayed:
LOCUS CP000964 5641239 bp DNA circular BCT 24-SEP-2008
DEFINITION Klebsiella pneumoniae 342, complete genome.
ACCESSION CP000964
VERSION CP000964.1 GI:206564770
PROJECT GenomeProject:28471
DBLINK Project:28471
Trace Assembly Archive:123456
....
COMMENT The source for the DNA and/or cells is: Professor Eric W.
Triplett, Chair, Department of Microbiology and Cell Science,
Institute of Food and Agricultural Sciences, University of Florida,
P.O. Box 110700, Gainesville, FL 32611-0700, [email protected].
PROJECT and DBLINK will co-exist for one GenBank release, until Release 171.0
(April 15, 2009), at which point the PROJECT line will be removed. In its final
state, our mock-up for CP000964 becomes:
LOCUS CP000964 5641239 bp DNA circular BCT 24-SEP-2008
DEFINITION Klebsiella pneumoniae 342, complete genome.
ACCESSION CP000964
VERSION CP000964.1 GI:206564770
DBLINK Project:28471
Trace Assembly Archive:123456
....
COMMENT The source for the DNA and/or cells is: Professor Eric W.
Triplett, Chair, Department of Microbiology and Cell Science,
Institute of Food and Agricultural Sciences, University of Florida,
P.O. Box 110700, Gainesville, FL 32611-0700, [email protected].
In summary: The PROJECT linetype will be replaced by DBLINK as of
Release 171.0 in April 2009.
For those who process sequence data in NCBI's ASN.1 format: The
underlying representation for (Genome) Project IDs will remain unchanged.
There will be no changes to the ASN.1 User-object that is used to store them:
user {
type
str "GenomeProjectsDB" ,
data {
{
label
str "ProjectID" ,
data
int 28471 } ,
{
label
str "ParentID" ,
data
int 0 } } } ,
However, to support linkages to other resources, such as the Trace
Assembly Archive, a new "DBLink" User-object will be introduced:
user {
type
str "DBLink" ,
data {
{
label
str "Trace Assembly Archive" ,
data
ints { 123456 } } } }
As new types of linkages are established, they will be added to
the DBLink User-object, and displayed via the DBLINK linetype in
the GenBank flatfile format.
There is a possibility that the GenomeProjectsDB User-object
might someday be incorporated into the new DBLink User-object.
But at the moment, there are no firm plans to do so.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1678 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut7.idx - Index of the entries according to author name, part 7.
61. gbaut8.idx - Index of the entries according to author name, part 8.
62. gbaut9.idx - Index of the entries according to author name, part 9.
63. gbbct1.seq - Bacterial sequence entries, part 1.
64. gbbct10.seq - Bacterial sequence entries, part 10.
65. gbbct11.seq - Bacterial sequence entries, part 11.
66. gbbct12.seq - Bacterial sequence entries, part 12.
67. gbbct13.seq - Bacterial sequence entries, part 13.
68. gbbct14.seq - Bacterial sequence entries, part 14.
69. gbbct15.seq - Bacterial sequence entries, part 15.
70. gbbct16.seq - Bacterial sequence entries, part 16.
71. gbbct17.seq - Bacterial sequence entries, part 17.
72. gbbct18.seq - Bacterial sequence entries, part 18.
73. gbbct19.seq - Bacterial sequence entries, part 19.
74. gbbct2.seq - Bacterial sequence entries, part 2.
75. gbbct20.seq - Bacterial sequence entries, part 20.
76. gbbct21.seq - Bacterial sequence entries, part 21.
77. gbbct22.seq - Bacterial sequence entries, part 22.
78. gbbct23.seq - Bacterial sequence entries, part 23.
79. gbbct24.seq - Bacterial sequence entries, part 24.
80. gbbct25.seq - Bacterial sequence entries, part 25.
81. gbbct26.seq - Bacterial sequence entries, part 26.
82. gbbct27.seq - Bacterial sequence entries, part 27.
83. gbbct28.seq - Bacterial sequence entries, part 28.
84. gbbct29.seq - Bacterial sequence entries, part 29.
85. gbbct3.seq - Bacterial sequence entries, part 3.
86. gbbct30.seq - Bacterial sequence entries, part 30.
87. gbbct31.seq - Bacterial sequence entries, part 31.
88. gbbct32.seq - Bacterial sequence entries, part 32.
89. gbbct4.seq - Bacterial sequence entries, part 4.
90. gbbct5.seq - Bacterial sequence entries, part 5.
91. gbbct6.seq - Bacterial sequence entries, part 6.
92. gbbct7.seq - Bacterial sequence entries, part 7.
93. gbbct8.seq - Bacterial sequence entries, part 8.
94. gbbct9.seq - Bacterial sequence entries, part 9.
95. gbchg.txt - Accession numbers of entries updated since the previous release.
96. gbcon1.seq - Constructed sequence entries, part 1.
97. gbcon10.seq - Constructed sequence entries, part 10.
98. gbcon100.seq - Constructed sequence entries, part 100.
99. gbcon101.seq - Constructed sequence entries, part 101.
100. gbcon102.seq - Constructed sequence entries, part 102.
101. gbcon103.seq - Constructed sequence entries, part 103.
102. gbcon11.seq - Constructed sequence entries, part 11.
103. gbcon12.seq - Constructed sequence entries, part 12.
104. gbcon13.seq - Constructed sequence entries, part 13.
105. gbcon14.seq - Constructed sequence entries, part 14.
106. gbcon15.seq - Constructed sequence entries, part 15.
107. gbcon16.seq - Constructed sequence entries, part 16.
108. gbcon17.seq - Constructed sequence entries, part 17.
109. gbcon18.seq - Constructed sequence entries, part 18.
110. gbcon19.seq - Constructed sequence entries, part 19.
111. gbcon2.seq - Constructed sequence entries, part 2.
112. gbcon20.seq - Constructed sequence entries, part 20.
113. gbcon21.seq - Constructed sequence entries, part 21.
114. gbcon22.seq - Constructed sequence entries, part 22.
115. gbcon23.seq - Constructed sequence entries, part 23.
116. gbcon24.seq - Constructed sequence entries, part 24.
117. gbcon25.seq - Constructed sequence entries, part 25.
118. gbcon26.seq - Constructed sequence entries, part 26.
119. gbcon27.seq - Constructed sequence entries, part 27.
120. gbcon28.seq - Constructed sequence entries, part 28.
121. gbcon29.seq - Constructed sequence entries, part 29.
122. gbcon3.seq - Constructed sequence entries, part 3.
123. gbcon30.seq - Constructed sequence entries, part 30.
124. gbcon31.seq - Constructed sequence entries, part 31.
125. gbcon32.seq - Constructed sequence entries, part 32.
126. gbcon33.seq - Constructed sequence entries, part 33.
127. gbcon34.seq - Constructed sequence entries, part 34.
128. gbcon35.seq - Constructed sequence entries, part 35.
129. gbcon36.seq - Constructed sequence entries, part 36.
130. gbcon37.seq - Constructed sequence entries, part 37.
131. gbcon38.seq - Constructed sequence entries, part 38.
132. gbcon39.seq - Constructed sequence entries, part 39.
133. gbcon4.seq - Constructed sequence entries, part 4.
134. gbcon40.seq - Constructed sequence entries, part 40.
135. gbcon41.seq - Constructed sequence entries, part 41.
136. gbcon42.seq - Constructed sequence entries, part 42.
137. gbcon43.seq - Constructed sequence entries, part 43.
138. gbcon44.seq - Constructed sequence entries, part 44.
139. gbcon45.seq - Constructed sequence entries, part 45.
140. gbcon46.seq - Constructed sequence entries, part 46.
141. gbcon47.seq - Constructed sequence entries, part 47.
142. gbcon48.seq - Constructed sequence entries, part 48.
143. gbcon49.seq - Constructed sequence entries, part 49.
144. gbcon5.seq - Constructed sequence entries, part 5.
145. gbcon50.seq - Constructed sequence entries, part 50.
146. gbcon51.seq - Constructed sequence entries, part 51.
147. gbcon52.seq - Constructed sequence entries, part 52.
148. gbcon53.seq - Constructed sequence entries, part 53.
149. gbcon54.seq - Constructed sequence entries, part 54.
150. gbcon55.seq - Constructed sequence entries, part 55.
151. gbcon56.seq - Constructed sequence entries, part 56.
152. gbcon57.seq - Constructed sequence entries, part 57.
153. gbcon58.seq - Constructed sequence entries, part 58.
154. gbcon59.seq - Constructed sequence entries, part 59.
155. gbcon6.seq - Constructed sequence entries, part 6.
156. gbcon60.seq - Constructed sequence entries, part 60.
157. gbcon61.seq - Constructed sequence entries, part 61.
158. gbcon62.seq - Constructed sequence entries, part 62.
159. gbcon63.seq - Constructed sequence entries, part 63.
160. gbcon64.seq - Constructed sequence entries, part 64.
161. gbcon65.seq - Constructed sequence entries, part 65.
162. gbcon66.seq - Constructed sequence entries, part 66.
163. gbcon67.seq - Constructed sequence entries, part 67.
164. gbcon68.seq - Constructed sequence entries, part 68.
165. gbcon69.seq - Constructed sequence entries, part 69.
166. gbcon7.seq - Constructed sequence entries, part 7.
167. gbcon70.seq - Constructed sequence entries, part 70.
168. gbcon71.seq - Constructed sequence entries, part 71.
169. gbcon72.seq - Constructed sequence entries, part 72.
170. gbcon73.seq - Constructed sequence entries, part 73.
171. gbcon74.seq - Constructed sequence entries, part 74.
172. gbcon75.seq - Constructed sequence entries, part 75.
173. gbcon76.seq - Constructed sequence entries, part 76.
174. gbcon77.seq - Constructed sequence entries, part 77.
175. gbcon78.seq - Constructed sequence entries, part 78.
176. gbcon79.seq - Constructed sequence entries, part 79.
177. gbcon8.seq - Constructed sequence entries, part 8.
178. gbcon80.seq - Constructed sequence entries, part 80.
179. gbcon81.seq - Constructed sequence entries, part 81.
180. gbcon82.seq - Constructed sequence entries, part 82.
181. gbcon83.seq - Constructed sequence entries, part 83.
182. gbcon84.seq - Constructed sequence entries, part 84.
183. gbcon85.seq - Constructed sequence entries, part 85.
184. gbcon86.seq - Constructed sequence entries, part 86.
185. gbcon87.seq - Constructed sequence entries, part 87.
186. gbcon88.seq - Constructed sequence entries, part 88.
187. gbcon89.seq - Constructed sequence entries, part 89.
188. gbcon9.seq - Constructed sequence entries, part 9.
189. gbcon90.seq - Constructed sequence entries, part 90.
190. gbcon91.seq - Constructed sequence entries, part 91.
191. gbcon92.seq - Constructed sequence entries, part 92.
192. gbcon93.seq - Constructed sequence entries, part 93.
193. gbcon94.seq - Constructed sequence entries, part 94.
194. gbcon95.seq - Constructed sequence entries, part 95.
195. gbcon96.seq - Constructed sequence entries, part 96.
196. gbcon97.seq - Constructed sequence entries, part 97.
197. gbcon98.seq - Constructed sequence entries, part 98.
198. gbcon99.seq - Constructed sequence entries, part 99.
199. gbdel.txt - Accession numbers of entries deleted since the previous release.
200. gbenv1.seq - Environmental sampling sequence entries, part 1.
201. gbenv10.seq - Environmental sampling sequence entries, part 10.
202. gbenv2.seq - Environmental sampling sequence entries, part 2.
203. gbenv3.seq - Environmental sampling sequence entries, part 3.
204. gbenv4.seq - Environmental sampling sequence entries, part 4.
205. gbenv5.seq - Environmental sampling sequence entries, part 5.
206. gbenv6.seq - Environmental sampling sequence entries, part 6.
207. gbenv7.seq - Environmental sampling sequence entries, part 7.
208. gbenv8.seq - Environmental sampling sequence entries, part 8.
209. gbenv9.seq - Environmental sampling sequence entries, part 9.
210. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
211. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
212. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
213. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
214. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
215. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
216. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
217. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
218. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
219. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
220. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
221. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
222. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
223. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
224. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
225. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
226. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
227. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
228. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
229. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
230. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
231. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
232. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
233. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
234. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
235. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
236. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
237. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
238. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
239. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
240. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
241. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
242. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
243. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
244. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
245. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
246. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
247. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
248. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
249. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
250. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
251. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
252. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
253. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
254. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
255. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
256. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
257. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
258. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
259. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
260. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
261. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
262. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
263. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
264. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
265. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
266. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
267. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
268. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
269. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
270. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
271. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
272. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
273. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
274. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
275. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
276. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
277. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
278. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
279. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
280. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
281. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
282. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
283. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
284. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
285. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
286. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
287. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
288. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
289. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
290. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
291. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
292. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
293. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
294. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
295. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
296. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
297. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
298. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
299. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
300. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
301. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
302. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
303. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
304. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
305. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
306. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
307. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
308. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
309. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
310. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
311. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
312. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
313. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
314. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
315. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
316. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
317. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
318. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
319. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
320. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
321. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
322. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
323. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
324. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
325. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
326. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
327. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
328. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
329. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
330. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
331. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
332. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
333. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
334. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
335. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
336. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
337. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
338. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
339. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
340. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
341. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
342. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
343. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
344. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
345. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
346. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
347. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
348. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
349. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
350. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
351. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
352. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
353. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
354. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
355. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
356. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
357. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
358. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
359. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
360. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
361. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
362. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
363. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
364. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
365. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
366. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
367. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
368. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
369. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
370. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
371. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
372. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
373. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
374. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
375. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
376. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
377. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
378. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
379. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
380. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
381. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
382. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
383. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
384. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
385. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
386. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
387. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
388. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
389. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
390. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
391. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
392. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
393. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
394. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
395. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
396. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
397. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
398. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
399. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
400. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
401. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
402. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
403. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
404. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
405. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
406. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
407. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
408. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
409. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
410. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
411. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
412. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
413. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
414. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
415. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
416. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
417. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
418. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
419. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
420. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
421. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
422. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
423. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
424. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
425. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
426. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
427. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
428. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
429. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
430. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
431. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
432. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
433. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
434. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
435. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
436. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
437. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
438. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
439. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
440. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
441. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
442. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
443. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
444. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
445. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
446. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
447. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
448. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
449. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
450. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
451. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
452. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
453. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
454. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
455. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
456. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
457. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
458. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
459. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
460. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
461. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
462. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
463. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
464. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
465. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
466. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
467. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
468. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
469. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
470. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
471. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
472. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
473. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
474. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
475. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
476. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
477. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
478. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
479. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
480. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
481. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
482. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
483. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
484. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
485. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
486. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
487. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
488. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
489. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
490. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
491. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
492. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
493. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
494. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
495. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
496. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
497. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
498. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
499. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
500. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
501. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
502. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
503. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
504. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
505. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
506. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
507. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
508. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
509. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
510. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
511. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
512. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
513. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
514. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
515. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
516. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
517. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
518. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
519. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
520. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
521. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
522. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
523. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
524. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
525. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
526. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
527. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
528. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
529. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
530. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
531. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
532. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
533. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
534. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
535. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
536. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
537. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
538. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
539. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
540. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
541. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
542. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
543. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
544. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
545. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
546. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
547. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
548. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
549. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
550. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
551. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
552. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
553. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
554. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
555. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
556. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
557. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
558. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
559. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
560. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
561. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
562. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
563. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
564. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
565. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
566. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
567. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
568. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
569. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
570. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
571. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
572. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
573. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
574. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
575. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
576. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
577. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
578. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
579. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
580. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
581. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
582. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
583. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
584. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
585. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
586. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
587. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
588. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
589. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
590. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
591. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
592. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
593. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
594. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
595. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
596. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
597. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
598. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
599. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
600. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
601. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
602. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
603. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
604. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
605. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
606. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
607. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
608. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
609. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
610. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
611. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
612. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
613. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
614. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
615. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
616. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
617. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
618. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
619. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
620. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
621. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
622. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
623. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
624. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
625. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
626. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
627. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
628. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
629. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
630. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
631. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
632. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
633. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
634. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
635. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
636. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
637. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
638. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
639. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
640. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
641. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
642. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
643. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
644. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
645. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
646. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
647. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
648. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
649. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
650. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
651. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
652. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
653. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
654. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
655. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
656. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
657. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
658. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
659. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
660. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
661. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
662. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
663. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
664. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
665. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
666. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
667. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
668. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
669. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
670. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
671. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
672. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
673. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
674. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
675. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
676. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
677. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
678. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
679. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
680. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
681. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
682. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
683. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
684. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
685. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
686. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
687. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
688. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
689. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
690. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
691. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
692. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
693. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
694. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
695. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
696. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
697. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
698. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
699. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
700. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
701. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
702. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
703. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
704. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
705. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
706. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
707. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
708. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
709. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
710. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
711. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
712. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
713. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
714. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
715. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
716. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
717. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
718. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
719. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
720. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
721. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
722. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
723. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
724. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
725. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
726. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
727. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
728. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
729. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
730. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
731. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
732. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
733. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
734. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
735. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
736. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
737. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
738. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
739. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
740. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
741. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
742. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
743. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
744. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
745. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
746. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
747. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
748. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
749. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
750. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
751. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
752. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
753. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
754. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
755. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
756. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
757. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
758. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
759. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
760. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
761. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
762. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
763. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
764. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
765. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
766. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
767. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
768. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
769. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
770. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
771. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
772. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
773. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
774. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
775. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
776. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
777. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
778. gbest610.seq - EST (expressed sequence tag) sequence entries, part 610.
779. gbest611.seq - EST (expressed sequence tag) sequence entries, part 611.
780. gbest612.seq - EST (expressed sequence tag) sequence entries, part 612.
781. gbest613.seq - EST (expressed sequence tag) sequence entries, part 613.
782. gbest614.seq - EST (expressed sequence tag) sequence entries, part 614.
783. gbest615.seq - EST (expressed sequence tag) sequence entries, part 615.
