Release Notes For GenBank Release 169
GBREL.TXT Genetic Sequence Data Bank
December 15 2008
NCBI-GenBank Flat File Release 169.0
Distribution Release Notes
98868465 loci, 99116431942 bases, from 98868465 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 169.0
1.2 Cutoff Date
1.3 Important Changes in Release 169.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 169.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for GenBank's web-based submission tool (BankIt) :
http://www.ncbi.nlm.nih.gov/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 169.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:
ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/ (Japan)
ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/ (Korea)
ftp://bio-mirror.sg.apan.net/biomirrors/genbank/ (Singapore)
1.2 Cutoff Date
This full release, 169.0, incorporates data available to the collaborating
databases as of December 11, 2008 at approximately 1:30am EST. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 169.0
1.3.1 Organizational changes
As described in a post to the GenBank Newsgroup on December 11, 2008, the
number of sequence data files associated with this GenBank release has
increased by a larger-than-usual amount, due to changes in the way that data
are processed and stored at NCBI. Thus the per-division increases described
below reflect both the storage-related changes *and* actual database growth.
In addition, GenBank divisions which consist of a single data file now
include a number in their names:
gbtsa.seq -> gbtsa1.seq
gbuna.seq -> gbuna1.seq
The total number of sequence data files increased by 94 with this release:
- the BCT division is now composed of 34 files (+2)
- the CON division is now composed of 128 files (+25)
- the ENV division is now composed of 11 files (+1)
- the EST division is now composed of 822 files (+20)
- the GSS division is now composed of 319 files (+10)
- the HTC division is now composed of 13 files (+1)
- the HTG division is now composed of 134 files (+12)
- the INV division is now composed of 14 files (+1)
- the PAT division is now composed of 55 files (+8)
- the PLN division is now composed of 37 files (+5)
- the PRI division is now composed of 39 files (+3)
- the ROD division is now composed of 28 files (+2)
- the STS division is now composed of 20 files (+2)
- the VRL division is now composed of 11 files (+1)
- the VRT division is now composed of 17 files (+1)
In addition, the total number of index files increased by 3 with this release:
- the AUT index is now composed of 62 files (+3)
1.3.2 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.3 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
sixty-nine of the GSS flatfiles in Release 169.0. Consider gbgss251.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
December 15 2008
NCBI-GenBank Flat File Release 169.0
GSS Sequences (Part 1)
87209 loci, 64341123 bases, from 87209 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "251" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 PROJECT linetype to be replaced by DBLINK (April 2009)
The PROJECT linetype allows a sequence record to be linked to information
about the sequencing project that generated the data which ultimately
resulted in the record's submission to the International Nucleotide Sequence
Database ( INSD; see http://www.insdc.org ) .
This complete bacterial GenBank record illustrates the use of the PROJECT
line:
LOCUS CP000964 5641239 bp DNA circular BCT 24-SEP-2008
DEFINITION Klebsiella pneumoniae 342, complete genome.
ACCESSION CP000964
VERSION CP000964.1 GI:206564770
PROJECT GenomeProject:28471
When viewed on the web in NCBI's Entrez:Nucleotide, the record's project
identifier (28471) links to an entry in the Genome Project Database (GPDB) :
http://www.ncbi.nlm.nih.gov/sites/entrez?db=genomeprj&cmd=Retrieve&dopt=Overview&uid=28471
where information about the sequencing center, the bacterium, and other
GenBank records (eg, plasmids) associated with the sequencing project
can be found.
Since the introduction of PROJECT, the scope of the "Genome" Project
Database has expanded, to include projects that are not necessarily targetted
to the sequencing of a complete genome.
In addition, there can be other resources which underlie an INSD sequence
record, such as the Trace Assembly Archive at the NCBI:
http://www.ncbi.nlm.nih.gov/Traces/assembly/assmbrowser.cgi?cmd=show&f=tree&m=main&s=tree
Because of the expanded scope of the GPDB, and because we anticipate a need
to link to more resources than just the GPDB, the PROJECT linetype is going to
be replaced by a new linetype:
DBLINK
Modifications to linetypes can be disruptive, so the switch to DBLINK will occur
in several stages. As of October 2008, links to the NCBI Trace Assembly Archive are
displayed via a line of text in the COMMENT section of sequence records. Here is a
mock-up, based on CP000964, to illustrate that initial change:
LOCUS CP000964 5641239 bp DNA circular BCT 24-SEP-2008
DEFINITION Klebsiella pneumoniae 342, complete genome.
ACCESSION CP000964
VERSION CP000964.1 GI:206564770
PROJECT GenomeProject:28471
....
COMMENT Trace Assembly Archive:123456
The source for the DNA and/or cells is: Professor Eric W.
Triplett, Chair, Department of Microbiology and Cell Science,
Institute of Food and Agricultural Sciences, University of Florida,
P.O. Box 110700, Gainesville, FL 32611-0700, [email protected].
Note: Use of the Trace Assembly Archive is still in its early stages, so only
a few records are expected to have these links in the short term.
The new DBLINK linetype will then be introduced with GenBank Release 170.0 ,
on or near February 15, 2009 .