784. gbest616.seq - EST (expressed sequence tag) sequence entries, part 616.
785. gbest617.seq - EST (expressed sequence tag) sequence entries, part 617.
786. gbest618.seq - EST (expressed sequence tag) sequence entries, part 618.
787. gbest619.seq - EST (expressed sequence tag) sequence entries, part 619.
788. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
789. gbest620.seq - EST (expressed sequence tag) sequence entries, part 620.
790. gbest621.seq - EST (expressed sequence tag) sequence entries, part 621.
791. gbest622.seq - EST (expressed sequence tag) sequence entries, part 622.
792. gbest623.seq - EST (expressed sequence tag) sequence entries, part 623.
793. gbest624.seq - EST (expressed sequence tag) sequence entries, part 624.
794. gbest625.seq - EST (expressed sequence tag) sequence entries, part 625.
795. gbest626.seq - EST (expressed sequence tag) sequence entries, part 626.
796. gbest627.seq - EST (expressed sequence tag) sequence entries, part 627.
797. gbest628.seq - EST (expressed sequence tag) sequence entries, part 628.
798. gbest629.seq - EST (expressed sequence tag) sequence entries, part 629.
799. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
800. gbest630.seq - EST (expressed sequence tag) sequence entries, part 630.
801. gbest631.seq - EST (expressed sequence tag) sequence entries, part 631.
802. gbest632.seq - EST (expressed sequence tag) sequence entries, part 632.
803. gbest633.seq - EST (expressed sequence tag) sequence entries, part 633.
804. gbest634.seq - EST (expressed sequence tag) sequence entries, part 634.
805. gbest635.seq - EST (expressed sequence tag) sequence entries, part 635.
806. gbest636.seq - EST (expressed sequence tag) sequence entries, part 636.
807. gbest637.seq - EST (expressed sequence tag) sequence entries, part 637.
808. gbest638.seq - EST (expressed sequence tag) sequence entries, part 638.
809. gbest639.seq - EST (expressed sequence tag) sequence entries, part 639.
810. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
811. gbest640.seq - EST (expressed sequence tag) sequence entries, part 640.
812. gbest641.seq - EST (expressed sequence tag) sequence entries, part 641.
813. gbest642.seq - EST (expressed sequence tag) sequence entries, part 642.
814. gbest643.seq - EST (expressed sequence tag) sequence entries, part 643.
815. gbest644.seq - EST (expressed sequence tag) sequence entries, part 644.
816. gbest645.seq - EST (expressed sequence tag) sequence entries, part 645.
817. gbest646.seq - EST (expressed sequence tag) sequence entries, part 646.
818. gbest647.seq - EST (expressed sequence tag) sequence entries, part 647.
819. gbest648.seq - EST (expressed sequence tag) sequence entries, part 648.
820. gbest649.seq - EST (expressed sequence tag) sequence entries, part 649.
821. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
822. gbest650.seq - EST (expressed sequence tag) sequence entries, part 650.
823. gbest651.seq - EST (expressed sequence tag) sequence entries, part 651.
824. gbest652.seq - EST (expressed sequence tag) sequence entries, part 652.
825. gbest653.seq - EST (expressed sequence tag) sequence entries, part 653.
826. gbest654.seq - EST (expressed sequence tag) sequence entries, part 654.
827. gbest655.seq - EST (expressed sequence tag) sequence entries, part 655.
828. gbest656.seq - EST (expressed sequence tag) sequence entries, part 656.
829. gbest657.seq - EST (expressed sequence tag) sequence entries, part 657.
830. gbest658.seq - EST (expressed sequence tag) sequence entries, part 658.
831. gbest659.seq - EST (expressed sequence tag) sequence entries, part 659.
832. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
833. gbest660.seq - EST (expressed sequence tag) sequence entries, part 660.
834. gbest661.seq - EST (expressed sequence tag) sequence entries, part 661.
835. gbest662.seq - EST (expressed sequence tag) sequence entries, part 662.
836. gbest663.seq - EST (expressed sequence tag) sequence entries, part 663.
837. gbest664.seq - EST (expressed sequence tag) sequence entries, part 664.
838. gbest665.seq - EST (expressed sequence tag) sequence entries, part 665.
839. gbest666.seq - EST (expressed sequence tag) sequence entries, part 666.
840. gbest667.seq - EST (expressed sequence tag) sequence entries, part 667.
841. gbest668.seq - EST (expressed sequence tag) sequence entries, part 668.
842. gbest669.seq - EST (expressed sequence tag) sequence entries, part 669.
843. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
844. gbest670.seq - EST (expressed sequence tag) sequence entries, part 670.
845. gbest671.seq - EST (expressed sequence tag) sequence entries, part 671.
846. gbest672.seq - EST (expressed sequence tag) sequence entries, part 672.
847. gbest673.seq - EST (expressed sequence tag) sequence entries, part 673.
848. gbest674.seq - EST (expressed sequence tag) sequence entries, part 674.
849. gbest675.seq - EST (expressed sequence tag) sequence entries, part 675.
850. gbest676.seq - EST (expressed sequence tag) sequence entries, part 676.
851. gbest677.seq - EST (expressed sequence tag) sequence entries, part 677.
852. gbest678.seq - EST (expressed sequence tag) sequence entries, part 678.
853. gbest679.seq - EST (expressed sequence tag) sequence entries, part 679.
854. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
855. gbest680.seq - EST (expressed sequence tag) sequence entries, part 680.
856. gbest681.seq - EST (expressed sequence tag) sequence entries, part 681.
857. gbest682.seq - EST (expressed sequence tag) sequence entries, part 682.
858. gbest683.seq - EST (expressed sequence tag) sequence entries, part 683.
859. gbest684.seq - EST (expressed sequence tag) sequence entries, part 684.
860. gbest685.seq - EST (expressed sequence tag) sequence entries, part 685.
861. gbest686.seq - EST (expressed sequence tag) sequence entries, part 686.
862. gbest687.seq - EST (expressed sequence tag) sequence entries, part 687.
863. gbest688.seq - EST (expressed sequence tag) sequence entries, part 688.
864. gbest689.seq - EST (expressed sequence tag) sequence entries, part 689.
865. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
866. gbest690.seq - EST (expressed sequence tag) sequence entries, part 690.
867. gbest691.seq - EST (expressed sequence tag) sequence entries, part 691.
868. gbest692.seq - EST (expressed sequence tag) sequence entries, part 692.
869. gbest693.seq - EST (expressed sequence tag) sequence entries, part 693.
870. gbest694.seq - EST (expressed sequence tag) sequence entries, part 694.
871. gbest695.seq - EST (expressed sequence tag) sequence entries, part 695.
872. gbest696.seq - EST (expressed sequence tag) sequence entries, part 696.
873. gbest697.seq - EST (expressed sequence tag) sequence entries, part 697.
874. gbest698.seq - EST (expressed sequence tag) sequence entries, part 698.
875. gbest699.seq - EST (expressed sequence tag) sequence entries, part 699.
876. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
877. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
878. gbest700.seq - EST (expressed sequence tag) sequence entries, part 700.
879. gbest701.seq - EST (expressed sequence tag) sequence entries, part 701.
880. gbest702.seq - EST (expressed sequence tag) sequence entries, part 702.
881. gbest703.seq - EST (expressed sequence tag) sequence entries, part 703.
882. gbest704.seq - EST (expressed sequence tag) sequence entries, part 704.
883. gbest705.seq - EST (expressed sequence tag) sequence entries, part 705.
884. gbest706.seq - EST (expressed sequence tag) sequence entries, part 706.
885. gbest707.seq - EST (expressed sequence tag) sequence entries, part 707.
886. gbest708.seq - EST (expressed sequence tag) sequence entries, part 708.
887. gbest709.seq - EST (expressed sequence tag) sequence entries, part 709.
888. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
889. gbest710.seq - EST (expressed sequence tag) sequence entries, part 710.
890. gbest711.seq - EST (expressed sequence tag) sequence entries, part 711.
891. gbest712.seq - EST (expressed sequence tag) sequence entries, part 712.
892. gbest713.seq - EST (expressed sequence tag) sequence entries, part 713.
893. gbest714.seq - EST (expressed sequence tag) sequence entries, part 714.
894. gbest715.seq - EST (expressed sequence tag) sequence entries, part 715.
895. gbest716.seq - EST (expressed sequence tag) sequence entries, part 716.
896. gbest717.seq - EST (expressed sequence tag) sequence entries, part 717.
897. gbest718.seq - EST (expressed sequence tag) sequence entries, part 718.
898. gbest719.seq - EST (expressed sequence tag) sequence entries, part 719.
899. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
900. gbest720.seq - EST (expressed sequence tag) sequence entries, part 720.
901. gbest721.seq - EST (expressed sequence tag) sequence entries, part 721.
902. gbest722.seq - EST (expressed sequence tag) sequence entries, part 722.
903. gbest723.seq - EST (expressed sequence tag) sequence entries, part 723.
904. gbest724.seq - EST (expressed sequence tag) sequence entries, part 724.
905. gbest725.seq - EST (expressed sequence tag) sequence entries, part 725.
906. gbest726.seq - EST (expressed sequence tag) sequence entries, part 726.
907. gbest727.seq - EST (expressed sequence tag) sequence entries, part 727.
908. gbest728.seq - EST (expressed sequence tag) sequence entries, part 728.
909. gbest729.seq - EST (expressed sequence tag) sequence entries, part 729.
910. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
911. gbest730.seq - EST (expressed sequence tag) sequence entries, part 730.
912. gbest731.seq - EST (expressed sequence tag) sequence entries, part 731.
913. gbest732.seq - EST (expressed sequence tag) sequence entries, part 732.
914. gbest733.seq - EST (expressed sequence tag) sequence entries, part 733.
915. gbest734.seq - EST (expressed sequence tag) sequence entries, part 734.
916. gbest735.seq - EST (expressed sequence tag) sequence entries, part 735.
917. gbest736.seq - EST (expressed sequence tag) sequence entries, part 736.
918. gbest737.seq - EST (expressed sequence tag) sequence entries, part 737.
919. gbest738.seq - EST (expressed sequence tag) sequence entries, part 738.
920. gbest739.seq - EST (expressed sequence tag) sequence entries, part 739.
921. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
922. gbest740.seq - EST (expressed sequence tag) sequence entries, part 740.
923. gbest741.seq - EST (expressed sequence tag) sequence entries, part 741.
924. gbest742.seq - EST (expressed sequence tag) sequence entries, part 742.
925. gbest743.seq - EST (expressed sequence tag) sequence entries, part 743.
926. gbest744.seq - EST (expressed sequence tag) sequence entries, part 744.
927. gbest745.seq - EST (expressed sequence tag) sequence entries, part 745.
928. gbest746.seq - EST (expressed sequence tag) sequence entries, part 746.
929. gbest747.seq - EST (expressed sequence tag) sequence entries, part 747.
930. gbest748.seq - EST (expressed sequence tag) sequence entries, part 748.
931. gbest749.seq - EST (expressed sequence tag) sequence entries, part 749.
932. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
933. gbest750.seq - EST (expressed sequence tag) sequence entries, part 750.
934. gbest751.seq - EST (expressed sequence tag) sequence entries, part 751.
935. gbest752.seq - EST (expressed sequence tag) sequence entries, part 752.
936. gbest753.seq - EST (expressed sequence tag) sequence entries, part 753.
937. gbest754.seq - EST (expressed sequence tag) sequence entries, part 754.
938. gbest755.seq - EST (expressed sequence tag) sequence entries, part 755.
939. gbest756.seq - EST (expressed sequence tag) sequence entries, part 756.
940. gbest757.seq - EST (expressed sequence tag) sequence entries, part 757.
941. gbest758.seq - EST (expressed sequence tag) sequence entries, part 758.
942. gbest759.seq - EST (expressed sequence tag) sequence entries, part 759.
943. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
944. gbest760.seq - EST (expressed sequence tag) sequence entries, part 760.
945. gbest761.seq - EST (expressed sequence tag) sequence entries, part 761.
946. gbest762.seq - EST (expressed sequence tag) sequence entries, part 762.
947. gbest763.seq - EST (expressed sequence tag) sequence entries, part 763.
948. gbest764.seq - EST (expressed sequence tag) sequence entries, part 764.
949. gbest765.seq - EST (expressed sequence tag) sequence entries, part 765.
950. gbest766.seq - EST (expressed sequence tag) sequence entries, part 766.
951. gbest767.seq - EST (expressed sequence tag) sequence entries, part 767.
952. gbest768.seq - EST (expressed sequence tag) sequence entries, part 768.
953. gbest769.seq - EST (expressed sequence tag) sequence entries, part 769.
954. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
955. gbest770.seq - EST (expressed sequence tag) sequence entries, part 770.
956. gbest771.seq - EST (expressed sequence tag) sequence entries, part 771.
957. gbest772.seq - EST (expressed sequence tag) sequence entries, part 772.
958. gbest773.seq - EST (expressed sequence tag) sequence entries, part 773.
959. gbest774.seq - EST (expressed sequence tag) sequence entries, part 774.
960. gbest775.seq - EST (expressed sequence tag) sequence entries, part 775.
961. gbest776.seq - EST (expressed sequence tag) sequence entries, part 776.
962. gbest777.seq - EST (expressed sequence tag) sequence entries, part 777.
963. gbest778.seq - EST (expressed sequence tag) sequence entries, part 778.
964. gbest779.seq - EST (expressed sequence tag) sequence entries, part 779.
965. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
966. gbest780.seq - EST (expressed sequence tag) sequence entries, part 780.
967. gbest781.seq - EST (expressed sequence tag) sequence entries, part 781.
968. gbest782.seq - EST (expressed sequence tag) sequence entries, part 782.
969. gbest783.seq - EST (expressed sequence tag) sequence entries, part 783.
970. gbest784.seq - EST (expressed sequence tag) sequence entries, part 784.
971. gbest785.seq - EST (expressed sequence tag) sequence entries, part 785.
972. gbest786.seq - EST (expressed sequence tag) sequence entries, part 786.
973. gbest787.seq - EST (expressed sequence tag) sequence entries, part 787.
974. gbest788.seq - EST (expressed sequence tag) sequence entries, part 788.
975. gbest789.seq - EST (expressed sequence tag) sequence entries, part 789.
976. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
977. gbest790.seq - EST (expressed sequence tag) sequence entries, part 790.
978. gbest791.seq - EST (expressed sequence tag) sequence entries, part 791.
979. gbest792.seq - EST (expressed sequence tag) sequence entries, part 792.
980. gbest793.seq - EST (expressed sequence tag) sequence entries, part 793.
981. gbest794.seq - EST (expressed sequence tag) sequence entries, part 794.
982. gbest795.seq - EST (expressed sequence tag) sequence entries, part 795.
983. gbest796.seq - EST (expressed sequence tag) sequence entries, part 796.
984. gbest797.seq - EST (expressed sequence tag) sequence entries, part 797.
985. gbest798.seq - EST (expressed sequence tag) sequence entries, part 798.
986. gbest799.seq - EST (expressed sequence tag) sequence entries, part 799.
987. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
988. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
989. gbest800.seq - EST (expressed sequence tag) sequence entries, part 800.
990. gbest801.seq - EST (expressed sequence tag) sequence entries, part 801.
991. gbest802.seq - EST (expressed sequence tag) sequence entries, part 802.
992. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
993. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
994. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
995. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
996. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
997. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
998. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
999. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1000. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1001. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1002. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1003. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1004. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1005. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1006. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1007. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1008. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1009. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1010. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1011. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1012. gbgen.idx - Index of the entries according to gene symbols.
1013. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1014. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1015. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1016. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1017. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1018. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1019. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1020. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1021. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1022. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1023. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1024. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1025. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1026. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1027. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1028. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1029. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1030. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1031. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1032. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1033. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1034. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1035. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1036. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1037. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1038. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1039. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1040. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1041. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1042. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1043. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1044. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1045. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1046. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1047. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1048. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1049. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1050. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1051. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1052. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1053. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1054. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1055. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1056. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1057. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1058. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1059. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1060. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1061. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1062. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1063. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1064. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1065. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1066. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1067. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1068. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1069. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1070. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1071. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1072. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1073. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1074. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1075. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1076. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1077. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1078. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1079. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1080. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1081. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1082. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1083. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1084. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1085. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1086. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1087. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1088. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1089. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1090. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1091. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1092. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1093. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1094. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1095. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1096. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1097. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1098. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1099. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1100. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1101. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1102. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1103. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1104. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1105. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1106. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1107. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1108. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1109. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1110. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1111. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1112. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1113. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1114. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1115. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1116. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1117. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1118. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1119. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1120. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1121. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1122. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1123. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1124. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1125. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1126. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1127. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1128. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1129. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1130. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1131. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1132. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1133. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1134. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1135. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1136. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1137. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1138. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1139. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1140. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1141. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1142. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1143. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1144. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1145. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1146. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1147. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1148. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1149. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1150. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1151. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1152. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1153. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1154. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1155. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1156. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1157. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1158. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1159. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1160. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1161. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1162. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1163. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1164. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1165. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1166. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1167. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1168. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1169. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1170. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1171. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1172. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1173. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1174. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1175. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1176. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1177. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1178. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1179. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1180. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1181. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1182. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1183. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1184. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1185. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1186. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1187. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1188. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1189. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1190. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1191. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1192. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1193. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1194. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1195. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1196. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1197. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1198. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1199. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1200. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1201. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1202. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1203. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1204. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1205. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1206. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1207. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1208. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1209. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1210. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1211. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1212. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1213. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1214. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1215. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1216. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1217. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1218. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1219. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1220. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1221. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1222. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1223. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1224. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1225. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1226. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1227. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1228. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1229. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1230. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1231. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1232. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1233. gbgss298.seq - GSS (genome survey sequence) sequence entries, part 298.
1234. gbgss299.seq - GSS (genome survey sequence) sequence entries, part 299.
1235. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1236. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1237. gbgss300.seq - GSS (genome survey sequence) sequence entries, part 300.
1238. gbgss301.seq - GSS (genome survey sequence) sequence entries, part 301.
1239. gbgss302.seq - GSS (genome survey sequence) sequence entries, part 302.