The Genome Project ID and the Trace Assembly Archive ID will be presented
via DBLINK, and the existing PROJECT line will continue to be displayed:
LOCUS CP000964 5641239 bp DNA circular BCT 24-SEP-2008
DEFINITION Klebsiella pneumoniae 342, complete genome.
ACCESSION CP000964
VERSION CP000964.1 GI:206564770
PROJECT GenomeProject:28471
DBLINK Project:28471
Trace Assembly Archive:123456
....
COMMENT The source for the DNA and/or cells is: Professor Eric W.
Triplett, Chair, Department of Microbiology and Cell Science,
Institute of Food and Agricultural Sciences, University of Florida,
P.O. Box 110700, Gainesville, FL 32611-0700, [email protected].
PROJECT and DBLINK will co-exist for one GenBank release, until Release 171.0
(April 15, 2009), at which point the PROJECT line will be removed. In its final
state, our mock-up for CP000964 becomes:
LOCUS CP000964 5641239 bp DNA circular BCT 24-SEP-2008
DEFINITION Klebsiella pneumoniae 342, complete genome.
ACCESSION CP000964
VERSION CP000964.1 GI:206564770
DBLINK Project:28471
Trace Assembly Archive:123456
....
COMMENT The source for the DNA and/or cells is: Professor Eric W.
Triplett, Chair, Department of Microbiology and Cell Science,
Institute of Food and Agricultural Sciences, University of Florida,
P.O. Box 110700, Gainesville, FL 32611-0700, [email protected].
In summary: The PROJECT linetype will be replaced by DBLINK as of GenBank
Release 171.0 in April 2009.
For those who process sequence data in NCBI's ASN.1 format: The
underlying representation for (Genome) Project IDs will remain unchanged.
There will be no changes to the ASN.1 User-object that is used to store them:
user {
type
str "GenomeProjectsDB" ,
data {
{
label
str "ProjectID" ,
data
int 28471 } ,
{
label
str "ParentID" ,
data
int 0 } } } ,
However, to support linkages to other resources, such as the Trace
Assembly Archive, a new "DBLink" User-object will be introduced:
user {
type
str "DBLink" ,
data {
{
label
str "Trace Assembly Archive" ,
data
ints { 123456 } } } }
As new types of linkages are established, they will be added to
the DBLink User-object, and displayed via the DBLINK linetype in
the GenBank flatfile format.
There is a possibility that the GenomeProjectsDB User-object
might someday be incorporated into the new DBLink User-object.
But at the moment, there are no firm plans to do so.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1775 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut7.idx - Index of the entries according to author name, part 7.
64. gbaut8.idx - Index of the entries according to author name, part 8.
65. gbaut9.idx - Index of the entries according to author name, part 9.
66. gbbct1.seq - Bacterial sequence entries, part 1.
67. gbbct10.seq - Bacterial sequence entries, part 10.
68. gbbct11.seq - Bacterial sequence entries, part 11.
69. gbbct12.seq - Bacterial sequence entries, part 12.
70. gbbct13.seq - Bacterial sequence entries, part 13.
71. gbbct14.seq - Bacterial sequence entries, part 14.
72. gbbct15.seq - Bacterial sequence entries, part 15.
73. gbbct16.seq - Bacterial sequence entries, part 16.
74. gbbct17.seq - Bacterial sequence entries, part 17.
75. gbbct18.seq - Bacterial sequence entries, part 18.
76. gbbct19.seq - Bacterial sequence entries, part 19.
77. gbbct2.seq - Bacterial sequence entries, part 2.
78. gbbct20.seq - Bacterial sequence entries, part 20.
79. gbbct21.seq - Bacterial sequence entries, part 21.
80. gbbct22.seq - Bacterial sequence entries, part 22.
81. gbbct23.seq - Bacterial sequence entries, part 23.
82. gbbct24.seq - Bacterial sequence entries, part 24.
83. gbbct25.seq - Bacterial sequence entries, part 25.
84. gbbct26.seq - Bacterial sequence entries, part 26.
85. gbbct27.seq - Bacterial sequence entries, part 27.
86. gbbct28.seq - Bacterial sequence entries, part 28.
87. gbbct29.seq - Bacterial sequence entries, part 29.
88. gbbct3.seq - Bacterial sequence entries, part 3.
89. gbbct30.seq - Bacterial sequence entries, part 30.
90. gbbct31.seq - Bacterial sequence entries, part 31.
91. gbbct32.seq - Bacterial sequence entries, part 32.
92. gbbct33.seq - Bacterial sequence entries, part 33.
93. gbbct34.seq - Bacterial sequence entries, part 34.
94. gbbct4.seq - Bacterial sequence entries, part 4.
95. gbbct5.seq - Bacterial sequence entries, part 5.
96. gbbct6.seq - Bacterial sequence entries, part 6.
97. gbbct7.seq - Bacterial sequence entries, part 7.
98. gbbct8.seq - Bacterial sequence entries, part 8.
99. gbbct9.seq - Bacterial sequence entries, part 9.
100. gbchg.txt - Accession numbers of entries updated since the previous release.
101. gbcon1.seq - Constructed sequence entries, part 1.
102. gbcon10.seq - Constructed sequence entries, part 10.
103. gbcon100.seq - Constructed sequence entries, part 100.
104. gbcon101.seq - Constructed sequence entries, part 101.
105. gbcon102.seq - Constructed sequence entries, part 102.
106. gbcon103.seq - Constructed sequence entries, part 103.
107. gbcon104.seq - Constructed sequence entries, part 104.
108. gbcon105.seq - Constructed sequence entries, part 105.
109. gbcon106.seq - Constructed sequence entries, part 106.
110. gbcon107.seq - Constructed sequence entries, part 107.
111. gbcon108.seq - Constructed sequence entries, part 108.
112. gbcon109.seq - Constructed sequence entries, part 109.
113. gbcon11.seq - Constructed sequence entries, part 11.
114. gbcon110.seq - Constructed sequence entries, part 110.
115. gbcon111.seq - Constructed sequence entries, part 111.
116. gbcon112.seq - Constructed sequence entries, part 112.
117. gbcon113.seq - Constructed sequence entries, part 113.
118. gbcon114.seq - Constructed sequence entries, part 114.
119. gbcon115.seq - Constructed sequence entries, part 115.
120. gbcon116.seq - Constructed sequence entries, part 116.
121. gbcon117.seq - Constructed sequence entries, part 117.
122. gbcon118.seq - Constructed sequence entries, part 118.
123. gbcon119.seq - Constructed sequence entries, part 119.
124. gbcon12.seq - Constructed sequence entries, part 12.
125. gbcon120.seq - Constructed sequence entries, part 120.
126. gbcon121.seq - Constructed sequence entries, part 121.
127. gbcon122.seq - Constructed sequence entries, part 122.
128. gbcon123.seq - Constructed sequence entries, part 123.
129. gbcon124.seq - Constructed sequence entries, part 124.
130. gbcon125.seq - Constructed sequence entries, part 125.
131. gbcon126.seq - Constructed sequence entries, part 126.
132. gbcon127.seq - Constructed sequence entries, part 127.
133. gbcon128.seq - Constructed sequence entries, part 128.
134. gbcon13.seq - Constructed sequence entries, part 13.
135. gbcon14.seq - Constructed sequence entries, part 14.
136. gbcon15.seq - Constructed sequence entries, part 15.
137. gbcon16.seq - Constructed sequence entries, part 16.
138. gbcon17.seq - Constructed sequence entries, part 17.
139. gbcon18.seq - Constructed sequence entries, part 18.
140. gbcon19.seq - Constructed sequence entries, part 19.
141. gbcon2.seq - Constructed sequence entries, part 2.
142. gbcon20.seq - Constructed sequence entries, part 20.
143. gbcon21.seq - Constructed sequence entries, part 21.
144. gbcon22.seq - Constructed sequence entries, part 22.
145. gbcon23.seq - Constructed sequence entries, part 23.
146. gbcon24.seq - Constructed sequence entries, part 24.
147. gbcon25.seq - Constructed sequence entries, part 25.
148. gbcon26.seq - Constructed sequence entries, part 26.
149. gbcon27.seq - Constructed sequence entries, part 27.
150. gbcon28.seq - Constructed sequence entries, part 28.
151. gbcon29.seq - Constructed sequence entries, part 29.
152. gbcon3.seq - Constructed sequence entries, part 3.
153. gbcon30.seq - Constructed sequence entries, part 30.
154. gbcon31.seq - Constructed sequence entries, part 31.
155. gbcon32.seq - Constructed sequence entries, part 32.
156. gbcon33.seq - Constructed sequence entries, part 33.
157. gbcon34.seq - Constructed sequence entries, part 34.
158. gbcon35.seq - Constructed sequence entries, part 35.
159. gbcon36.seq - Constructed sequence entries, part 36.
160. gbcon37.seq - Constructed sequence entries, part 37.
161. gbcon38.seq - Constructed sequence entries, part 38.
162. gbcon39.seq - Constructed sequence entries, part 39.
163. gbcon4.seq - Constructed sequence entries, part 4.
164. gbcon40.seq - Constructed sequence entries, part 40.
165. gbcon41.seq - Constructed sequence entries, part 41.
166. gbcon42.seq - Constructed sequence entries, part 42.
167. gbcon43.seq - Constructed sequence entries, part 43.
168. gbcon44.seq - Constructed sequence entries, part 44.
169. gbcon45.seq - Constructed sequence entries, part 45.
170. gbcon46.seq - Constructed sequence entries, part 46.
171. gbcon47.seq - Constructed sequence entries, part 47.
172. gbcon48.seq - Constructed sequence entries, part 48.
173. gbcon49.seq - Constructed sequence entries, part 49.
174. gbcon5.seq - Constructed sequence entries, part 5.
175. gbcon50.seq - Constructed sequence entries, part 50.
176. gbcon51.seq - Constructed sequence entries, part 51.
177. gbcon52.seq - Constructed sequence entries, part 52.
178. gbcon53.seq - Constructed sequence entries, part 53.
179. gbcon54.seq - Constructed sequence entries, part 54.
180. gbcon55.seq - Constructed sequence entries, part 55.
181. gbcon56.seq - Constructed sequence entries, part 56.
182. gbcon57.seq - Constructed sequence entries, part 57.