1240. gbgss303.seq - GSS (genome survey sequence) sequence entries, part 303.
1241. gbgss304.seq - GSS (genome survey sequence) sequence entries, part 304.
1242. gbgss305.seq - GSS (genome survey sequence) sequence entries, part 305.
1243. gbgss306.seq - GSS (genome survey sequence) sequence entries, part 306.
1244. gbgss307.seq - GSS (genome survey sequence) sequence entries, part 307.
1245. gbgss308.seq - GSS (genome survey sequence) sequence entries, part 308.
1246. gbgss309.seq - GSS (genome survey sequence) sequence entries, part 309.
1247. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1248. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1249. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1250. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1251. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1252. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1253. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1254. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1255. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1256. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1257. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1258. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1259. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1260. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1261. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1262. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1263. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1264. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1265. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1266. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1267. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1268. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1269. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1270. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1271. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1272. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1273. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1274. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1275. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1276. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1277. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1278. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1279. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1280. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1281. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1282. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1283. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1284. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1285. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1286. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1287. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1288. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1289. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1290. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1291. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1292. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1293. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1294. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1295. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1296. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1297. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1298. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1299. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1300. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1301. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1302. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1303. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1304. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1305. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1306. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1307. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1308. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1309. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1310. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1311. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1312. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1313. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1314. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1315. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1316. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1317. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1318. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1319. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1320. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1321. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1322. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1323. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1324. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1325. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1326. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1327. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1328. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1329. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1330. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1331. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1332. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1333. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1334. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1335. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1336. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1337. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1338. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1339. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1340. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1341. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1342. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1343. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1344. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1345. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1346. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1347. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1348. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1349. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1350. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1351. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1352. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1353. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1354. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1355. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1356. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1357. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1358. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1359. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1360. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1361. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1362. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1363. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1364. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1365. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1366. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1367. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1368. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1369. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1370. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1371. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1372. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1373. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1374. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1375. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1376. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1377. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1378. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1379. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1380. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1381. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1382. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1383. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1384. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1385. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1386. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1387. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1388. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1389. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1390. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1391. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1392. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1393. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1394. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1395. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1396. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1397. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1398. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1399. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1400. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1401. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1402. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1403. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1404. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1405. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1406. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1407. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1408. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1409. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1410. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1411. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1412. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1413. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1414. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1415. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1416. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1417. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1418. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1419. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1420. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1421. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1422. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1423. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1424. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1425. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1426. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1427. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1428. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1429. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1430. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1431. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1432. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1433. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1434. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1435. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1436. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1437. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1438. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1439. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1440. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1441. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1442. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1443. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1444. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1445. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1446. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1447. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1448. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1449. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1450. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1451. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1452. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1453. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1454. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1455. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1456. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1457. gbinv1.seq - Invertebrate sequence entries, part 1.
1458. gbinv10.seq - Invertebrate sequence entries, part 10.
1459. gbinv11.seq - Invertebrate sequence entries, part 11.
1460. gbinv12.seq - Invertebrate sequence entries, part 12.
1461. gbinv13.seq - Invertebrate sequence entries, part 13.
1462. gbinv2.seq - Invertebrate sequence entries, part 2.
1463. gbinv3.seq - Invertebrate sequence entries, part 3.
1464. gbinv4.seq - Invertebrate sequence entries, part 4.
1465. gbinv5.seq - Invertebrate sequence entries, part 5.
1466. gbinv6.seq - Invertebrate sequence entries, part 6.
1467. gbinv7.seq - Invertebrate sequence entries, part 7.
1468. gbinv8.seq - Invertebrate sequence entries, part 8.
1469. gbinv9.seq - Invertebrate sequence entries, part 9.
1470. gbjou1.idx - Index of the entries according to journal citation, part 1.
1471. gbjou2.idx - Index of the entries according to journal citation, part 2.
1472. gbjou3.idx - Index of the entries according to journal citation, part 3.
1473. gbjou4.idx - Index of the entries according to journal citation, part 4.
1474. gbjou5.idx - Index of the entries according to journal citation, part 5.
1475. gbjou6.idx - Index of the entries according to journal citation, part 6.
1476. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1477. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1478. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1479. gbmam1.seq - Other mammalian sequence entries, part 1.
1480. gbmam2.seq - Other mammalian sequence entries, part 2.
1481. gbmam3.seq - Other mammalian sequence entries, part 3.
1482. gbmam4.seq - Other mammalian sequence entries, part 4.
1483. gbnew.txt - Accession numbers of entries new since the previous release.
1484. gbpat1.seq - Patent sequence entries, part 1.
1485. gbpat10.seq - Patent sequence entries, part 10.
1486. gbpat11.seq - Patent sequence entries, part 11.
1487. gbpat12.seq - Patent sequence entries, part 12.
1488. gbpat13.seq - Patent sequence entries, part 13.
1489. gbpat14.seq - Patent sequence entries, part 14.
1490. gbpat15.seq - Patent sequence entries, part 15.
1491. gbpat16.seq - Patent sequence entries, part 16.
1492. gbpat17.seq - Patent sequence entries, part 17.
1493. gbpat18.seq - Patent sequence entries, part 18.
1494. gbpat19.seq - Patent sequence entries, part 19.
1495. gbpat2.seq - Patent sequence entries, part 2.
1496. gbpat20.seq - Patent sequence entries, part 20.
1497. gbpat21.seq - Patent sequence entries, part 21.
1498. gbpat22.seq - Patent sequence entries, part 22.
1499. gbpat23.seq - Patent sequence entries, part 23.
1500. gbpat24.seq - Patent sequence entries, part 24.
1501. gbpat25.seq - Patent sequence entries, part 25.
1502. gbpat26.seq - Patent sequence entries, part 26.
1503. gbpat27.seq - Patent sequence entries, part 27.
1504. gbpat28.seq - Patent sequence entries, part 28.
1505. gbpat29.seq - Patent sequence entries, part 29.
1506. gbpat3.seq - Patent sequence entries, part 3.
1507. gbpat30.seq - Patent sequence entries, part 30.
1508. gbpat31.seq - Patent sequence entries, part 31.
1509. gbpat32.seq - Patent sequence entries, part 32.
1510. gbpat33.seq - Patent sequence entries, part 33.
1511. gbpat34.seq - Patent sequence entries, part 34.
1512. gbpat35.seq - Patent sequence entries, part 35.
1513. gbpat36.seq - Patent sequence entries, part 36.
1514. gbpat37.seq - Patent sequence entries, part 37.
1515. gbpat38.seq - Patent sequence entries, part 38.
1516. gbpat39.seq - Patent sequence entries, part 39.
1517. gbpat4.seq - Patent sequence entries, part 4.
1518. gbpat40.seq - Patent sequence entries, part 40.
1519. gbpat41.seq - Patent sequence entries, part 41.
1520. gbpat42.seq - Patent sequence entries, part 42.
1521. gbpat43.seq - Patent sequence entries, part 43.
1522. gbpat44.seq - Patent sequence entries, part 44.
1523. gbpat45.seq - Patent sequence entries, part 45.
1524. gbpat46.seq - Patent sequence entries, part 46.
1525. gbpat47.seq - Patent sequence entries, part 47.
1526. gbpat5.seq - Patent sequence entries, part 5.
1527. gbpat6.seq - Patent sequence entries, part 6.
1528. gbpat7.seq - Patent sequence entries, part 7.
1529. gbpat8.seq - Patent sequence entries, part 8.
1530. gbpat9.seq - Patent sequence entries, part 9.
1531. gbphg.seq - Phage sequence entries.
1532. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1533. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1534. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1535. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1536. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1537. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1538. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1539. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1540. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1541. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1542. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1543. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1544. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1545. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1546. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1547. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1548. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1549. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1550. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1551. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1552. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1553. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1554. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1555. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1556. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1557. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1558. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1559. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1560. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1561. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1562. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1563. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1564. gbpri1.seq - Primate sequence entries, part 1.
1565. gbpri10.seq - Primate sequence entries, part 10.
1566. gbpri11.seq - Primate sequence entries, part 11.
1567. gbpri12.seq - Primate sequence entries, part 12.
1568. gbpri13.seq - Primate sequence entries, part 13.
1569. gbpri14.seq - Primate sequence entries, part 14.
1570. gbpri15.seq - Primate sequence entries, part 15.
1571. gbpri16.seq - Primate sequence entries, part 16.
1572. gbpri17.seq - Primate sequence entries, part 17.
1573. gbpri18.seq - Primate sequence entries, part 18.
1574. gbpri19.seq - Primate sequence entries, part 19.
1575. gbpri2.seq - Primate sequence entries, part 2.
1576. gbpri20.seq - Primate sequence entries, part 20.
1577. gbpri21.seq - Primate sequence entries, part 21.
1578. gbpri22.seq - Primate sequence entries, part 22.
1579. gbpri23.seq - Primate sequence entries, part 23.
1580. gbpri24.seq - Primate sequence entries, part 24.
1581. gbpri25.seq - Primate sequence entries, part 25.
1582. gbpri26.seq - Primate sequence entries, part 26.
1583. gbpri27.seq - Primate sequence entries, part 27.
1584. gbpri28.seq - Primate sequence entries, part 28.
1585. gbpri29.seq - Primate sequence entries, part 29.
1586. gbpri3.seq - Primate sequence entries, part 3.
1587. gbpri30.seq - Primate sequence entries, part 30.
1588. gbpri31.seq - Primate sequence entries, part 31.
1589. gbpri32.seq - Primate sequence entries, part 32.
1590. gbpri33.seq - Primate sequence entries, part 33.
1591. gbpri34.seq - Primate sequence entries, part 34.
1592. gbpri35.seq - Primate sequence entries, part 35.
1593. gbpri36.seq - Primate sequence entries, part 36.
1594. gbpri4.seq - Primate sequence entries, part 4.
1595. gbpri5.seq - Primate sequence entries, part 5.
1596. gbpri6.seq - Primate sequence entries, part 6.
1597. gbpri7.seq - Primate sequence entries, part 7.
1598. gbpri8.seq - Primate sequence entries, part 8.
1599. gbpri9.seq - Primate sequence entries, part 9.
1600. gbrel.txt - Release notes (this document).
1601. gbrod1.seq - Rodent sequence entries, part 1.
1602. gbrod10.seq - Rodent sequence entries, part 10.
1603. gbrod11.seq - Rodent sequence entries, part 11.
1604. gbrod12.seq - Rodent sequence entries, part 12.
1605. gbrod13.seq - Rodent sequence entries, part 13.
1606. gbrod14.seq - Rodent sequence entries, part 14.
1607. gbrod15.seq - Rodent sequence entries, part 15.
1608. gbrod16.seq - Rodent sequence entries, part 16.
1609. gbrod17.seq - Rodent sequence entries, part 17.
1610. gbrod18.seq - Rodent sequence entries, part 18.
1611. gbrod19.seq - Rodent sequence entries, part 19.
1612. gbrod2.seq - Rodent sequence entries, part 2.
1613. gbrod20.seq - Rodent sequence entries, part 20.
1614. gbrod21.seq - Rodent sequence entries, part 21.
1615. gbrod22.seq - Rodent sequence entries, part 22.
1616. gbrod23.seq - Rodent sequence entries, part 23.
1617. gbrod24.seq - Rodent sequence entries, part 24.
1618. gbrod25.seq - Rodent sequence entries, part 25.
1619. gbrod26.seq - Rodent sequence entries, part 26.
1620. gbrod3.seq - Rodent sequence entries, part 3.
1621. gbrod4.seq - Rodent sequence entries, part 4.
1622. gbrod5.seq - Rodent sequence entries, part 5.
1623. gbrod6.seq - Rodent sequence entries, part 6.
1624. gbrod7.seq - Rodent sequence entries, part 7.
1625. gbrod8.seq - Rodent sequence entries, part 8.
1626. gbrod9.seq - Rodent sequence entries, part 9.
1627. gbsdr1.txt - Short directory of the data bank, part 1.
1628. gbsdr2.txt - Short directory of the data bank, part 2.
1629. gbsdr3.txt - Short directory of the data bank, part 3.
1630. gbsec.idx - Index of the entries according to secondary accession number.
1631. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1632. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1633. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1634. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1635. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1636. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1637. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1638. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1639. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1640. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1641. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1642. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1643. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1644. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1645. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1646. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1647. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1648. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1649. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1650. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1651. gbtsa.seq - TSA (transcriptome shotgun assembly) sequence entries.
1652. gbuna.seq - Unannotated sequence entries.
1653. gbvrl1.seq - Viral sequence entries, part 1.
1654. gbvrl10.seq - Viral sequence entries, part 10.
1655. gbvrl2.seq - Viral sequence entries, part 2.
1656. gbvrl3.seq - Viral sequence entries, part 3.
1657. gbvrl4.seq - Viral sequence entries, part 4.
1658. gbvrl5.seq - Viral sequence entries, part 5.
1659. gbvrl6.seq - Viral sequence entries, part 6.
1660. gbvrl7.seq - Viral sequence entries, part 7.
1661. gbvrl8.seq - Viral sequence entries, part 8.
1662. gbvrl9.seq - Viral sequence entries, part 9.