183. gbcon58.seq - Constructed sequence entries, part 58.
184. gbcon59.seq - Constructed sequence entries, part 59.
185. gbcon6.seq - Constructed sequence entries, part 6.
186. gbcon60.seq - Constructed sequence entries, part 60.
187. gbcon61.seq - Constructed sequence entries, part 61.
188. gbcon62.seq - Constructed sequence entries, part 62.
189. gbcon63.seq - Constructed sequence entries, part 63.
190. gbcon64.seq - Constructed sequence entries, part 64.
191. gbcon65.seq - Constructed sequence entries, part 65.
192. gbcon66.seq - Constructed sequence entries, part 66.
193. gbcon67.seq - Constructed sequence entries, part 67.
194. gbcon68.seq - Constructed sequence entries, part 68.
195. gbcon69.seq - Constructed sequence entries, part 69.
196. gbcon7.seq - Constructed sequence entries, part 7.
197. gbcon70.seq - Constructed sequence entries, part 70.
198. gbcon71.seq - Constructed sequence entries, part 71.
199. gbcon72.seq - Constructed sequence entries, part 72.
200. gbcon73.seq - Constructed sequence entries, part 73.
201. gbcon74.seq - Constructed sequence entries, part 74.
202. gbcon75.seq - Constructed sequence entries, part 75.
203. gbcon76.seq - Constructed sequence entries, part 76.
204. gbcon77.seq - Constructed sequence entries, part 77.
205. gbcon78.seq - Constructed sequence entries, part 78.
206. gbcon79.seq - Constructed sequence entries, part 79.
207. gbcon8.seq - Constructed sequence entries, part 8.
208. gbcon80.seq - Constructed sequence entries, part 80.
209. gbcon81.seq - Constructed sequence entries, part 81.
210. gbcon82.seq - Constructed sequence entries, part 82.
211. gbcon83.seq - Constructed sequence entries, part 83.
212. gbcon84.seq - Constructed sequence entries, part 84.
213. gbcon85.seq - Constructed sequence entries, part 85.
214. gbcon86.seq - Constructed sequence entries, part 86.
215. gbcon87.seq - Constructed sequence entries, part 87.
216. gbcon88.seq - Constructed sequence entries, part 88.
217. gbcon89.seq - Constructed sequence entries, part 89.
218. gbcon9.seq - Constructed sequence entries, part 9.
219. gbcon90.seq - Constructed sequence entries, part 90.
220. gbcon91.seq - Constructed sequence entries, part 91.
221. gbcon92.seq - Constructed sequence entries, part 92.
222. gbcon93.seq - Constructed sequence entries, part 93.
223. gbcon94.seq - Constructed sequence entries, part 94.
224. gbcon95.seq - Constructed sequence entries, part 95.
225. gbcon96.seq - Constructed sequence entries, part 96.
226. gbcon97.seq - Constructed sequence entries, part 97.
227. gbcon98.seq - Constructed sequence entries, part 98.
228. gbcon99.seq - Constructed sequence entries, part 99.
229. gbdel.txt - Accession numbers of entries deleted since the previous release.
230. gbenv1.seq - Environmental sampling sequence entries, part 1.
231. gbenv10.seq - Environmental sampling sequence entries, part 10.
232. gbenv11.seq - Environmental sampling sequence entries, part 11.
233. gbenv2.seq - Environmental sampling sequence entries, part 2.
234. gbenv3.seq - Environmental sampling sequence entries, part 3.
235. gbenv4.seq - Environmental sampling sequence entries, part 4.
236. gbenv5.seq - Environmental sampling sequence entries, part 5.
237. gbenv6.seq - Environmental sampling sequence entries, part 6.
238. gbenv7.seq - Environmental sampling sequence entries, part 7.
239. gbenv8.seq - Environmental sampling sequence entries, part 8.
240. gbenv9.seq - Environmental sampling sequence entries, part 9.
241. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
242. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
243. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
244. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
245. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
246. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
247. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
248. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
249. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
250. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
251. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
252. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
253. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
254. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
255. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
256. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
257. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
258. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
259. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
260. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
261. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
262. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
263. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
264. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
265. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
266. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
267. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
268. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
269. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
270. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
271. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
272. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
273. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
274. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
275. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
276. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
277. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
278. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
279. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
280. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
281. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
282. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
283. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
284. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
285. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
286. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
287. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
288. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
289. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
290. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
291. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
292. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
293. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
294. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
295. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
296. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
297. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
298. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
299. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
300. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
301. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
302. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
303. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
304. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
305. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
306. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
307. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
308. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
309. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
310. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
311. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
312. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
313. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
314. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
315. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
316. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
317. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
318. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
319. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
320. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
321. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
322. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
323. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
324. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
325. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
326. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
327. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
328. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
329. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
330. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
331. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
332. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
333. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
334. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
335. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
336. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
337. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
338. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
339. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
340. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
341. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
342. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
343. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
344. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
345. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
346. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
347. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
348. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
349. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
350. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
351. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
352. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
353. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
354. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
355. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
356. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
357. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
358. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
359. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
360. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
361. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
362. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
363. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
364. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
365. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
366. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
367. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
368. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
369. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
370. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
371. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
372. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
373. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
374. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
375. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
376. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
377. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
378. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
379. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
380. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
381. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
382. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
383. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
384. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
385. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
386. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
387. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
388. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
389. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
390. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
391. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
392. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
393. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
394. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
395. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
396. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
397. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
398. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
399. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
400. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
401. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
402. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
403. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
404. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
405. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
406. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
407. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
408. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
409. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
410. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
411. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
412. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
413. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
414. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
415. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
416. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
417. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
418. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
419. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
420. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
421. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
422. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
423. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
424. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
425. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
426. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
427. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
428. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
429. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
430. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
431. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
432. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
433. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
434. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
435. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
436. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
437. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
438. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
439. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
440. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
441. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
442. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
443. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
444. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
445. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
446. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
447. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
448. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
449. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
450. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
451. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
452. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
453. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
454. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
455. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
456. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
457. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
458. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
459. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
460. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
461. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
462. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
463. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
464. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
465. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
466. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
467. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
468. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
469. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
470. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
471. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
472. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
473. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
474. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
475. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
476. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
477. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
478. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
479. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
480. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
481. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
482. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
483. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
484. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
485. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
486. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
487. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
488. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
489. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
490. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
491. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
492. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
493. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
494. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
495. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
496. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
497. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
498. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
499. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
500. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
501. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
502. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
503. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
504. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
505. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
506. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
507. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
508. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
509. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
510. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
511. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
512. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
513. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
514. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
515. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
516. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
517. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
518. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
519. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
520. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
521. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
522. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
523. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
524. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
525. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
526. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
527. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
528. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
529. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
530. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
531. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
532. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
533. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
534. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
535. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
536. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
537. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
538. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
539. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
540. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
541. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
542. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
543. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
544. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
545. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
546. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
547. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
548. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
549. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
550. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
551. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
552. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
553. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
554. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
555. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
556. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
557. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
558. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
559. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
560. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
561. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
562. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
563. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
564. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
565. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
566. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
567. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
568. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
569. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
570. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
571. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
572. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
573. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
574. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
575. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
576. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
577. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
578. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
579. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
580. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
581. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
582. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
583. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
584. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
585. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
586. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
587. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
588. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
589. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
590. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
591. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
592. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
593. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
594. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
595. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
596. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
597. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
598. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
599. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
600. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
601. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
602. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
603. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
604. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
605. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
606. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
607. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
608. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
609. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
610. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
611. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
612. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
613. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
614. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
615. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
616. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
617. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
618. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
619. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
620. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
621. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
622. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
623. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
624. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
625. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
626. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
627. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
628. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
629. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
630. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
631. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
632. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
633. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
634. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
635. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
636. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
637. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
638. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
639. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
640. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
641. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
642. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
643. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
644. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
645. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
646. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
647. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
648. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
649. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
650. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
651. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
652. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
653. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
654. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
655. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
656. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
657. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
658. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
659. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
660. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
661. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
662. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
663. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
664. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
665. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
666. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
667. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
668. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
669. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
670. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
671. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
672. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
673. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
674. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
675. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
676. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
677. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
678. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
679. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
680. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
681. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
682. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
683. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
684. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
685. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
686. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
687. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
688. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
689. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
690. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
691. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
692. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
693. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
694. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
695. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
696. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
697. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
698. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
699. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
700. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
701. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
702. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
703. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
704. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
705. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
706. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
707. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
708. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
709. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
710. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
711. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
712. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
713. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
714. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
715. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
716. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
717. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
718. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
719. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
720. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
721. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
722. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
723. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
724. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
725. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
726. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
727. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
728. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
729. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
730. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
731. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
732. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
733. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
734. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
735. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
736. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
737. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
738. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
739. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
740. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
741. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
742. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
743. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
744. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
745. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
746. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
747. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
748. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
749. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
750. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
751. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
752. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
753. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
754. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
755. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
756. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
757. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
758. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
759. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
760. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
761. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
762. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
763. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
764. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
765. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
766. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
767. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
768. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
769. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
770. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
771. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
772. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
773. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
774. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
775. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
776. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
777. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
778. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
779. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
780. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
781. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
782. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
783. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
784. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
785. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
786. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
787. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
788. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
789. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
790. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
791. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
792. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
793. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
794. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
795. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
796. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
797. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
798. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
799. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
800. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
801. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
802. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
803. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
804. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
805. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
806. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
807. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
808. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
809. gbest610.seq - EST (expressed sequence tag) sequence entries, part 610.
810. gbest611.seq - EST (expressed sequence tag) sequence entries, part 611.
811. gbest612.seq - EST (expressed sequence tag) sequence entries, part 612.
812. gbest613.seq - EST (expressed sequence tag) sequence entries, part 613.
813. gbest614.seq - EST (expressed sequence tag) sequence entries, part 614.
814. gbest615.seq - EST (expressed sequence tag) sequence entries, part 615.
815. gbest616.seq - EST (expressed sequence tag) sequence entries, part 616.
816. gbest617.seq - EST (expressed sequence tag) sequence entries, part 617.
817. gbest618.seq - EST (expressed sequence tag) sequence entries, part 618.