1663. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1664. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1665. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1666. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1667. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1668. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1669. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1670. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1671. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1672. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1673. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1674. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1675. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1676. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1677. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1678. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 168.0 flatfiles require roughly 371 GB (sequence
files only) or 396 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
815223248 gbacc1.idx
1893265746 gbacc2.idx
632946177 gbacc3.idx
241838890 gbaut1.idx
185730191 gbaut10.idx
192619518 gbaut11.idx
183931792 gbaut12.idx
233470934 gbaut13.idx
244225583 gbaut14.idx
253407063 gbaut15.idx
252352341 gbaut16.idx
184330642 gbaut17.idx
183861860 gbaut18.idx
193457922 gbaut19.idx
239275649 gbaut2.idx
185775663 gbaut20.idx
185802922 gbaut21.idx
212442774 gbaut22.idx
183961741 gbaut23.idx
185809815 gbaut24.idx
185485326 gbaut25.idx
186274510 gbaut26.idx
183963625 gbaut27.idx
234618607 gbaut28.idx
186718918 gbaut29.idx
184660104 gbaut3.idx
185033708 gbaut30.idx
186246514 gbaut31.idx
184308579 gbaut32.idx
190479762 gbaut33.idx
186950421 gbaut34.idx
204624373 gbaut35.idx
184125727 gbaut36.idx
184034436 gbaut37.idx
184521089 gbaut38.idx
184413988 gbaut39.idx
187723686 gbaut4.idx
185297530 gbaut40.idx
186337409 gbaut41.idx
244045630 gbaut42.idx
235475962 gbaut43.idx
188390384 gbaut44.idx
184247953 gbaut45.idx
219689487 gbaut46.idx
228267008 gbaut47.idx
229947828 gbaut48.idx
185810865 gbaut49.idx
255369346 gbaut5.idx
245811541 gbaut50.idx
183847512 gbaut51.idx
243545298 gbaut52.idx
185134222 gbaut53.idx
192655610 gbaut54.idx
190564616 gbaut55.idx
186495907 gbaut56.idx
190957564 gbaut57.idx
183995843 gbaut58.idx
156729081 gbaut59.idx
185778791 gbaut6.idx
184143673 gbaut7.idx
183740308 gbaut8.idx
184823485 gbaut9.idx
259272212 gbbct1.seq
258064950 gbbct10.seq
250272017 gbbct11.seq
258097908 gbbct12.seq
252516856 gbbct13.seq
250359183 gbbct14.seq
254604217 gbbct15.seq
256913166 gbbct16.seq
255194170 gbbct17.seq
250626718 gbbct18.seq
250544249 gbbct19.seq
254539944 gbbct2.seq
256788464 gbbct20.seq
253685285 gbbct21.seq
256390637 gbbct22.seq
254016209 gbbct23.seq
251806581 gbbct24.seq
254120394 gbbct25.seq
253839294 gbbct26.seq
252204379 gbbct27.seq
250290731 gbbct28.seq
250131491 gbbct29.seq
259802647 gbbct3.seq
250001718 gbbct30.seq
250004617 gbbct31.seq
48327488 gbbct32.seq
250001896 gbbct4.seq
250048730 gbbct5.seq
252957865 gbbct6.seq
254333842 gbbct7.seq
250442157 gbbct8.seq
250002573 gbbct9.seq
17122661 gbchg.txt
250151094 gbcon1.seq
250611722 gbcon10.seq
250000921 gbcon100.seq
250010435 gbcon101.seq
119328127 gbcon102.seq
21414393 gbcon103.seq
255476342 gbcon11.seq
250000016 gbcon12.seq
251339002 gbcon13.seq
250002238 gbcon14.seq
250001621 gbcon15.seq
250002154 gbcon16.seq
250885385 gbcon17.seq
250000851 gbcon18.seq
250000813 gbcon19.seq
251535851 gbcon2.seq
250000565 gbcon20.seq
250000459 gbcon21.seq
250002045 gbcon22.seq
250000537 gbcon23.seq
250000166 gbcon24.seq
250000151 gbcon25.seq
250001072 gbcon26.seq
250002199 gbcon27.seq
250005509 gbcon28.seq
250003296 gbcon29.seq
250010803 gbcon3.seq
250002929 gbcon30.seq
250002442 gbcon31.seq
250004672 gbcon32.seq
250004740 gbcon33.seq
250002947 gbcon34.seq
250000771 gbcon35.seq
250004119 gbcon36.seq
250003089 gbcon37.seq
250000463 gbcon38.seq
250005149 gbcon39.seq
250136530 gbcon4.seq
250002220 gbcon40.seq
250001292 gbcon41.seq
250003484 gbcon42.seq
250000067 gbcon43.seq
250003093 gbcon44.seq
250002278 gbcon45.seq
250000425 gbcon46.seq
250002300 gbcon47.seq
250001796 gbcon48.seq
250000201 gbcon49.seq
250004520 gbcon5.seq
250000649 gbcon50.seq
250004334 gbcon51.seq
250002514 gbcon52.seq
250005185 gbcon53.seq
250002853 gbcon54.seq
250000263 gbcon55.seq
250001594 gbcon56.seq
250002918 gbcon57.seq
250001641 gbcon58.seq
250000063 gbcon59.seq
250006032 gbcon6.seq
250002959 gbcon60.seq
250001386 gbcon61.seq
250003293 gbcon62.seq
250005862 gbcon63.seq
250002063 gbcon64.seq
250000064 gbcon65.seq
250000119 gbcon66.seq
250001304 gbcon67.seq
250000466 gbcon68.seq
250004987 gbcon69.seq
250234579 gbcon7.seq
250002755 gbcon70.seq
250000374 gbcon71.seq
250002219 gbcon72.seq
250005406 gbcon73.seq
250003865 gbcon74.seq
250000674 gbcon75.seq
250003756 gbcon76.seq
250000145 gbcon77.seq
250001028 gbcon78.seq
250004011 gbcon79.seq
250533530 gbcon8.seq
250004679 gbcon80.seq
250004778 gbcon81.seq
250001645 gbcon82.seq
250000778 gbcon83.seq
250002590 gbcon84.seq
250003129 gbcon85.seq
250001088 gbcon86.seq
250004213 gbcon87.seq
250004083 gbcon88.seq
250004909 gbcon89.seq
250000476 gbcon9.seq
250004145 gbcon90.seq
250001079 gbcon91.seq
250001232 gbcon92.seq
250010822 gbcon93.seq
250000577 gbcon94.seq
250000351 gbcon95.seq
250004127 gbcon96.seq
250000192 gbcon97.seq
250002284 gbcon98.seq
250001517 gbcon99.seq
5063860 gbdel.txt
250002496 gbenv1.seq
159570563 gbenv10.seq
250001061 gbenv2.seq
250000757 gbenv3.seq
250000250 gbenv4.seq
250000747 gbenv5.seq
250000852 gbenv6.seq
250000803 gbenv7.seq
250000025 gbenv8.seq
250002567 gbenv9.seq
230688615 gbest1.seq
230687850 gbest10.seq
230688348 gbest100.seq
230689403 gbest101.seq
230687717 gbest102.seq
230690223 gbest103.seq
230688898 gbest104.seq
230689610 gbest105.seq
230689549 gbest106.seq
230688622 gbest107.seq
230688313 gbest108.seq
230688152 gbest109.seq
230688467 gbest11.seq
230689276 gbest110.seq
230691029 gbest111.seq
230690588 gbest112.seq
230689460 gbest113.seq
230689891 gbest114.seq
230690439 gbest115.seq
230690609 gbest116.seq
230689284 gbest117.seq
230687658 gbest118.seq
230624213 gbest119.seq
230689872 gbest12.seq
230689713 gbest120.seq
230687979 gbest121.seq
230688921 gbest122.seq
230689431 gbest123.seq
230689060 gbest124.seq
230689825 gbest125.seq
230687934 gbest126.seq
230688185 gbest127.seq
230689313 gbest128.seq
230687474 gbest129.seq
230689821 gbest13.seq
230690579 gbest130.seq
230688915 gbest131.seq
230689203 gbest132.seq
230688752 gbest133.seq
230688582 gbest134.seq
230687927 gbest135.seq
230689423 gbest136.seq
230688494 gbest137.seq
230689583 gbest138.seq
230689936 gbest139.seq
230689501 gbest14.seq
230689905 gbest140.seq
230687669 gbest141.seq
230687589 gbest142.seq
230687604 gbest143.seq
230689823 gbest144.seq
230689350 gbest145.seq
230689019 gbest146.seq
230688669 gbest147.seq
230689024 gbest148.seq
230688775 gbest149.seq
230688549 gbest15.seq
230689108 gbest150.seq
230688193 gbest151.seq
230688457 gbest152.seq
230689658 gbest153.seq
230687568 gbest154.seq
230688979 gbest155.seq
230687751 gbest156.seq
230690284 gbest157.seq
230688985 gbest158.seq
230690658 gbest159.seq
230688764 gbest16.seq
230688550 gbest160.seq
230691337 gbest161.seq
230688856 gbest162.seq
230689243 gbest163.seq
230688043 gbest164.seq
230696078 gbest165.seq
230689476 gbest166.seq
230688595 gbest167.seq
230688809 gbest168.seq
230688231 gbest169.seq
230688328 gbest17.seq
230691248 gbest170.seq
230690635 gbest171.seq
230688656 gbest172.seq
230689772 gbest173.seq
230688150 gbest174.seq
230690026 gbest175.seq
230687978 gbest176.seq
230687837 gbest177.seq
230688733 gbest178.seq
230689219 gbest179.seq
230688107 gbest18.seq
230689055 gbest180.seq
230689416 gbest181.seq
230689617 gbest182.seq
230687667 gbest183.seq
230688056 gbest184.seq
230688627 gbest185.seq
230690102 gbest186.seq
230689492 gbest187.seq
230690243 gbest188.seq
229111824 gbest189.seq
230690091 gbest19.seq
230689171 gbest190.seq
230687986 gbest191.seq
230688212 gbest192.seq
230689221 gbest193.seq
230688151 gbest194.seq
230687632 gbest195.seq
230688749 gbest196.seq
230687837 gbest197.seq
230688540 gbest198.seq
230689419 gbest199.seq
230689833 gbest2.seq
230689487 gbest20.seq
230690353 gbest200.seq
230689756 gbest201.seq
230687879 gbest202.seq
230688388 gbest203.seq
230689606 gbest204.seq
230688007 gbest205.seq
230690261 gbest206.seq
230687525 gbest207.seq
230689221 gbest208.seq
230689873 gbest209.seq
230688612 gbest21.seq
230687540 gbest210.seq
230687537 gbest211.seq
230688956 gbest212.seq
230688595 gbest213.seq
230687936 gbest214.seq
230689087 gbest215.seq
230687754 gbest216.seq
230688876 gbest217.seq
230688195 gbest218.seq
230687562 gbest219.seq
230689308 gbest22.seq
230688538 gbest220.seq
230689495 gbest221.seq
230689861 gbest222.seq
230688482 gbest223.seq
230688793 gbest224.seq
230688884 gbest225.seq
230690846 gbest226.seq
230689439 gbest227.seq
230689281 gbest228.seq
230688154 gbest229.seq
230689102 gbest23.seq
230689666 gbest230.seq
196192105 gbest231.seq
161660341 gbest232.seq
161859322 gbest233.seq
169827386 gbest234.seq
168523336 gbest235.seq
163452766 gbest236.seq
164114088 gbest237.seq
163673318 gbest238.seq
162887431 gbest239.seq
230689629 gbest24.seq
163532114 gbest240.seq
163019019 gbest241.seq
163141795 gbest242.seq
161893174 gbest243.seq
167285028 gbest244.seq
161451437 gbest245.seq
161761251 gbest246.seq
166076666 gbest247.seq
166790125 gbest248.seq
164795894 gbest249.seq
230690547 gbest25.seq
164650774 gbest250.seq
164245538 gbest251.seq
164073235 gbest252.seq
163169072 gbest253.seq
163098989 gbest254.seq
164039369 gbest255.seq
164235387 gbest256.seq
179868784 gbest257.seq
171003204 gbest258.seq
187095968 gbest259.seq
230688489 gbest26.seq
230688853 gbest260.seq
230691090 gbest261.seq
230688868 gbest262.seq
230689481 gbest263.seq
230690672 gbest264.seq
230689211 gbest265.seq
230689948 gbest266.seq
230689260 gbest267.seq
230689080 gbest268.seq
230689114 gbest269.seq
230689532 gbest27.seq
230687614 gbest270.seq
230687673 gbest271.seq
230689412 gbest272.seq
230688872 gbest273.seq
230687506 gbest274.seq
230688532 gbest275.seq
230689105 gbest276.seq
230688358 gbest277.seq
230689947 gbest278.seq
230690564 gbest279.seq
230688330 gbest28.seq
230689761 gbest280.seq
230689912 gbest281.seq
230688874 gbest282.seq
230688240 gbest283.seq
230688384 gbest284.seq
230689111 gbest285.seq
230690031 gbest286.seq
230688048 gbest287.seq
230687517 gbest288.seq
230690716 gbest289.seq
230688529 gbest29.seq
230689514 gbest290.seq
216519174 gbest291.seq
210353721 gbest292.seq
230687773 gbest293.seq
230690862 gbest294.seq
230690380 gbest295.seq
230687526 gbest296.seq
230688729 gbest297.seq
230687970 gbest298.seq
230688617 gbest299.seq
230690315 gbest3.seq
230688054 gbest30.seq
230689496 gbest300.seq
230688645 gbest301.seq
230688126 gbest302.seq
230689434 gbest303.seq
230687703 gbest304.seq
230689950 gbest305.seq
230688999 gbest306.seq
230690863 gbest307.seq
230689466 gbest308.seq
230689772 gbest309.seq
230689729 gbest31.seq
230688761 gbest310.seq
230690162 gbest311.seq
230689201 gbest312.seq
230688847 gbest313.seq
230687791 gbest314.seq
230691049 gbest315.seq
227889862 gbest316.seq
230691003 gbest317.seq
230688472 gbest318.seq
230690424 gbest319.seq
230688154 gbest32.seq
230691050 gbest320.seq
230690882 gbest321.seq
230688392 gbest322.seq
230690356 gbest323.seq
230689197 gbest324.seq
230689308 gbest325.seq
230687941 gbest326.seq
230690129 gbest327.seq
230688526 gbest328.seq
230690648 gbest329.seq
230688396 gbest33.seq
230688545 gbest330.seq
230688812 gbest331.seq
230689833 gbest332.seq
230687995 gbest333.seq
230689044 gbest334.seq
230689116 gbest335.seq
230690291 gbest336.seq
230689587 gbest337.seq
230689331 gbest338.seq
230687786 gbest339.seq
230689383 gbest34.seq
230687885 gbest340.seq
230689854 gbest341.seq
230689644 gbest342.seq
204869021 gbest343.seq
230690034 gbest344.seq
230689711 gbest345.seq
230690347 gbest346.seq
230689518 gbest347.seq
230687734 gbest348.seq
230687651 gbest349.seq
230688213 gbest35.seq
143433252 gbest350.seq
175596923 gbest351.seq
230689471 gbest352.seq
230688347 gbest353.seq
230689405 gbest354.seq
230690358 gbest355.seq
230688123 gbest356.seq
230689464 gbest357.seq
230688710 gbest358.seq
230689269 gbest359.seq
230688906 gbest36.seq
230688792 gbest360.seq
230689440 gbest361.seq
230688199 gbest362.seq
230690347 gbest363.seq
230688417 gbest364.seq
230688054 gbest365.seq
230687811 gbest366.seq
230687563 gbest367.seq
230691504 gbest368.seq
230688316 gbest369.seq
230689771 gbest37.seq
230689254 gbest370.seq
230688515 gbest371.seq
230690144 gbest372.seq
230690251 gbest373.seq
230687888 gbest374.seq
230687922 gbest375.seq
230687724 gbest376.seq
230687753 gbest377.seq
230689948 gbest378.seq
230688043 gbest379.seq
230688105 gbest38.seq
230688174 gbest380.seq
230688010 gbest381.seq
230690355 gbest382.seq
230688282 gbest383.seq
230694935 gbest384.seq
230694621 gbest385.seq
230688221 gbest386.seq
230689719 gbest387.seq
230688142 gbest388.seq
230687870 gbest389.seq
230687714 gbest39.seq
230689749 gbest390.seq
230689514 gbest391.seq
230689834 gbest392.seq
230690062 gbest393.seq
230687736 gbest394.seq
230689800 gbest395.seq
222233514 gbest396.seq
230688591 gbest397.seq
230689602 gbest398.seq
230690382 gbest399.seq
230688895 gbest4.seq
230691043 gbest40.seq
230688732 gbest400.seq
230687705 gbest401.seq
222632816 gbest402.seq
230688619 gbest403.seq
230690964 gbest404.seq
230688441 gbest405.seq
230688253 gbest406.seq
230688291 gbest407.seq
230689179 gbest408.seq
223536688 gbest409.seq
230687776 gbest41.seq
230689254 gbest410.seq
230691478 gbest411.seq
230688125 gbest412.seq
230688177 gbest413.seq
230687857 gbest414.seq
230688404 gbest415.seq
230689327 gbest416.seq
230691515 gbest417.seq
230690881 gbest418.seq
230688831 gbest419.seq
230689066 gbest42.seq
230689760 gbest420.seq
230689246 gbest421.seq
230691414 gbest422.seq
230688286 gbest423.seq
230690733 gbest424.seq
230689290 gbest425.seq
230688589 gbest426.seq
210656244 gbest427.seq
208300415 gbest428.seq
208245152 gbest429.seq
230688456 gbest43.seq
208383496 gbest430.seq
208347588 gbest431.seq
208502812 gbest432.seq
209169954 gbest433.seq
209781924 gbest434.seq
209546479 gbest435.seq
209608199 gbest436.seq
212106910 gbest437.seq
209631726 gbest438.seq
208664231 gbest439.seq
230687561 gbest44.seq
208803736 gbest440.seq
208800104 gbest441.seq
208223577 gbest442.seq
208266323 gbest443.seq
208258224 gbest444.seq
208241157 gbest445.seq
219329210 gbest446.seq
230687754 gbest447.seq
230687651 gbest448.seq
230690063 gbest449.seq
230688396 gbest45.seq
230689233 gbest450.seq
230690077 gbest451.seq
230689701 gbest452.seq
230689326 gbest453.seq