818. gbest619.seq - EST (expressed sequence tag) sequence entries, part 619.
819. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
820. gbest620.seq - EST (expressed sequence tag) sequence entries, part 620.
821. gbest621.seq - EST (expressed sequence tag) sequence entries, part 621.
822. gbest622.seq - EST (expressed sequence tag) sequence entries, part 622.
823. gbest623.seq - EST (expressed sequence tag) sequence entries, part 623.
824. gbest624.seq - EST (expressed sequence tag) sequence entries, part 624.
825. gbest625.seq - EST (expressed sequence tag) sequence entries, part 625.
826. gbest626.seq - EST (expressed sequence tag) sequence entries, part 626.
827. gbest627.seq - EST (expressed sequence tag) sequence entries, part 627.
828. gbest628.seq - EST (expressed sequence tag) sequence entries, part 628.
829. gbest629.seq - EST (expressed sequence tag) sequence entries, part 629.
830. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
831. gbest630.seq - EST (expressed sequence tag) sequence entries, part 630.
832. gbest631.seq - EST (expressed sequence tag) sequence entries, part 631.
833. gbest632.seq - EST (expressed sequence tag) sequence entries, part 632.
834. gbest633.seq - EST (expressed sequence tag) sequence entries, part 633.
835. gbest634.seq - EST (expressed sequence tag) sequence entries, part 634.
836. gbest635.seq - EST (expressed sequence tag) sequence entries, part 635.
837. gbest636.seq - EST (expressed sequence tag) sequence entries, part 636.
838. gbest637.seq - EST (expressed sequence tag) sequence entries, part 637.
839. gbest638.seq - EST (expressed sequence tag) sequence entries, part 638.
840. gbest639.seq - EST (expressed sequence tag) sequence entries, part 639.
841. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
842. gbest640.seq - EST (expressed sequence tag) sequence entries, part 640.
843. gbest641.seq - EST (expressed sequence tag) sequence entries, part 641.
844. gbest642.seq - EST (expressed sequence tag) sequence entries, part 642.
845. gbest643.seq - EST (expressed sequence tag) sequence entries, part 643.
846. gbest644.seq - EST (expressed sequence tag) sequence entries, part 644.
847. gbest645.seq - EST (expressed sequence tag) sequence entries, part 645.
848. gbest646.seq - EST (expressed sequence tag) sequence entries, part 646.
849. gbest647.seq - EST (expressed sequence tag) sequence entries, part 647.
850. gbest648.seq - EST (expressed sequence tag) sequence entries, part 648.
851. gbest649.seq - EST (expressed sequence tag) sequence entries, part 649.
852. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
853. gbest650.seq - EST (expressed sequence tag) sequence entries, part 650.
854. gbest651.seq - EST (expressed sequence tag) sequence entries, part 651.
855. gbest652.seq - EST (expressed sequence tag) sequence entries, part 652.
856. gbest653.seq - EST (expressed sequence tag) sequence entries, part 653.
857. gbest654.seq - EST (expressed sequence tag) sequence entries, part 654.
858. gbest655.seq - EST (expressed sequence tag) sequence entries, part 655.
859. gbest656.seq - EST (expressed sequence tag) sequence entries, part 656.
860. gbest657.seq - EST (expressed sequence tag) sequence entries, part 657.
861. gbest658.seq - EST (expressed sequence tag) sequence entries, part 658.
862. gbest659.seq - EST (expressed sequence tag) sequence entries, part 659.
863. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
864. gbest660.seq - EST (expressed sequence tag) sequence entries, part 660.
865. gbest661.seq - EST (expressed sequence tag) sequence entries, part 661.
866. gbest662.seq - EST (expressed sequence tag) sequence entries, part 662.
867. gbest663.seq - EST (expressed sequence tag) sequence entries, part 663.
868. gbest664.seq - EST (expressed sequence tag) sequence entries, part 664.
869. gbest665.seq - EST (expressed sequence tag) sequence entries, part 665.
870. gbest666.seq - EST (expressed sequence tag) sequence entries, part 666.
871. gbest667.seq - EST (expressed sequence tag) sequence entries, part 667.
872. gbest668.seq - EST (expressed sequence tag) sequence entries, part 668.
873. gbest669.seq - EST (expressed sequence tag) sequence entries, part 669.
874. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
875. gbest670.seq - EST (expressed sequence tag) sequence entries, part 670.
876. gbest671.seq - EST (expressed sequence tag) sequence entries, part 671.
877. gbest672.seq - EST (expressed sequence tag) sequence entries, part 672.
878. gbest673.seq - EST (expressed sequence tag) sequence entries, part 673.
879. gbest674.seq - EST (expressed sequence tag) sequence entries, part 674.
880. gbest675.seq - EST (expressed sequence tag) sequence entries, part 675.
881. gbest676.seq - EST (expressed sequence tag) sequence entries, part 676.
882. gbest677.seq - EST (expressed sequence tag) sequence entries, part 677.
883. gbest678.seq - EST (expressed sequence tag) sequence entries, part 678.
884. gbest679.seq - EST (expressed sequence tag) sequence entries, part 679.
885. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
886. gbest680.seq - EST (expressed sequence tag) sequence entries, part 680.