230688234 gbest454.seq
230688156 gbest455.seq
230689584 gbest456.seq
230687860 gbest457.seq
230689283 gbest458.seq
230689449 gbest459.seq
230689344 gbest46.seq
230688251 gbest460.seq
230691245 gbest461.seq
230689702 gbest462.seq
230689018 gbest463.seq
230688615 gbest464.seq
230688137 gbest465.seq
230688001 gbest466.seq
230691778 gbest467.seq
230689831 gbest468.seq
230691771 gbest469.seq
189041900 gbest47.seq
230688942 gbest470.seq
230689191 gbest471.seq
230688507 gbest472.seq
230689550 gbest473.seq
230690097 gbest474.seq
230689013 gbest475.seq
230689136 gbest476.seq
230687703 gbest477.seq
230689820 gbest478.seq
230687993 gbest479.seq
188241195 gbest48.seq
230687751 gbest480.seq
230689407 gbest481.seq
230688906 gbest482.seq
230687565 gbest483.seq
230689544 gbest484.seq
230688188 gbest485.seq
230687676 gbest486.seq
230687510 gbest487.seq
230691659 gbest488.seq
230690956 gbest489.seq
204743919 gbest49.seq
230687557 gbest490.seq
230689931 gbest491.seq
230690997 gbest492.seq
230690690 gbest493.seq
230689568 gbest494.seq
230688427 gbest495.seq
230687635 gbest496.seq
230688267 gbest497.seq
230690537 gbest498.seq
230688288 gbest499.seq
164142208 gbest5.seq
215053205 gbest50.seq
230691067 gbest500.seq
230688732 gbest501.seq
230687636 gbest502.seq
230689913 gbest503.seq
230689051 gbest504.seq
230690512 gbest505.seq
230689363 gbest506.seq
230688882 gbest507.seq
230688838 gbest508.seq
225450206 gbest509.seq
214776070 gbest51.seq
230688979 gbest510.seq
230687795 gbest511.seq
230688132 gbest512.seq
230687824 gbest513.seq
230688220 gbest514.seq
230687878 gbest515.seq
230688617 gbest516.seq
230689954 gbest517.seq
230690021 gbest518.seq
230690038 gbest519.seq
215563786 gbest52.seq
230687455 gbest520.seq
230689007 gbest521.seq
230688644 gbest522.seq
225474749 gbest523.seq
226487502 gbest524.seq
230690541 gbest525.seq
230691031 gbest526.seq
230689866 gbest527.seq
230687620 gbest528.seq
230687864 gbest529.seq
228893666 gbest53.seq
230688823 gbest530.seq
230687872 gbest531.seq
230688688 gbest532.seq
230691300 gbest533.seq
230689769 gbest534.seq
230688204 gbest535.seq
230689391 gbest536.seq
230689543 gbest537.seq
226988160 gbest538.seq
196092768 gbest539.seq
230688969 gbest54.seq
223769735 gbest540.seq
230687546 gbest541.seq
230689817 gbest542.seq
230688098 gbest543.seq
230687573 gbest544.seq
230690590 gbest545.seq
230688816 gbest546.seq
230688431 gbest547.seq
230689684 gbest548.seq
230688305 gbest549.seq
230688215 gbest55.seq
230687811 gbest550.seq
230688824 gbest551.seq
230690023 gbest552.seq
222000248 gbest553.seq
221924435 gbest554.seq
230689176 gbest555.seq
230689267 gbest556.seq
230688736 gbest557.seq
230689137 gbest558.seq
230690368 gbest559.seq
230687962 gbest56.seq
230687920 gbest560.seq
219046805 gbest561.seq
215460639 gbest562.seq
230687697 gbest563.seq
230687670 gbest564.seq
230689772 gbest565.seq
230688776 gbest566.seq
230687947 gbest567.seq
230688795 gbest568.seq
230688277 gbest569.seq
224224094 gbest57.seq
230689557 gbest570.seq
230689995 gbest571.seq
230689301 gbest572.seq
230687957 gbest573.seq
230687933 gbest574.seq
230691175 gbest575.seq
230688493 gbest576.seq
224198333 gbest577.seq
230687956 gbest578.seq
230689012 gbest579.seq
230687680 gbest58.seq
230688086 gbest580.seq
230688052 gbest581.seq
230688863 gbest582.seq
230689714 gbest583.seq
230689265 gbest584.seq
230689669 gbest585.seq
230689683 gbest586.seq
230689531 gbest587.seq
230690025 gbest588.seq
230687555 gbest589.seq
230687976 gbest59.seq
230689628 gbest590.seq
230688923 gbest591.seq
230689841 gbest592.seq
230689096 gbest593.seq
230688857 gbest594.seq
230689143 gbest595.seq
230688167 gbest596.seq
230689472 gbest597.seq
220230182 gbest598.seq
230690120 gbest599.seq
177420861 gbest6.seq
230689352 gbest60.seq
230688218 gbest600.seq
230689230 gbest601.seq
230689689 gbest602.seq
230691718 gbest603.seq
230691614 gbest604.seq
230688872 gbest605.seq
230689609 gbest606.seq
230688634 gbest607.seq
230688647 gbest608.seq
230688047 gbest609.seq
230689614 gbest61.seq
230687466 gbest610.seq
230688509 gbest611.seq
230690815 gbest612.seq
230690746 gbest613.seq
230689576 gbest614.seq
230688105 gbest615.seq
230689069 gbest616.seq
230688175 gbest617.seq
230687629 gbest618.seq
230689597 gbest619.seq
230690030 gbest62.seq
230689016 gbest620.seq
230688970 gbest621.seq
230688882 gbest622.seq
230688950 gbest623.seq
230689440 gbest624.seq
230688059 gbest625.seq
230688589 gbest626.seq
230688570 gbest627.seq
230690552 gbest628.seq
230689193 gbest629.seq
230688627 gbest63.seq
230690795 gbest630.seq
230688318 gbest631.seq
230688122 gbest632.seq
230690668 gbest633.seq
230688815 gbest634.seq
230689311 gbest635.seq
230690215 gbest636.seq
230688517 gbest637.seq
230688209 gbest638.seq
230687935 gbest639.seq
230687708 gbest64.seq
221085326 gbest640.seq
217363111 gbest641.seq
230688461 gbest642.seq
220946650 gbest643.seq
190676939 gbest644.seq
190509982 gbest645.seq
193513700 gbest646.seq
192241380 gbest647.seq
191648228 gbest648.seq
191695040 gbest649.seq
230690379 gbest65.seq
193157105 gbest650.seq
191853500 gbest651.seq
191289889 gbest652.seq
191324080 gbest653.seq
230687466 gbest654.seq
230688399 gbest655.seq
230687505 gbest656.seq
230687965 gbest657.seq
230690304 gbest658.seq
230689638 gbest659.seq
230689173 gbest66.seq
230688776 gbest660.seq
179572306 gbest661.seq
181403392 gbest662.seq
230687486 gbest663.seq
230687440 gbest664.seq
230688129 gbest665.seq
230688097 gbest666.seq
230689642 gbest667.seq
230688724 gbest668.seq
230690868 gbest669.seq
230687888 gbest67.seq
230689015 gbest670.seq
230689673 gbest671.seq
230691025 gbest672.seq
230687861 gbest673.seq
230689584 gbest674.seq
230687666 gbest675.seq
230688478 gbest676.seq
230690556 gbest677.seq
230689432 gbest678.seq
230689140 gbest679.seq
230688905 gbest68.seq
230688230 gbest680.seq
230688789 gbest681.seq
230690384 gbest682.seq
230688251 gbest683.seq
230688062 gbest684.seq
230687669 gbest685.seq
230690512 gbest686.seq
230689922 gbest687.seq
230688277 gbest688.seq
230689663 gbest689.seq
230688636 gbest69.seq
230688917 gbest690.seq
230690245 gbest691.seq
230690381 gbest692.seq
230691868 gbest693.seq
230688847 gbest694.seq
230688431 gbest695.seq
230690593 gbest696.seq
230688690 gbest697.seq
230689015 gbest698.seq
230688542 gbest699.seq
230687843 gbest7.seq
230687985 gbest70.seq
220767200 gbest700.seq
216334915 gbest701.seq
218478741 gbest702.seq
217243574 gbest703.seq
214949101 gbest704.seq
230689985 gbest705.seq
230687490 gbest706.seq
230689011 gbest707.seq
230691155 gbest708.seq
230688015 gbest709.seq
229944368 gbest71.seq
230689424 gbest710.seq
230687992 gbest711.seq
230689487 gbest712.seq
230689411 gbest713.seq
230689729 gbest714.seq
230688214 gbest715.seq
230688881 gbest716.seq
230687736 gbest717.seq
230690016 gbest718.seq
230689778 gbest719.seq
230688289 gbest72.seq
230687707 gbest720.seq
230688760 gbest721.seq
230688721 gbest722.seq
230690582 gbest723.seq
230689442 gbest724.seq
230688847 gbest725.seq
230687933 gbest726.seq
230687855 gbest727.seq
230688525 gbest728.seq
230687756 gbest729.seq
209652443 gbest73.seq
205399734 gbest730.seq
225087751 gbest731.seq
230688571 gbest732.seq
230687623 gbest733.seq
230689925 gbest734.seq
230688851 gbest735.seq
230688460 gbest736.seq
230688507 gbest737.seq
230690918 gbest738.seq
230687607 gbest739.seq
208185320 gbest74.seq
230687759 gbest740.seq
230688681 gbest741.seq
230690953 gbest742.seq
230688523 gbest743.seq
230689724 gbest744.seq
230688576 gbest745.seq
230690179 gbest746.seq
198035273 gbest747.seq
219236697 gbest748.seq
230688152 gbest749.seq
207500258 gbest75.seq
230690058 gbest750.seq
230694369 gbest751.seq
230691141 gbest752.seq
230690215 gbest753.seq
230693432 gbest754.seq
230689470 gbest755.seq
230691094 gbest756.seq
230690088 gbest757.seq
230690674 gbest758.seq
230690863 gbest759.seq
207829812 gbest76.seq
230690300 gbest760.seq
230689682 gbest761.seq
230688619 gbest762.seq
230689119 gbest763.seq
230687504 gbest764.seq
230688457 gbest765.seq
230688874 gbest766.seq
230689703 gbest767.seq
230687633 gbest768.seq
230687586 gbest769.seq
208396764 gbest77.seq
230689736 gbest770.seq
230689491 gbest771.seq
230688917 gbest772.seq
230689023 gbest773.seq
230687515 gbest774.seq
230689743 gbest775.seq
230688925 gbest776.seq
230687803 gbest777.seq
230688917 gbest778.seq
230689805 gbest779.seq
209258342 gbest78.seq
230687930 gbest780.seq
230689824 gbest781.seq
230689923 gbest782.seq
230690515 gbest783.seq
230688522 gbest784.seq
230688391 gbest785.seq
230690356 gbest786.seq
230688100 gbest787.seq
230688234 gbest788.seq
230689361 gbest789.seq
208502973 gbest79.seq
230689465 gbest790.seq
230688102 gbest791.seq
230689118 gbest792.seq
230691456 gbest793.seq
230689593 gbest794.seq
230690282 gbest795.seq
230687708 gbest796.seq
230688723 gbest797.seq
230689437 gbest798.seq
228617168 gbest799.seq
230688355 gbest8.seq
207043740 gbest80.seq
230687860 gbest800.seq
230690961 gbest801.seq
61974859 gbest802.seq
209016164 gbest81.seq
207141074 gbest82.seq
204119490 gbest83.seq
207238233 gbest84.seq
206904658 gbest85.seq
210534732 gbest86.seq
226422334 gbest87.seq
230690196 gbest88.seq
230691865 gbest89.seq
230689534 gbest9.seq
217435667 gbest90.seq
213212965 gbest91.seq
214483164 gbest92.seq
230690196 gbest93.seq
230688270 gbest94.seq
230687550 gbest95.seq
230688793 gbest96.seq
230687772 gbest97.seq
230687987 gbest98.seq
230688538 gbest99.seq
93390688 gbgen.idx
230688979 gbgss1.seq
230690079 gbgss10.seq
230687985 gbgss100.seq
227641348 gbgss101.seq
228853960 gbgss102.seq
228577797 gbgss103.seq
228616146 gbgss104.seq
227678395 gbgss105.seq
230160460 gbgss106.seq
230687600 gbgss107.seq
230687841 gbgss108.seq
230688889 gbgss109.seq
230689764 gbgss11.seq
230689869 gbgss110.seq
230689355 gbgss111.seq
230690249 gbgss112.seq
230688184 gbgss113.seq
230687967 gbgss114.seq
230687862 gbgss115.seq
230687621 gbgss116.seq
230689054 gbgss117.seq
230689483 gbgss118.seq
230687486 gbgss119.seq
230687679 gbgss12.seq
230689336 gbgss120.seq
230688021 gbgss121.seq
230687870 gbgss122.seq
230688758 gbgss123.seq
230688880 gbgss124.seq
230688977 gbgss125.seq
230688685 gbgss126.seq
230689349 gbgss127.seq
230687906 gbgss128.seq
230690119 gbgss129.seq
230690347 gbgss13.seq
230690398 gbgss130.seq
230688922 gbgss131.seq
230689134 gbgss132.seq
230688439 gbgss133.seq
230689347 gbgss134.seq
230689748 gbgss135.seq
230689964 gbgss136.seq
230688112 gbgss137.seq
230687742 gbgss138.seq
230689718 gbgss139.seq
230689893 gbgss14.seq
230688478 gbgss140.seq
230688707 gbgss141.seq
230689457 gbgss142.seq
230688982 gbgss143.seq
230689993 gbgss144.seq
224594908 gbgss145.seq
230689546 gbgss146.seq
230688800 gbgss147.seq
199924220 gbgss148.seq
230688073 gbgss149.seq
230689648 gbgss15.seq
230689711 gbgss150.seq
230690053 gbgss151.seq
230688865 gbgss152.seq
230688117 gbgss153.seq
230688653 gbgss154.seq
230687819 gbgss155.seq
230689649 gbgss156.seq
230688254 gbgss157.seq
230688636 gbgss158.seq
230689115 gbgss159.seq
230689778 gbgss16.seq
230688125 gbgss160.seq
230689092 gbgss161.seq
230687565 gbgss162.seq
230690435 gbgss163.seq
230688975 gbgss164.seq
230689820 gbgss165.seq
230690358 gbgss166.seq
230688195 gbgss167.seq
230688649 gbgss168.seq
230687939 gbgss169.seq
230688655 gbgss17.seq
230687786 gbgss170.seq
230690628 gbgss171.seq
230688753 gbgss172.seq
230689866 gbgss173.seq
214234374 gbgss174.seq
207652763 gbgss175.seq
210029902 gbgss176.seq
210673597 gbgss177.seq
209682506 gbgss178.seq
209419696 gbgss179.seq
230688580 gbgss18.seq
207488635 gbgss180.seq
207258577 gbgss181.seq
207746380 gbgss182.seq
209291952 gbgss183.seq
209292380 gbgss184.seq
208633065 gbgss185.seq
205852670 gbgss186.seq
205577964 gbgss187.seq
205287210 gbgss188.seq
205470985 gbgss189.seq
230688247 gbgss19.seq
205274354 gbgss190.seq
206072341 gbgss191.seq
207491979 gbgss192.seq
208618555 gbgss193.seq
207877722 gbgss194.seq
207953298 gbgss195.seq
208773455 gbgss196.seq
208858885 gbgss197.seq
208917427 gbgss198.seq
205751013 gbgss199.seq
230688628 gbgss2.seq
230689216 gbgss20.seq
206170487 gbgss200.seq
206444670 gbgss201.seq
205511262 gbgss202.seq
206017096 gbgss203.seq
207311310 gbgss204.seq
207135375 gbgss205.seq
207106981 gbgss206.seq
207240819 gbgss207.seq
207061813 gbgss208.seq
207144730 gbgss209.seq
230687808 gbgss21.seq
206853951 gbgss210.seq
206971386 gbgss211.seq
206675485 gbgss212.seq
207873505 gbgss213.seq
207898181 gbgss214.seq
209406955 gbgss215.seq
210074945 gbgss216.seq
209275082 gbgss217.seq
210247069 gbgss218.seq
218148117 gbgss219.seq
230691288 gbgss22.seq
218861353 gbgss220.seq
230688875 gbgss221.seq
230690563 gbgss222.seq
230689823 gbgss223.seq
230688527 gbgss224.seq
230688485 gbgss225.seq
230689035 gbgss226.seq
217911552 gbgss227.seq
217928427 gbgss228.seq
230688758 gbgss229.seq
230690275 gbgss23.seq
230688350 gbgss230.seq
230689525 gbgss231.seq
230688559 gbgss232.seq
230688966 gbgss233.seq
230688949 gbgss234.seq
230688928 gbgss235.seq
230688305 gbgss236.seq
230689957 gbgss237.seq
230688421 gbgss238.seq
230687448 gbgss239.seq
230687584 gbgss24.seq
230687779 gbgss240.seq
230689645 gbgss241.seq
230689324 gbgss242.seq
230687963 gbgss243.seq
230688174 gbgss244.seq
230689620 gbgss245.seq
230687509 gbgss246.seq
230689905 gbgss247.seq
230690104 gbgss248.seq
161458931 gbgss249.seq
230688860 gbgss25.seq
250002175 gbgss250.seq
250001328 gbgss251.seq
250000873 gbgss252.seq
250001928 gbgss253.seq
250001271 gbgss254.seq
250003080 gbgss255.seq
250001929 gbgss256.seq
250003093 gbgss257.seq
250002648 gbgss258.seq
250003042 gbgss259.seq
230689933 gbgss26.seq
250002054 gbgss260.seq
250001763 gbgss261.seq
250002572 gbgss262.seq
250002725 gbgss263.seq
250000573 gbgss264.seq
250001742 gbgss265.seq
250000825 gbgss266.seq
250000536 gbgss267.seq
250003350 gbgss268.seq
250000266 gbgss269.seq
230687500 gbgss27.seq
250000155 gbgss270.seq
250003096 gbgss271.seq
250001287 gbgss272.seq
250000181 gbgss273.seq
250000404 gbgss274.seq
250001698 gbgss275.seq
250001008 gbgss276.seq
250001653 gbgss277.seq
250001664 gbgss278.seq
250000344 gbgss279.seq
230691150 gbgss28.seq
250002121 gbgss280.seq
250001583 gbgss281.seq
250002312 gbgss282.seq
250001183 gbgss283.seq
250000821 gbgss284.seq
250001600 gbgss285.seq
250000327 gbgss286.seq
250001458 gbgss287.seq
250001105 gbgss288.seq
250000505 gbgss289.seq
230689347 gbgss29.seq
250001343 gbgss290.seq
250000778 gbgss291.seq
250000545 gbgss292.seq
250002059 gbgss293.seq
250002081 gbgss294.seq
250000146 gbgss295.seq
250000065 gbgss296.seq
250000138 gbgss297.seq
250000490 gbgss298.seq
250000185 gbgss299.seq
230689286 gbgss3.seq
230689385 gbgss30.seq
250001880 gbgss300.seq
250002287 gbgss301.seq
250002478 gbgss302.seq
250001084 gbgss303.seq
250001211 gbgss304.seq
250001535 gbgss305.seq
250002217 gbgss306.seq
250002283 gbgss307.seq
250001993 gbgss308.seq
32274227 gbgss309.seq
230690225 gbgss31.seq
230688976 gbgss32.seq
230688128 gbgss33.seq
230690193 gbgss34.seq
230688810 gbgss35.seq
230689089 gbgss36.seq
230689278 gbgss37.seq
230688359 gbgss38.seq
230689487 gbgss39.seq
230688064 gbgss4.seq
230688189 gbgss40.seq
230687914 gbgss41.seq
230689468 gbgss42.seq
230689860 gbgss43.seq
230688625 gbgss44.seq
230688829 gbgss45.seq
230690346 gbgss46.seq
230688963 gbgss47.seq
230687625 gbgss48.seq
230688321 gbgss49.seq
230688342 gbgss5.seq
230688467 gbgss50.seq
230688749 gbgss51.seq
230689377 gbgss52.seq
230689505 gbgss53.seq
230690049 gbgss54.seq
230688759 gbgss55.seq
230687592 gbgss56.seq
230688956 gbgss57.seq
230690150 gbgss58.seq
230688240 gbgss59.seq
230689182 gbgss6.seq
230689458 gbgss60.seq
228978887 gbgss61.seq
230688786 gbgss62.seq
230688562 gbgss63.seq
230688493 gbgss64.seq
230688511 gbgss65.seq
230688084 gbgss66.seq
230688090 gbgss67.seq
230687948 gbgss68.seq
230687896 gbgss69.seq
230687458 gbgss7.seq
230689872 gbgss70.seq
230689371 gbgss71.seq
230689612 gbgss72.seq
230689793 gbgss73.seq
230688465 gbgss74.seq
230687944 gbgss75.seq
230688682 gbgss76.seq
230688590 gbgss77.seq
230688102 gbgss78.seq
230688694 gbgss79.seq
230690430 gbgss8.seq
230688922 gbgss80.seq
225707360 gbgss81.seq
194162099 gbgss82.seq
194321118 gbgss83.seq
230691378 gbgss84.seq
230689444 gbgss85.seq
230688634 gbgss86.seq
230689771 gbgss87.seq
230688430 gbgss88.seq
230689328 gbgss89.seq
230689298 gbgss9.seq
230689609 gbgss90.seq
230689497 gbgss91.seq
230687463 gbgss92.seq
230688240 gbgss93.seq
230689328 gbgss94.seq
230690844 gbgss95.seq
230688483 gbgss96.seq
230689657 gbgss97.seq
230688630 gbgss98.seq
230689972 gbgss99.seq
250011893 gbhtc1.seq
250001450 gbhtc10.seq
250001155 gbhtc11.seq
250001364 gbhtc12.seq
12611206 gbhtc13.seq
250015867 gbhtc2.seq
250012618 gbhtc3.seq
250003132 gbhtc4.seq
250000802 gbhtc5.seq
250002862 gbhtc6.seq
250003280 gbhtc7.seq
250000604 gbhtc8.seq
250005061 gbhtc9.seq
250096978 gbhtg1.seq
250061283 gbhtg10.seq
250221451 gbhtg100.seq
250197475 gbhtg101.seq
250078972 gbhtg102.seq
250057678 gbhtg103.seq
250231976 gbhtg104.seq
250095667 gbhtg105.seq
251076061 gbhtg106.seq
250093336 gbhtg107.seq
250087182 gbhtg108.seq
250111042 gbhtg109.seq
250044302 gbhtg11.seq
250210143 gbhtg110.seq
250355482 gbhtg111.seq
250212361 gbhtg112.seq
250128493 gbhtg113.seq
250120793 gbhtg114.seq
250034784 gbhtg115.seq
250003366 gbhtg116.seq
250076530 gbhtg117.seq
250089768 gbhtg118.seq
250135489 gbhtg119.seq
250316839 gbhtg12.seq
250169215 gbhtg120.seq
250107955 gbhtg121.seq
112015211 gbhtg122.seq
250262395 gbhtg13.seq
250035129 gbhtg14.seq
250133266 gbhtg15.seq
250076344 gbhtg16.seq
250178723 gbhtg17.seq
250091540 gbhtg18.seq
250147774 gbhtg19.seq
250023304 gbhtg2.seq
250182078 gbhtg20.seq
250082633 gbhtg21.seq
250033574 gbhtg22.seq
250235175 gbhtg23.seq
250258936 gbhtg24.seq
250096493 gbhtg25.seq
250296347 gbhtg26.seq
250257898 gbhtg27.seq
250252130 gbhtg28.seq
250053426 gbhtg29.seq
250041103 gbhtg3.seq
250017542 gbhtg30.seq
250019041 gbhtg31.seq
250192741 gbhtg32.seq
250064205 gbhtg33.seq
250100700 gbhtg34.seq
250087680 gbhtg35.seq
250183191 gbhtg36.seq
250178284 gbhtg37.seq
250043485 gbhtg38.seq
250254386 gbhtg39.seq
250103738 gbhtg4.seq
250056767 gbhtg40.seq
250165562 gbhtg41.seq
250149847 gbhtg42.seq
250096938 gbhtg43.seq
250007616 gbhtg44.seq
250101256 gbhtg45.seq
250494564 gbhtg46.seq
250128822 gbhtg47.seq
250249866 gbhtg48.seq
250181462 gbhtg49.seq
250212018 gbhtg5.seq
250256783 gbhtg50.seq
250189960 gbhtg51.seq
250018478 gbhtg52.seq
250057699 gbhtg53.seq
250125419 gbhtg54.seq
250238545 gbhtg55.seq
250078161 gbhtg56.seq
250246531 gbhtg57.seq
250017186 gbhtg58.seq
250131935 gbhtg59.seq
250055961 gbhtg6.seq
250119043 gbhtg60.seq
250123761 gbhtg61.seq
250226301 gbhtg62.seq
250133978 gbhtg63.seq
250178878 gbhtg64.seq
250059819 gbhtg65.seq
250184459 gbhtg66.seq
250200618 gbhtg67.seq
250128414 gbhtg68.seq
250154873 gbhtg69.seq
250006820 gbhtg7.seq
250001719 gbhtg70.seq
250021443 gbhtg71.seq
250090925 gbhtg72.seq
250214423 gbhtg73.seq
250032714 gbhtg74.seq
250139620 gbhtg75.seq
250094947 gbhtg76.seq
250112163 gbhtg77.seq
250190545 gbhtg78.seq
250029568 gbhtg79.seq
250126658 gbhtg8.seq
250219716 gbhtg80.seq
250123836 gbhtg81.seq
250137234 gbhtg82.seq
250099027 gbhtg83.seq
250020182 gbhtg84.seq
250212661 gbhtg85.seq
250220384 gbhtg86.seq
250196276 gbhtg87.seq
250229275 gbhtg88.seq
250202164 gbhtg89.seq
250011311 gbhtg9.seq
250099412 gbhtg90.seq
250012111 gbhtg91.seq
250196800 gbhtg92.seq
250108884 gbhtg93.seq
250104562 gbhtg94.seq
250204873 gbhtg95.seq
250119686 gbhtg96.seq
250054021 gbhtg97.seq
250076172 gbhtg98.seq
250172116 gbhtg99.seq
250052201 gbinv1.seq
250000533 gbinv10.seq
250002704 gbinv11.seq
250126428 gbinv12.seq
149141990 gbinv13.seq
250190796 gbinv2.seq
277136152 gbinv3.seq
250000185 gbinv4.seq
250188345 gbinv5.seq
249948982 gbinv6.seq
250001771 gbinv7.seq
250002199 gbinv8.seq
250004429 gbinv9.seq
141021828 gbjou1.idx
148482681 gbjou2.idx
207224509 gbjou3.idx
281958631 gbjou4.idx
256245843 gbjou5.idx
9464718 gbjou6.idx
185207511 gbkey1.idx
256337691 gbkey2.idx
63002388 gbkey3.idx
250185260 gbmam1.seq
250002153 gbmam2.seq
250000661 gbmam3.seq
189451332 gbmam4.seq
66672277 gbnew.txt
250000466 gbpat1.seq
250004782 gbpat10.seq
250000474 gbpat11.seq
250000314 gbpat12.seq
250000624 gbpat13.seq
250002798 gbpat14.seq
250000769 gbpat15.seq
250000948 gbpat16.seq
250005842 gbpat17.seq
250000633 gbpat18.seq
250002714 gbpat19.seq
250007646 gbpat2.seq
250000833 gbpat20.seq
250000844 gbpat21.seq
250054920 gbpat22.seq
250000947 gbpat23.seq
250000303 gbpat24.seq
250007016 gbpat25.seq
250000393 gbpat26.seq
250000496 gbpat27.seq
250001139 gbpat28.seq
250097988 gbpat29.seq
250000361 gbpat3.seq
250001873 gbpat30.seq
250000600 gbpat31.seq
250000738 gbpat32.seq
250003288 gbpat33.seq
250001781 gbpat34.seq
250000952 gbpat35.seq
250001253 gbpat36.seq
250002961 gbpat37.seq
250000335 gbpat38.seq
250001429 gbpat39.seq
250003883 gbpat4.seq
250000642 gbpat40.seq
250016388 gbpat41.seq
250001260 gbpat42.seq
250000722 gbpat43.seq
250000351 gbpat44.seq
250000530 gbpat45.seq
250000612 gbpat46.seq
220669732 gbpat47.seq
250001407 gbpat5.seq
250000999 gbpat6.seq
250000034 gbpat7.seq
250002015 gbpat8.seq
250002306 gbpat9.seq
79484791 gbphg.seq
250001591 gbpln1.seq
250295714 gbpln10.seq
250008370 gbpln11.seq
250004416 gbpln12.seq
250001230 gbpln13.seq
250000589 gbpln14.seq
250024593 gbpln15.seq
252685629 gbpln16.seq
295953043 gbpln17.seq
251258781 gbpln18.seq
250002193 gbpln19.seq
250121696 gbpln2.seq
250000924 gbpln20.seq
250012961 gbpln21.seq
250000344 gbpln22.seq
250076206 gbpln23.seq
254259000 gbpln24.seq
250000365 gbpln25.seq
250001398 gbpln26.seq
250001190 gbpln27.seq
250002062 gbpln28.seq
250002064 gbpln29.seq
250063659 gbpln3.seq
250000496 gbpln30.seq
250008383 gbpln31.seq
50809181 gbpln32.seq
250047515 gbpln4.seq
250000447 gbpln5.seq
250001251 gbpln6.seq
250007082 gbpln7.seq
250004660 gbpln8.seq
250308908 gbpln9.seq
250175129 gbpri1.seq
250261801 gbpri10.seq
250186277 gbpri11.seq
250004885 gbpri12.seq
250089133 gbpri13.seq
250254497 gbpri14.seq
250223316 gbpri15.seq
250077694 gbpri16.seq
250131249 gbpri17.seq
250041332 gbpri18.seq
250103287 gbpri19.seq
250003502 gbpri2.seq
250002034 gbpri20.seq
250001856 gbpri21.seq
250032903 gbpri22.seq
250197320 gbpri23.seq
250041193 gbpri24.seq
250048733 gbpri25.seq
250049987 gbpri26.seq
250109407 gbpri27.seq
250159568 gbpri28.seq
250009929 gbpri29.seq
250206247 gbpri3.seq
250025537 gbpri30.seq
250005489 gbpri31.seq
250010337 gbpri32.seq
250019925 gbpri33.seq
250009336 gbpri34.seq
250003693 gbpri35.seq
189987572 gbpri36.seq
250023802 gbpri4.seq
250030668 gbpri5.seq
250003826 gbpri6.seq
250059387 gbpri7.seq
250267513 gbpri8.seq
250182875 gbpri9.seq
325604 gbrel.txt
250170470 gbrod1.seq
250076277 gbrod10.seq
250046491 gbrod11.seq
250140011 gbrod12.seq
250001460 gbrod13.seq
250076451 gbrod14.seq
250125238 gbrod15.seq
250019831 gbrod16.seq
250000477 gbrod17.seq
250038782 gbrod18.seq
250230008 gbrod19.seq
250013655 gbrod2.seq
250112663 gbrod20.seq
250001241 gbrod21.seq
250003855 gbrod22.seq
250023675 gbrod23.seq
250225220 gbrod24.seq
250001558 gbrod25.seq
181380023 gbrod26.seq
250186463 gbrod3.seq
250155443 gbrod4.seq
250003494 gbrod5.seq
250170395 gbrod6.seq
250093824 gbrod7.seq
250213886 gbrod8.seq
250171009 gbrod9.seq
1552586792 gbsdr1.txt
4599825406 gbsdr2.txt
1967203095 gbsdr3.txt
117934435 gbsec.idx
250002840 gbsts1.seq
250000051 gbsts10.seq
250001117 gbsts11.seq
250002763 gbsts12.seq
250000666 gbsts13.seq
250001496 gbsts14.seq
250002313 gbsts15.seq
250000949 gbsts16.seq
250001651 gbsts17.seq
48953338 gbsts18.seq
250001798 gbsts2.seq
250001049 gbsts3.seq
250003031 gbsts4.seq
250003373 gbsts5.seq
250002668 gbsts6.seq
250000183 gbsts7.seq
250002100 gbsts8.seq
250001612 gbsts9.seq
250000732 gbsyn1.seq
146220933 gbsyn2.seq
10047685 gbtsa.seq
430663 gbuna.seq
250002557 gbvrl1.seq
68868408 gbvrl10.seq
250001325 gbvrl2.seq
250005485 gbvrl3.seq
250001532 gbvrl4.seq
250002233 gbvrl5.seq
250000623 gbvrl6.seq
250000245 gbvrl7.seq
250005685 gbvrl8.seq
250000904 gbvrl9.seq
250137525 gbvrt1.seq
250013499 gbvrt10.seq
250048806 gbvrt11.seq
250108962 gbvrt12.seq
250109989 gbvrt13.seq
250001494 gbvrt14.seq
250000597 gbvrt15.seq
217803325 gbvrt16.seq
250001474 gbvrt2.seq
250117008 gbvrt3.seq
250001555 gbvrt4.seq
250000582 gbvrt5.seq
250004164 gbvrt6.seq
250259646 gbvrt7.seq
250070111 gbvrt8.seq
250109867 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 37985 103087307
BCT10 46128 97313396
BCT11 118 105721945
BCT12 140 104771590
BCT13 62 113763681
BCT14 47 112439895
BCT15 53 117813056
BCT16 53 116510730
BCT17 72 114855045
BCT18 40 111252551
BCT19 59 110053219
BCT2 3251 110513586
BCT20 66 113751799
BCT21 57 113214682
BCT22 66 109836677
BCT23 57 113012388
BCT24 48 110366471
BCT25 82 112049307
BCT26 66 111259766
BCT27 89 110223377
BCT28 267 103331657
BCT29 68110 83286227
BCT3 60 115722057
BCT30 77099 79700009
BCT31 47078 92212218
BCT32 7090 17695981
BCT4 22460 103645634
BCT5 54651 86880293
BCT6 5710 95834402
BCT7 13889 97090975
BCT8 5624 106922369
BCT9 23647 106459309
ENV1 91351 71716522
ENV10 59423 48626542
ENV2 95015 69338769
ENV3 83634 81639041
ENV4 89514 86660103
ENV5 110451 56163891
ENV6 125873 36804577
ENV7 89427 73983066
ENV8 86474 81951729
ENV9 79903 93673479
EST1 68125 26289403
EST10 76524 29834002
EST100 75486 34950706
EST101 75009 43146503
EST102 71268 36591486
EST103 74270 37011621
EST104 73086 40111802
EST105 74390 39713863
EST106 70390 39919818
EST107 68686 36533883
EST108 73300 36600330
EST109 72223 45448015
EST11 75175 28789926
EST110 72193 45587744
EST111 69910 43202474
EST112 72842 33133128
EST113 69573 29469615
EST114 67338 37812898
EST115 68175 36514923
EST116 68461 41647704
EST117 72429 36800803
EST118 75080 34648709
EST119 74542 27227139
EST12 77544 30745583
EST120 73706 34519684
EST121 73986 35748572
EST122 64719 36896553
EST123 80509 44758158
EST124 78080 43346741
EST125 68577 47951550
EST126 67580 39749692
EST127 74495 50929120
EST128 69124 41654243
EST129 74407 44783532
EST13 76983 29267115
EST130 73941 45645628
EST131 71491 49340319
EST132 72623 47801211
EST133 79066 44425836
EST134 75139 31080243
EST135 78167 34177166
EST136 79222 45795968
EST137 74706 43078198
EST138 64549 34648976
EST139 70669 36460001
EST14 78809 31965533
EST140 67838 37172271
EST141 65806 36675753
EST142 71503 43482741
EST143 72634 45635472
EST144 67822 39282225
EST145 68620 39487022
EST146 74391 45319848
EST147 67617 39739919
EST148 62619 35685308
EST149 99539 54163382
EST15 74538 31502042
EST150 79251 45321555
EST151 84675 44115275
EST152 104239 55162979
EST153 105251 57265407
EST154 98848 56443192
EST155 74313 44546078
EST156 93939 55920625
EST157 98630 59071549
EST158 92861 54892160
EST159 78938 45322109
EST16 75869 33347122
EST160 68819 37767828
EST161 66136 30117337
EST162 60230 27709054
EST163 56247 27399302
EST164 64846 31425958
EST165 54091 27153105
EST166 79645 53053897
EST167 67817 37281940
EST168 72142 52380947
EST169 72589 41383087
EST17 82082 33820980
EST170 60321 30330985
EST171 63787 37169603
EST172 65453 33509983
EST173 63502 45595034
EST174 62867 36341475
EST175 107318 47604843
EST176 87049 51634732
EST177 103581 59969743
EST178 107797 59386557
EST179 96684 52139246
EST18 80691 32364816
EST180 82347 38263897
EST181 96447 44801815
EST182 97699 48110595
EST183 93101 37430069
EST184 90219 43134393
EST185 63952 44504491
EST186 70649 37530862
EST187 57617 33931800
EST188 71410 43413528
EST189 72330 26720552
EST19 78660 31715009
EST190 75801 45463115
EST191 73142 36952723
EST192 68368 34780543
EST193 68283 39916018
EST194 69618 51893820
EST195 68858 39558133
EST196 67600 33738207
EST197 69082 52939799
EST198 68142 46192762
EST199 72239 37057510
EST2 74644 28643983
EST20 74627 30756939
EST200 68117 45884610
EST201 70146 58387505
EST202 63801 47386758
EST203 63471 46612088
EST204 63747 46092603
EST205 64768 45835795
EST206 66999 50504509
EST207 61579 40150072
EST208 61802 35613024
EST209 66472 37666254
EST21 74038 34350476
EST210 68494 38691675
EST211 91014 51446269
EST212 71549 50510267
EST213 88390 52011014
EST214 113229 69963858
EST215 115169 68308057
EST216 103648 62477629
EST217 98487 64055442
EST218 119097 56041036
EST219 97026 51727787
EST22 74912 30009022
EST220 85980 51939996
EST221 93071 41279998
EST222 86991 45350958
EST223 72479 47398662
EST224 66771 42928876
EST225 68624 57968316
EST226 67891 59149018
EST227 79814 40399524
EST228 80269 45454928
EST229 73734 52081037
EST23 77381 32705944
EST230 70884 51895428
EST231 45068 24453069
EST232 27996 10618419
EST233 27940 10318094
EST234 26571 9892410
EST235 26863 9084318
EST236 27701 9776844
EST237 27400 10160364
EST238 27383 9834708
EST239 27538 10325089
EST24 74758 32789050
EST240 27315 12196014
EST241 27425 11317294
EST242 27517 10196544
EST243 27825 9353317
EST244 27104 9280785
EST245 27996 11414942
EST246 27974 10889588
EST247 27228 11413228
EST248 26844 12062773
EST249 27279 11399609
EST25 74100 31976744
EST250 27246 11003114
EST251 27238 11659126
EST252 27354 11665319
EST253 27478 11099361
EST254 27473 10926209
EST255 27369 10558562
EST256 27320 11509141
EST257 24572 17398462
EST258 26014 17380933
EST259 48348 22474608
EST26 75168 31024583
EST260 89179 41025627
EST261 72612 42580904
EST262 71129 32872713
EST263 93068 40377357
EST264 70316 43884428
EST265 69181 44592907
EST266 69125 44316473
EST267 67575 41919486
EST268 73275 43087565
EST269 66323 38543559
EST27 74427 32413121
EST270 66492 50079207
EST271 60520 28515240
EST272 93544 45407733
EST273 95773 46623787
EST274 71523 40357408
EST275 61739 29840643