887. gbest681.seq - EST (expressed sequence tag) sequence entries, part 681.
888. gbest682.seq - EST (expressed sequence tag) sequence entries, part 682.
889. gbest683.seq - EST (expressed sequence tag) sequence entries, part 683.
890. gbest684.seq - EST (expressed sequence tag) sequence entries, part 684.
891. gbest685.seq - EST (expressed sequence tag) sequence entries, part 685.
892. gbest686.seq - EST (expressed sequence tag) sequence entries, part 686.
893. gbest687.seq - EST (expressed sequence tag) sequence entries, part 687.
894. gbest688.seq - EST (expressed sequence tag) sequence entries, part 688.
895. gbest689.seq - EST (expressed sequence tag) sequence entries, part 689.
896. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
897. gbest690.seq - EST (expressed sequence tag) sequence entries, part 690.
898. gbest691.seq - EST (expressed sequence tag) sequence entries, part 691.
899. gbest692.seq - EST (expressed sequence tag) sequence entries, part 692.
900. gbest693.seq - EST (expressed sequence tag) sequence entries, part 693.
901. gbest694.seq - EST (expressed sequence tag) sequence entries, part 694.
902. gbest695.seq - EST (expressed sequence tag) sequence entries, part 695.
903. gbest696.seq - EST (expressed sequence tag) sequence entries, part 696.
904. gbest697.seq - EST (expressed sequence tag) sequence entries, part 697.
905. gbest698.seq - EST (expressed sequence tag) sequence entries, part 698.
906. gbest699.seq - EST (expressed sequence tag) sequence entries, part 699.
907. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
908. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
909. gbest700.seq - EST (expressed sequence tag) sequence entries, part 700.
910. gbest701.seq - EST (expressed sequence tag) sequence entries, part 701.
911. gbest702.seq - EST (expressed sequence tag) sequence entries, part 702.
912. gbest703.seq - EST (expressed sequence tag) sequence entries, part 703.
913. gbest704.seq - EST (expressed sequence tag) sequence entries, part 704.
914. gbest705.seq - EST (expressed sequence tag) sequence entries, part 705.
915. gbest706.seq - EST (expressed sequence tag) sequence entries, part 706.
916. gbest707.seq - EST (expressed sequence tag) sequence entries, part 707.
917. gbest708.seq - EST (expressed sequence tag) sequence entries, part 708.
918. gbest709.seq - EST (expressed sequence tag) sequence entries, part 709.
919. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
920. gbest710.seq - EST (expressed sequence tag) sequence entries, part 710.
921. gbest711.seq - EST (expressed sequence tag) sequence entries, part 711.
922. gbest712.seq - EST (expressed sequence tag) sequence entries, part 712.
923. gbest713.seq - EST (expressed sequence tag) sequence entries, part 713.
924. gbest714.seq - EST (expressed sequence tag) sequence entries, part 714.
925. gbest715.seq - EST (expressed sequence tag) sequence entries, part 715.
926. gbest716.seq - EST (expressed sequence tag) sequence entries, part 716.
927. gbest717.seq - EST (expressed sequence tag) sequence entries, part 717.
928. gbest718.seq - EST (expressed sequence tag) sequence entries, part 718.
929. gbest719.seq - EST (expressed sequence tag) sequence entries, part 719.
930. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
931. gbest720.seq - EST (expressed sequence tag) sequence entries, part 720.
932. gbest721.seq - EST (expressed sequence tag) sequence entries, part 721.
933. gbest722.seq - EST (expressed sequence tag) sequence entries, part 722.
934. gbest723.seq - EST (expressed sequence tag) sequence entries, part 723.
935. gbest724.seq - EST (expressed sequence tag) sequence entries, part 724.
936. gbest725.seq - EST (expressed sequence tag) sequence entries, part 725.
937. gbest726.seq - EST (expressed sequence tag) sequence entries, part 726.
938. gbest727.seq - EST (expressed sequence tag) sequence entries, part 727.
939. gbest728.seq - EST (expressed sequence tag) sequence entries, part 728.
940. gbest729.seq - EST (expressed sequence tag) sequence entries, part 729.
941. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
942. gbest730.seq - EST (expressed sequence tag) sequence entries, part 730.
943. gbest731.seq - EST (expressed sequence tag) sequence entries, part 731.
944. gbest732.seq - EST (expressed sequence tag) sequence entries, part 732.
945. gbest733.seq - EST (expressed sequence tag) sequence entries, part 733.
946. gbest734.seq - EST (expressed sequence tag) sequence entries, part 734.
947. gbest735.seq - EST (expressed sequence tag) sequence entries, part 735.
948. gbest736.seq - EST (expressed sequence tag) sequence entries, part 736.
949. gbest737.seq - EST (expressed sequence tag) sequence entries, part 737.
950. gbest738.seq - EST (expressed sequence tag) sequence entries, part 738.
951. gbest739.seq - EST (expressed sequence tag) sequence entries, part 739.
952. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
953. gbest740.seq - EST (expressed sequence tag) sequence entries, part 740.
954. gbest741.seq - EST (expressed sequence tag) sequence entries, part 741.