EST276 70725 36956160
EST277 70569 40456417
EST278 73717 34220756
EST279 70306 37812588
EST28 107890 51049016
EST280 70801 45050454
EST281 65092 37884455
EST282 69412 34008554
EST283 86423 46211890
EST284 73740 42032239
EST285 78466 55353947
EST286 86826 52022279
EST287 105794 47651268
EST288 78384 45804009
EST289 72078 41861241
EST29 97107 45876209
EST290 74041 39594740
EST291 68651 33258737
EST292 70410 28128399
EST293 66366 40016120
EST294 61814 35736284
EST295 66236 42195856
EST296 69234 39853105
EST297 63766 44075309
EST298 68707 34522092
EST299 81565 44042874
EST3 73730 29915710
EST30 98633 53896101
EST300 78864 42848127
EST301 86805 51731072
EST302 113226 51817153
EST303 108393 47992571
EST304 71316 37094364
EST305 67558 37166775
EST306 72369 46291458
EST307 80030 39051299
EST308 71245 43237517
EST309 70352 39285732
EST31 86682 50562197
EST310 59522 36367563
EST311 53187 29409755
EST312 69289 46764937
EST313 66378 41019242
EST314 69436 42878914
EST315 65481 38354401
EST316 77251 38626789
EST317 56926 30056266
EST318 55613 28401017
EST319 54255 29577469
EST32 65127 40693235
EST320 55139 28862193
EST321 53720 29174644
EST322 57434 25344145
EST323 58067 25479701
EST324 56609 23297168
EST325 57215 22954015
EST326 57141 22087248
EST327 58322 23787837
EST328 57303 22311117
EST329 58086 21507372
EST33 70612 57597862
EST330 60896 25065570
EST331 76008 42134245
EST332 76546 34969305
EST333 78610 32421943
EST334 76480 32285882
EST335 87434 53432093
EST336 62431 47840998
EST337 76116 49184417
EST338 96094 59504440
EST339 97717 57453064
EST34 84700 48512876
EST340 101679 57773126
EST341 99304 55057187
EST342 74296 38914310
EST343 69664 39876077
EST344 74231 44457163
EST345 61357 53900233
EST346 64849 46408051
EST347 62312 38130168
EST348 65326 40253448
EST349 71686 48431186
EST35 85782 42878242
EST350 47817 24035877
EST351 52529 26335987
EST352 74214 41324419
EST353 60932 31878262
EST354 60157 31270824
EST355 67090 43020806
EST356 83078 41794025
EST357 71160 41988443
EST358 68080 43724474
EST359 65020 37020821
EST36 89921 48471450
EST360 68092 44302365
EST361 86575 48927649
EST362 84715 50496830
EST363 75364 41456848
EST364 63039 36462720
EST365 67977 35031588
EST366 69545 38444161
EST367 47053 24082868
EST368 70797 40068962
EST369 70925 42669117
EST37 86717 61702415
EST370 98837 46115338
EST371 73863 47571653
EST372 70311 45478715
EST373 68931 44573942
EST374 63972 34961805
EST375 79608 37058077
EST376 77015 38608125
EST377 56814 39998217
EST378 59338 38844996
EST379 62386 38215242
EST38 77240 50263921
EST380 89621 51909731
EST381 86158 46280188
EST382 66303 44113378
EST383 77512 39650705
EST384 50395 31882473
EST385 44142 23145291
EST386 70312 45388789
EST387 79828 40708185
EST388 79143 46860770
EST389 73437 45806983
EST39 95857 56327670
EST390 77919 47326632
EST391 78267 50533959
EST392 86063 65022463
EST393 78437 69528821
EST394 87798 51844848
EST395 79650 54313041
EST396 71104 58449059
EST397 72262 39900123
EST398 60617 39289024
EST399 73604 40102845
EST4 74560 28391201
EST40 63845 49100302
EST400 53623 33222933
EST401 74611 31165183
EST402 79709 25495188
EST403 70040 45068532
EST404 66040 37882159
EST405 69684 36539984
EST406 66745 41194099
EST407 74239 47046786
EST408 65614 44249064
EST409 73787 43480367
EST41 78128 55394364
EST410 59359 32906931
EST411 64485 39217668
EST412 77718 50035756
EST413 83292 48432643
EST414 79838 44895069
EST415 58851 40761639
EST416 56024 40807329
EST417 56783 39973913
EST418 61424 39104047
EST419 75981 48250709
EST42 100768 48049302
EST420 51412 31063139
EST421 63089 38906743
EST422 60287 40004940
EST423 56438 41229367
EST424 60109 41572586
EST425 47538 33413124
EST426 84068 43110547
EST427 73743 39000920
EST428 70562 38852132
EST429 70629 38819220
EST43 75894 46167770
EST430 70496 39122103
EST431 70482 38957193
EST432 70382 39260112
EST433 69846 38818968
EST434 69826 38701057
EST435 69851 39690329
EST436 69523 38730834
EST437 68065 38508983
EST438 70121 39686343
EST439 70282 38522006
EST44 105048 44849434
EST440 70278 39067625
EST441 70286 38366001
EST442 70695 38691909
EST443 70588 38805844
EST444 70594 38741640
EST445 70746 38027405
EST446 81622 45637184
EST447 88178 47179705
EST448 82853 37832926
EST449 103509 59249272
EST45 92510 51445623
EST450 82599 45878976
EST451 75629 48298360
EST452 82601 47982456
EST453 88872 52539687
EST454 96939 60324012
EST455 82614 48995138
EST456 89184 49128672
EST457 87828 48333752
EST458 78728 57665706
EST459 91859 52548934
EST46 103526 45756218
EST460 76726 50871236
EST461 58417 41745465
EST462 96218 64918920
EST463 96661 66301168
EST464 102311 60842507
EST465 111840 44533562
EST466 78528 41807926
EST467 51621 40318776
EST468 67150 45242404
EST469 67040 37851428
EST47 70160 19034288
EST470 66101 39738701
EST471 105468 53575765
EST472 82622 49739509
EST473 87586 54559897
EST474 58540 40769550
EST475 45268 34516923
EST476 46873 58506267
EST477 65319 55879620
EST478 64504 41693534
EST479 73178 42570250
EST48 70451 18757242
EST480 72959 42879175
EST481 67111 43815166
EST482 67152 42364515
EST483 61356 50318264
EST484 109159 47959300
EST485 101107 48190246
EST486 67499 50208767
EST487 53763 38885575
EST488 57096 39670385
EST489 61997 41884419
EST49 72841 21728988
EST490 63883 48036126
EST491 63294 46342836
EST492 57531 39597257
EST493 50959 38534605
EST494 59084 40454816
EST495 58745 37930015
EST496 70847 41427766
EST497 60844 41282064
EST498 56896 38504908
EST499 62215 45430043
EST5 48193 15292118
EST50 44093 12154300
EST500 58389 45744287
EST501 66650 47325399
EST502 58092 40590334
EST503 56491 40623689
EST504 53040 34377424
EST505 56434 39472012
EST506 55266 36316228
EST507 77350 43252243
EST508 62689 51781877
EST509 73090 55337437
EST51 44038 12222409
EST510 77983 49310818
EST511 46691 56300035
EST512 53184 50460855
EST513 66770 53233997
EST514 57938 38937936
EST515 73077 39104489
EST516 84757 54944948
EST517 80885 53333832
EST518 73842 43973558
EST519 58706 38809506
EST52 43825 11870819
EST520 72628 47091676
EST521 81679 50049023
EST522 79291 55426850
EST523 71411 54861801
EST524 71445 50577074
EST525 65894 44295768
EST526 66011 50985546
EST527 62727 45397393
EST528 70341 44246631
EST529 78360 44833662
EST53 64243 24464286
EST530 97334 43199776
EST531 122707 46349975
EST532 87454 54569208
EST533 55387 49923185
EST534 56397 47724313
EST535 91952 21728728
EST536 99699 11057706
EST537 99477 12312203
EST538 94915 44544825
EST539 86887 31647465
EST54 96605 39158502
EST540 86053 34745006
EST541 61327 63756447
EST542 89690 56555707
EST543 82857 45736016
EST544 68719 42704514
EST545 71988 49383722
EST546 75926 48650885
EST547 89456 52581556
EST548 70777 51063898
EST549 69970 50182615
EST55 97045 42531157
EST550 69319 52045250
EST551 80723 54745251
EST552 86731 43702496
EST553 82803 47112218
EST554 83459 38828715
EST555 79142 41552292
EST556 79918 52295089
EST557 74291 55690279
EST558 71975 51921873
EST559 75928 44148850
EST56 97596 47119535
EST560 98336 49709354
EST561 112596 46994879
EST562 111414 48468020
EST563 130484 58927660
EST564 110969 53982038
EST565 77014 55394697
EST566 79432 33487464
EST567 84288 8748097
EST568 88182 25793658
EST569 115986 57006251
EST57 92584 46417811
EST570 93366 49298972
EST571 65959 43185627
EST572 70963 42369216
EST573 75655 51909119
EST574 70945 43292872
EST575 78070 46611413
EST576 68014 48541753
EST577 76125 52294453
EST578 98469 53296078
EST579 87235 42562485
EST58 103582 51181242
EST580 64340 41731363
EST581 62416 46892284
EST582 97217 59180062
EST583 89428 52172073
EST584 74795 42476755
EST585 86266 27567681
EST586 96768 10472272
EST587 96889 10256687
EST588 93106 25698031
EST589 70818 45048777
EST59 106437 54596694
EST590 94049 45472410
EST591 71411 50615628
EST592 78529 54904803
EST593 87515 53315928
EST594 85201 56269938
EST595 83037 55352867
EST596 81776 42577073
EST597 81449 48428741
EST598 72071 51452108
EST599 61412 40076625
EST6 54905 17436848
EST60 76030 33372423
EST600 80107 30959074
EST601 93669 40950861
EST602 49933 34816309
EST603 51543 31605926
EST604 50716 35445908
EST605 67500 42857357
EST606 67838 47160636
EST607 64704 47965285
EST608 119771 13985750
EST609 118201 14569998
EST61 66646 28476102
EST610 122569 11158624
EST611 122481 11293461
EST612 98250 26535040
EST613 64765 48473513
EST614 68220 47536566
EST615 78070 53534514
EST616 71032 49169390
EST617 67438 45805260
EST618 77696 44184166
EST619 63641 43191363
EST62 72722 32570189
EST620 73967 39317153
EST621 123631 15447395
EST622 127150 11897375
EST623 79132 41013805
EST624 74355 49330872
EST625 69951 50024025
EST626 94370 46445119
EST627 87507 56114673
EST628 63648 36735158
EST629 61663 32190263
EST63 70581 29993612
EST630 81413 63780151
EST631 71695 47120053
EST632 108438 47437252
EST633 84080 53697787
EST634 61407 48615922
EST635 64549 55311844
EST636 75846 42831334
EST637 82079 43922680
EST638 94002 55232100
EST639 83306 39410355
EST64 79688 32615418
EST640 74294 46667260
EST641 71396 47135776
EST642 70780 50971319
EST643 89071 39958565
EST644 77417 26374515
EST645 77602 24845622
EST646 75325 29422823
EST647 76380 26769187
EST648 76264 29234549
EST649 76225 29597083
EST65 77140 30252594
EST650 75633 28559706
EST651 76408 27937123
EST652 76503 29508321
EST653 76521 28899477
EST654 82094 44982558
EST655 80921 55574364
EST656 81953 59809341
EST657 83789 54943408
EST658 65063 33610533
EST659 61545 40750825
EST66 70458 28327055
EST660 79404 46712843
EST661 50372 25862426
EST662 41029 34315829
EST663 59651 45092113
EST664 58285 45169077
EST665 67520 46969453
EST666 81357 40426806
EST667 63689 39992663
EST668 89951 49284707
EST669 75329 43364031
EST67 64705 29620254
EST670 64626 42305813
EST671 78072 51321310
EST672 78960 42961700
EST673 62665 37117088
EST674 71441 50035141
EST675 73258 47143969
EST676 60338 41863769
EST677 70806 52316829
EST678 72040 47298594
EST679 74058 46317823
EST68 72963 32529439
EST680 68926 48414218
EST681 70553 52960589
EST682 81615 69549653
EST683 82049 69476646
EST684 80165 62741523
EST685 77410 39019138
EST686 71950 33063935
EST687 53183 30737501
EST688 68017 48385556
EST689 63489 40170500
EST69 79427 35592773
EST690 65935 48581781
EST691 68465 45958335
EST692 58573 39300588
EST693 56795 39026073
EST694 61882 41285125
EST695 68995 44165101
EST696 65198 44894671
EST697 65850 46031653
EST698 66079 45054368
EST699 69791 45596634
EST7 74531 29353676
EST70 73498 29341392
EST700 71056 39704004
EST701 68503 36136732
EST702 66624 40096994
EST703 67712 37677760
EST704 68980 40131265
EST705 69175 49501114
EST706 70938 56659969
EST707 64758 36091386
EST708 67406 40345625
EST709 67711 46330426
EST71 73806 25015643
EST710 59549 37150159
EST711 65477 40407962
EST712 62070 37753224
EST713 68706 43037643
EST714 92182 53224674
EST715 101720 50007173
EST716 70567 42877162
EST717 56900 27473267
EST718 52284 30868169
EST719 51834 31893909
EST72 86894 42217651
EST720 58634 40215591
EST721 60521 39342501
EST722 58276 37762087
EST723 66377 40776041
EST724 57211 37516113
EST725 54844 34270397
EST726 55504 34374362
EST727 79578 41149662
EST728 126780 37070130
EST729 80816 45191734
EST73 43954 12696003
EST730 73712 28622023
EST731 78899 37107706
EST732 64224 44535638
EST733 82407 46928454
EST734 81474 50115849
EST735 66873 43676041
EST736 81578 45140617
EST737 57406 38607877
EST738 57853 37522228
EST739 61392 42155735
EST74 40874 11260611
EST740 59765 39254963
EST741 60003 38666909
EST742 62780 41736758
EST743 80944 47945202
EST744 90425 63985894
EST745 81866 44259558
EST746 67098 36458888
EST747 59953 29971526
EST748 74874 41579261
EST749 82638 60936654
EST75 40850 12515453
EST750 77794 59354775
EST751 54051 38024103
EST752 32457 19723958
EST753 32684 19344556
EST754 32456 19594999
EST755 48532 26906616
EST756 61275 36615939
EST757 58776 35122822
EST758 58733 35230008
EST759 59116 34272301
EST76 41228 12730524
EST760 70792 19821459
EST761 70958 14800681
EST762 71293 13980470
EST763 70933 14825126
EST764 71210 14173458
EST765 69968 18811895
EST766 85121 45769118
EST767 78066 57976169
EST768 72445 44711386
EST769 61435 39710769
EST77 41274 12338337
EST770 60486 40029173
EST771 60418 38520099
EST772 61924 39446730
EST773 62621 37354338
EST774 64495 39316143
EST775 84142 49675029
EST776 77673 52478000
EST777 60905 35598437
EST778 77997 53696747
EST779 77318 14394300
EST78 41244 13330271
EST780 75576 5877015
EST781 75773 5850437
EST782 70484 6063071
EST783 69080 6166987
EST784 70524 10679667
EST785 70855 15006485
EST786 71143 14335785
EST787 71106 14420172
EST788 71046 14558093
EST789 71270 14034958
EST79 40995 13023750
EST790 70822 15084210
EST791 66737 42288473
EST792 64959 41029210
EST793 79659 40475846
EST794 83765 55730828
EST795 78393 40944688
EST796 71299 25372110
EST797 73084 27106466
EST798 72506 26258123
EST799 79251 26707064
EST8 75810 30584188
EST80 41041 12262440
EST800 72629 27332141
EST801 68007 28848589
EST802 24912 7783677
EST81 40611 12120632
EST82 41359 12908870
EST83 41909 11978787
EST84 41487 13235885
EST85 41351 13058500
EST86 42961 13082170
EST87 46667 17288181
EST88 43357 27222605
EST89 43050 19570387
EST9 77564 29870697
EST90 49439 20284334
EST91 51551 22240706
EST92 51014 22004749
EST93 84132 49835822
EST94 79483 38757178
EST95 72644 27616943
EST96 74542 29315402
EST97 74671 40808097
EST98 77241 40683215
EST99 76761 44064984
GSS1 90430 38662943
GSS10 74787 43607320
GSS100 80735 53971664
GSS101 74738 42240517
GSS102 73329 45795023
GSS103 73648 44992357
GSS104 73318 45586185
GSS105 73322 44678178
GSS106 74426 45470373
GSS107 81407 54214366
GSS108 83607 55584656
GSS109 80497 53099504
GSS11 70802 35983221
GSS110 83236 50414169
GSS111 84022 55210073
GSS112 79938 61714412
GSS113 90046 45964896
GSS114 90349 54605890
GSS115 75631 49835317
GSS116 87925 63549447
GSS117 82334 60106582
GSS118 75605 39949531
GSS119 81448 52672069
GSS12 73150 38495437
GSS120 95653 53247821
GSS121 84443 55332718
GSS122 85011 54678646
GSS123 82368 54883067
GSS124 76259 69411509
GSS125 76066 67163569
GSS126 79639 56039680
GSS127 72433 50238646
GSS128 72549 50010064
GSS129 73030 49226869
GSS13 76795 38906116
GSS130 72287 50500475
GSS131 73656 49939229
GSS132 83999 59977943
GSS133 81197 58380156
GSS134 70044 56408758
GSS135 70519 55044741
GSS136 75952 67607108
GSS137 75457 63186502
GSS138 77457 52326030
GSS139 85499 53662696
GSS14 71379 32114760
GSS140 94711 58049538
GSS141 93303 59893634
GSS142 81959 53930110
GSS143 89769 50596214
GSS144 72103 59090159
GSS145 114930 59510836
GSS146 111067 58394737
GSS147 86226 63647120
GSS148 55178 31343387
GSS149 67105 47299600
GSS15 70493 35055254
GSS150 72995 55896884
GSS151 72982 55920430
GSS152 73000 55888683
GSS153 73012 55866150
GSS154 72970 55939668
GSS155 72980 55922259
GSS156 75708 57785716
GSS157 83527 39195265
GSS158 88049 60128101
GSS159 86771 64920423
GSS16 78213 46093569
GSS160 88032 59819062
GSS161 92550 57472558
GSS162 82885 57227406
GSS163 76243 49677822
GSS164 75772 48590426
GSS165 92705 58637962
GSS166 88991 59730761
GSS167 85988 61453517
GSS168 102785 26254090
GSS169 103091 29421157
GSS17 70895 33315071
GSS170 78937 46757646
GSS171 80953 52896553
GSS172 54393 39355316
GSS173 52629 40815204
GSS174 61916 51489913
GSS175 59033 45447126
GSS176 57768 48361707
GSS177 57489 48794310
GSS178 58190 46599959
GSS179 58380 46034204
GSS18 58792 27918452
GSS180 58913 47990219
GSS181 58948 48421626
GSS182 58611 49465131
GSS183 58245 48434809
GSS184 58637 46079420
GSS185 58719 49348955
GSS186 60104 50321764
GSS187 60305 49772098
GSS188 60508 49164257
GSS189 60377 49554722
GSS19 56814 29015258
GSS190 60516 49138957
GSS191 60060 46962471
GSS192 59200 45202313
GSS193 58415 47678703
GSS194 58931 46062299
GSS195 58876 46232825
GSS196 58306 48020428
GSS197 58245 48210188
GSS198 58202 48387004
GSS199 60127 50007696
GSS2 89000 39334171
GSS20 57683 26671178
GSS200 59839 50876053
GSS201 59838 49497368
GSS202 60656 45813431
GSS203 60308 46895293
GSS204 59407 49677503
GSS205 59531 49301271
GSS206 59551 49239309
GSS207 59455 49530770
GSS208 59579 49152997
GSS209 59522 49326606
GSS21 61491 29519987
GSS210 59723 48712929
GSS211 59642 48960618
GSS212 59849 48330986
GSS213 58886 46171120
GSS214 58868 45994499
GSS215 58413 47567397
GSS216 58238 48171337
GSS217 58745 46253148
GSS218 57876 48032392
GSS219 64298 54163485
GSS22 64602 37591837
GSS220 64817 54769958
GSS221 89902 58795964
GSS222 84295 44773209
GSS223 78136 60371736
GSS224 83485 53267000
GSS225 91296 49820327
GSS226 75286 51935250
GSS227 71267 47113208
GSS228 71250 47155099
GSS229 95864 51401755
GSS23 57530 27078431
GSS230 99936 64620685
GSS231 86959 56293913
GSS232 96188 62489933
GSS233 95177 63748502
GSS234 96245 62423957
GSS235 95244 63549310
GSS236 95366 63292630
GSS237 92351 67045932
GSS238 94160 64797649
GSS239 94730 64082872
GSS24 66204 42045465
GSS240 92708 66603193
GSS241 93223 65960615
GSS242 93514 65605769
GSS243 92264 67436181
GSS244 94722 64620437
GSS245 90096 69967289
GSS246 88195 68094915
GSS247 74079 52063976
GSS248 57273 34832409
GSS249 38997 24737188
GSS25 68012 28208036
GSS250 87217 64373883
GSS251 83566 62776031
GSS252 103540 48483911
GSS253 68530 58477321
GSS254 68305 58780400
GSS255 69369 56628381
GSS256 69629 56122564
GSS257 70549 56031360
GSS258 76223 57617337
GSS259 75918 58207370
GSS26 58165 25385995
GSS260 87215 74862382
GSS261 81577 44450380
GSS262 92198 44663657
GSS263 84649 64710112
GSS264 71286 59060430
GSS265 69694 58679614
GSS266 65139 62481473
GSS267 72980 48816193
GSS268 86771 34797714
GSS269 112723 70591694
GSS27 65496 32012382
GSS270 94949 75105285
GSS271 94412 49704007
GSS272 106409 58075599
GSS273 120672 73157517
GSS274 117335 76455142
GSS275 105014 56031468
GSS276 82745 54504973
GSS277 95126 59659055
GSS278 107324 78645180
GSS279 108174 77737159
GSS28 65277 32524263
GSS280 106138 79943501
GSS281 105057 81113062
GSS282 76838 51605435
GSS283 108206 65748843
GSS284 109872 66411798
GSS285 106648 59622383
GSS286 68481 37441557
GSS287 70209 39114793
GSS288 88669 44463461
GSS289 81637 45113812
GSS29 77560 39751724
GSS290 109460 57442394
GSS291 85677 50315778
GSS292 105339 59012959
GSS293 115405 41727653
GSS294 115631 44545878
GSS295 94794 73330877
GSS296 95872 55062873
GSS297 95364 37373389
GSS298 95597 36967311
GSS299 95851 36540192
GSS3 87422 41844005
GSS30 82722 39709532
GSS300 94452 38888762
GSS301 102286 62831084
GSS302 94514 61248322
GSS303 94849 60760745
GSS304 95052 60468383
GSS305 84020 55739568
GSS306 83903 28239656
GSS307 84172 27748051
GSS308 85189 27626075
GSS309 12713 5752060
GSS31 74196 40403296
GSS32 70296 48150506
GSS33 79819 37806757
GSS34 75886 40326853
GSS35 74137 39965937
GSS36 87407 56321961
GSS37 87597 58175336
GSS38 85527 44938754
GSS39 86748 50382457
GSS4 79227 41150659
GSS40 86338 39890925
GSS41 83128 32053103
GSS42 81246 56934526
GSS43 80119 58036205
GSS44 72015 47522099
GSS45 72042 47418737
GSS46 77593 45700878
GSS47 77817 38710219
GSS48 83136 57946480
GSS49 86562 64736594
GSS5 78819 40567994
GSS50 81619 54415202
GSS51 93859 59286241
GSS52 88468 58760461
GSS53 76598 42227197
GSS54 72837 40526305
GSS55 86497 47027164
GSS56 88038 58467263
GSS57 76195 63888101
GSS58 70809 77994698
GSS59 85505 69015835
GSS6 78088 38842501
GSS60 89580 60228581
GSS61 63450 44798512
GSS62 66010 45382089
GSS63 89643 67177279
GSS64 84960 58429020
GSS65 86085 52989465
GSS66 85463 55672245
GSS67 93346 57853897
GSS68 97857 52536797
GSS69 97528 52972908
GSS7 77657 39174963
GSS70 98228 52048388
GSS71 99183 50781820
GSS72 99205 50753178
GSS73 99077 50923874
GSS74 99695 50102347
GSS75 97770 52652118
GSS76 91867 64654021
GSS77 89865 70740033
GSS78 88925 70111547
GSS79 87858 69635748
GSS8 75881 38134490
GSS80 87908 63986891
GSS81 88312 44882444
GSS82 78277 23271484
GSS83 78145 23584254
GSS84 84149 48917342
GSS85 77098 45548204
GSS86 88958 56028697
GSS87 84342 58665578
GSS88 75464 75654161
GSS89 78488 73099327
GSS9 72240 37167492
GSS90 83987 46687847
GSS91 85043 49406143
GSS92 73869 40395541
GSS93 80113 56218088
GSS94 76471 56905463
GSS95 82996 52877042
GSS96 82955 59174299
GSS97 85633 57672356
GSS98 86989 52201941
GSS99 82545 66443743
HTC1 25182 27239764
HTC10 63605 85166402
HTC11 67066 59970962
HTC12 70719 69845809
HTC13 4938 2858188
HTC2 16163 36534406
HTC3 16151 36807462
HTC4 16390 35877969
HTC5 16090 40454992
HTC6 16184 37874084
HTC7 55463 33965606
HTC8 82720 60349715
HTC9 74635 70557423
HTG1 1318 188929277
HTG10 1300 186477873
HTG100 1335 191169917
HTG101 1122 190121876
HTG102 1144 190022286
HTG103 1401 190534721
HTG104 1129 190599436
HTG105 1129 187012231
HTG106 1600 189291361
HTG107 979 193491311
HTG108 748 168963944
HTG109 1091 193951064
HTG11 1452 184100451
HTG110 1105 193259844
HTG111 1014 190148563
HTG112 1086 192314399
HTG113 1082 192481525
HTG114 1140 192248015
HTG115 1095 192447207
HTG116 1191 192637170
HTG117 1176 192563319
HTG118 1177 192258939
HTG119 1176 191712283
HTG12 876 192056419
HTG120 1309 191377529
HTG121 1259 191122780
HTG122 627 85461866
HTG13 750 192437652
HTG14 744 192158023
HTG15 782 192230176
HTG16 803 192009637
HTG17 769 192283132
HTG18 2064 171033537
HTG19 1071 187903257
HTG2 2465 186071856
HTG20 963 189548030
HTG21 784 191909290
HTG22 923 190306412
HTG23 902 190717511
HTG24 811 191592140
HTG25 776 192067539
HTG26 868 191479631
HTG27 889 190824411
HTG28 946 190172111
HTG29 899 191050856
HTG3 2517 185290576
HTG30 927 190341026
HTG31 870 191282856
HTG32 966 189711739
HTG33 883 191133821
HTG34 862 191459235
HTG35 822 191882341
HTG36 946 190165839
HTG37 931 190844490
HTG38 936 190384520
HTG39 1042 189423264
HTG4 2553 188532563
HTG40 1206 186874595
HTG41 1261 188238239
HTG42 1174 188051970
HTG43 1153 187982687
HTG44 1118 191410240
HTG45 1273 190757992
HTG46 1178 191498464
HTG47 1132 191453158
HTG48 1039 191574728
HTG49 1021 189959989
HTG5 1284 185715991
HTG50 1125 190248413
HTG51 973 190405971
HTG52 1105 190251567
HTG53 1046 190377837
HTG54 1015 189931982
HTG55 971 189376471
HTG56 1021 189604526
HTG57 1026 190156085
HTG58 1054 188046885
HTG59 1107 188062998
HTG6 1274 185234665
HTG60 1136 189437349
HTG61 1090 189732943
HTG62 1067 189743769
HTG63 1171 188988580
HTG64 1180 187691324
HTG65 1284 184555785
HTG66 1231 185463155
HTG67 1241 184776066
HTG68 1246 184744581
HTG69 1199 187559518
HTG7 1277 185414872
HTG70 1126 188979507
HTG71 1120 188563221
HTG72 1102 190976099
HTG73 1137 191173960
HTG74 1185 190996133
HTG75 1124 190606322
HTG76 1174 190515264
HTG77 1115 190280633
HTG78 1211 190271712
HTG79 1130 189978873
HTG8 1459 184762119
HTG80 1110 190259336
HTG81 1258 188355805
HTG82 1244 188502138
HTG83 1155 190302692
HTG84 1155 190103622
HTG85 1118 190497013
HTG86 1208 190439612
HTG87 1132 190664360
HTG88 1165 190760701
HTG89 1116 191202227
HTG9 1200 186999351
HTG90 1164 191395340
HTG91 1084 191360949
HTG92 1192 191643774
HTG93 1064 189768677
HTG94 1081 189812497
HTG95 1012 190052551
HTG96 1031 189827775
HTG97 991 189677269
HTG98 1003 189498664
HTG99 983 189592922
INV1 85671 63199158
INV10 85083 66089514
INV11 86386 64971472
INV12 70058 79172830
INV13 15900 67982201
INV2 1562 185483388
INV3 808 169978320
INV4 50407 96928913
INV5 70955 81072849
INV6 23522 127817507
INV7 71508 74138353
INV8 77385 71421640
INV9 65038 84051987
MAM1 12528 166101030
MAM2 62931 96031336
MAM3 34571 123466322
MAM4 62037 56656025
PAT1 222610 70141260
PAT10 125342 99572764
PAT11 141789 62565327
PAT12 105812 59886069
PAT13 103596 50198861
PAT14 121372 53373401
PAT15 113141 61257330
PAT16 145008 54908547
PAT17 155446 69964752
PAT18 97460 122619004
PAT19 147659 87305490
PAT2 194518 84660818
PAT20 117456 104509866
PAT21 123746 103451965
PAT22 119070 106228471
PAT23 146385 86147274
PAT24 175166 64143344
PAT25 140457 60991542
PAT26 100419 79520850
PAT27 108681 70815145
PAT28 111348 66577932
PAT29 113617 67410371
PAT3 171986 95895471
PAT30 129236 68268266
PAT31 111310 78154097
PAT32 138112 29117385
PAT33 158493 24106566
PAT34 114730 48995774
PAT35 88806 90774757
PAT36 104028 74640478
PAT37 133470 96740386
PAT38 161843 99371034
PAT39 125372 122622690
PAT4 153751 106059941
PAT40 159973 97932114
PAT41 134261 117307395
PAT42 23257 183481910
PAT43 166307 103291734
PAT44 281017 7025425
PAT45 236564 35276126
PAT46 342936 8573400
PAT47 179736 74053626
PAT5 184019 85620296
PAT6 156350 93374367
PAT7 152370 81741138
PAT8 104607 119444729
PAT9 143602 89174290
PHG 4015 32181914
PLN1 60238 93165167
PLN10 13800 133911748
PLN11 20815 136855916
PLN12 17710 145992003
PLN13 17571 146271860
PLN14 22755 139854469
PLN15 6324 157777111
PLN16 1470 171685373
PLN17 81 186636665
PLN18 6 163930483
PLN19 21817 143421195
PLN2 2129 164274056
PLN20 68475 70215225
PLN21 74523 79819811
PLN22 72671 76559194
PLN23 8755 134096755
PLN24 26232 135853046
PLN25 68521 88436254
PLN26 75668 78556644
PLN27 97709 54484171
PLN28 81577 73972655
PLN29 81103 71860990
PLN3 1563 182734671
PLN30 105625 56734993
PLN31 77359 76672209
PLN32 8778 19961000
PLN4 1978 191132159
PLN5 21209 144993446
PLN6 75914 78900236
PLN7 73956 76350546
PLN8 40075 52871852
PLN9 34258 83177385
PRI1 33835 116081062
PRI10 1448 182648841
PRI11 1285 179415902
PRI12 1448 177690472
PRI13 1592 180381653
PRI14 1592 182043355
PRI15 1286 191964893
PRI16 1139 193830345
PRI17 1100 194432678
PRI18 1197 193587602
PRI19 2154 190045022
PRI2 1643 172574468
PRI20 44646 117733208
PRI21 64672 81021282
PRI22 36166 85407539
PRI23 2615 178135054
PRI24 2183 182432282
PRI25 1603 182787810
PRI26 2010 182650725
PRI27 2110 182044752
PRI28 12853 157049945
PRI29 1661 177354804
PRI3 1308 183438540
PRI30 56574 88820446
PRI31 35384 69245637
PRI32 21284 109401951
PRI33 19364 149232213
PRI34 66669 86920294
PRI35 60550 86130909
PRI36 42149 79654092
PRI4 1347 185576366
PRI5 1199 181070059
PRI6 1185 179128978
PRI7 1233 180935126
PRI8 1320 176677110
PRI9 1248 174806991
ROD1 29398 145248238
ROD10 975 181407723
ROD11 1036 185791334
ROD12 942 183003719
ROD13 1039 189331709
ROD14 950 180462863
ROD15 968 182164790
ROD16 994 186082703
ROD17 9713 175698049
ROD18 27390 139621421
ROD19 1133 183070945
ROD2 912 175008954
ROD20 1184 184215986
ROD21 12964 165105579
ROD22 38800 70250821
ROD23 20460 110834116
ROD24 1515 190168095
ROD25 146312 22150978
ROD26 53229 56439883
ROD3 913 173613772
ROD4 903 174113178
ROD5 929 174104515
ROD6 982 179430604
ROD7 957 179789624
ROD8 994 182313248
ROD9 1002 182289292
STS1 84909 36523903
STS10 57981 44440179
STS11 57899 43582829
STS12 66657 42476872
STS13 98620 33511784
STS14 107138 27754813
STS15 106069 28906628
STS16 85236 34563504
STS17 103976 32718013
STS18 21441 6430967
STS2 84931 49980847
STS3 70631 26651644
STS4 74027 37508620
STS5 54834 32081262
STS6 54794 32059771
STS7 54680 32178936
STS8 55872 37166887
STS9 57890 44468176
SYN1 48035 72250618
SYN2 28875 39557582
TSA 3209 2720551
UNA 214 116246
VRL1 71934 66630875
VRL10 19163 19051912
VRL2 70781 64781746
VRL3 73266 63361163
VRL4 68950 70031637
VRL5 52875 74728114
VRL6 63366 71853056
VRL7 68591 67095916
VRL8 59541 72710832
VRL9 65827 72698939
VRT1 24134 153989282
VRT10 11271 175613247
VRT11 10826 177363122
VRT12 6675 180757038
VRT13 4654 186202503
VRT14 56556 104720673
VRT15 80091 68926338
VRT16 69112 58798607
VRT2 42581 130562205
VRT3 31174 139936296
VRT4 52986 107316473
VRT5 62896 66384336
VRT6 32492 62267814
VRT7 10589 173583017
VRT8 1278 190483884
VRT9 1284 189957007
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 168.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:
Entries Bases Species
11550460 13148670755 Homo sapiens
7255650 8361230436 Mus musculus
1757685 6060823765 Rattus norvegicus
2086880 5235078866 Bos taurus
3181318 4600009751 Zea mays
2489204 3551438061 Sus scrofa
1591342 2978804803 Danio rerio
1205529 1533859717 Oryza sativa Japonica Group
228091 1352737662 Strongylocentrotus purpuratus
1673038 1142531302 Nicotiana tabacum
1413112 1088892839 Xenopus (Silurana) tropicalis
212967 996533885 Pan troglodytes
780860 913586921 Drosophila melanogaster
2211104 912500625 Arabidopsis thaliana
650374 905797007 Vitis vinifera
804246 871336795 Gallus gallus
77069 803847320 Macaca mulatta
1215319 748031972 Ciona intestinalis
1224224 744373069 Canis lupus familiaris
1725913 680988452 Glycine max
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
October 15 2008
NCBI-GenBank Flat File Release 168.0
Bacterial Sequences (Part 1)
25389 loci, 102437874 bases, from 25389 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 PROJECT Format
This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
PROJECT GenomeProject:18787
A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second
contains the actual project identifier ("18787").
PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:
http://www.ncbi.nlm.nih.gov/genomes/static/gprj_help.html#introduction
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 168.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
Andrea Gocke, Anjanette Johnston, Mark Landree, Richard McVeigh,
Ilene Mizrachi, DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,
Gert Roosen, Susan Schafer, Melissa Wright, and Linda Yankie
Data Management and Preparation
Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
Eugene Yaschenko, Sergey Zhdanov
Database Administration
Slava Khotomliansky, Igor Lozitskiy, Ben Slade, Constantin Vasilyev
User Support
Medha Bhagwat, Peter Cooper, Wayne Matten, Scott McGinnis, Monica Romiti,
Eric Sayers, Tao Tao, Majda Valjavec-Gratian, David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