955. gbest742.seq - EST (expressed sequence tag) sequence entries, part 742.
956. gbest743.seq - EST (expressed sequence tag) sequence entries, part 743.
957. gbest744.seq - EST (expressed sequence tag) sequence entries, part 744.
958. gbest745.seq - EST (expressed sequence tag) sequence entries, part 745.
959. gbest746.seq - EST (expressed sequence tag) sequence entries, part 746.
960. gbest747.seq - EST (expressed sequence tag) sequence entries, part 747.
961. gbest748.seq - EST (expressed sequence tag) sequence entries, part 748.
962. gbest749.seq - EST (expressed sequence tag) sequence entries, part 749.
963. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
964. gbest750.seq - EST (expressed sequence tag) sequence entries, part 750.
965. gbest751.seq - EST (expressed sequence tag) sequence entries, part 751.
966. gbest752.seq - EST (expressed sequence tag) sequence entries, part 752.
967. gbest753.seq - EST (expressed sequence tag) sequence entries, part 753.
968. gbest754.seq - EST (expressed sequence tag) sequence entries, part 754.
969. gbest755.seq - EST (expressed sequence tag) sequence entries, part 755.
970. gbest756.seq - EST (expressed sequence tag) sequence entries, part 756.
971. gbest757.seq - EST (expressed sequence tag) sequence entries, part 757.
972. gbest758.seq - EST (expressed sequence tag) sequence entries, part 758.
973. gbest759.seq - EST (expressed sequence tag) sequence entries, part 759.
974. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
975. gbest760.seq - EST (expressed sequence tag) sequence entries, part 760.
976. gbest761.seq - EST (expressed sequence tag) sequence entries, part 761.
977. gbest762.seq - EST (expressed sequence tag) sequence entries, part 762.
978. gbest763.seq - EST (expressed sequence tag) sequence entries, part 763.
979. gbest764.seq - EST (expressed sequence tag) sequence entries, part 764.
980. gbest765.seq - EST (expressed sequence tag) sequence entries, part 765.
981. gbest766.seq - EST (expressed sequence tag) sequence entries, part 766.
982. gbest767.seq - EST (expressed sequence tag) sequence entries, part 767.
983. gbest768.seq - EST (expressed sequence tag) sequence entries, part 768.
984. gbest769.seq - EST (expressed sequence tag) sequence entries, part 769.
985. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
986. gbest770.seq - EST (expressed sequence tag) sequence entries, part 770.
987. gbest771.seq - EST (expressed sequence tag) sequence entries, part 771.
988. gbest772.seq - EST (expressed sequence tag) sequence entries, part 772.
989. gbest773.seq - EST (expressed sequence tag) sequence entries, part 773.
990. gbest774.seq - EST (expressed sequence tag) sequence entries, part 774.
991. gbest775.seq - EST (expressed sequence tag) sequence entries, part 775.
992. gbest776.seq - EST (expressed sequence tag) sequence entries, part 776.
993. gbest777.seq - EST (expressed sequence tag) sequence entries, part 777.
994. gbest778.seq - EST (expressed sequence tag) sequence entries, part 778.
995. gbest779.seq - EST (expressed sequence tag) sequence entries, part 779.
996. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
997. gbest780.seq - EST (expressed sequence tag) sequence entries, part 780.
998. gbest781.seq - EST (expressed sequence tag) sequence entries, part 781.
999. gbest782.seq - EST (expressed sequence tag) sequence entries, part 782.
1000. gbest783.seq - EST (expressed sequence tag) sequence entries, part 783.
1001. gbest784.seq - EST (expressed sequence tag) sequence entries, part 784.
1002. gbest785.seq - EST (expressed sequence tag) sequence entries, part 785.
1003. gbest786.seq - EST (expressed sequence tag) sequence entries, part 786.
1004. gbest787.seq - EST (expressed sequence tag) sequence entries, part 787.
1005. gbest788.seq - EST (expressed sequence tag) sequence entries, part 788.
1006. gbest789.seq - EST (expressed sequence tag) sequence entries, part 789.
1007. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1008. gbest790.seq - EST (expressed sequence tag) sequence entries, part 790.
1009. gbest791.seq - EST (expressed sequence tag) sequence entries, part 791.
1010. gbest792.seq - EST (expressed sequence tag) sequence entries, part 792.
1011. gbest793.seq - EST (expressed sequence tag) sequence entries, part 793.
1012. gbest794.seq - EST (expressed sequence tag) sequence entries, part 794.
1013. gbest795.seq - EST (expressed sequence tag) sequence entries, part 795.
1014. gbest796.seq - EST (expressed sequence tag) sequence entries, part 796.
1015. gbest797.seq - EST (expressed sequence tag) sequence entries, part 797.
1016. gbest798.seq - EST (expressed sequence tag) sequence entries, part 798.
1017. gbest799.seq - EST (expressed sequence tag) sequence entries, part 799.
1018. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1019. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1020. gbest800.seq - EST (expressed sequence tag) sequence entries, part 800.
1021. gbest801.seq - EST (expressed sequence tag) sequence entries, part 801.
1022. gbest802.seq - EST (expressed sequence tag) sequence entries, part 802.
1023. gbest803.seq - EST (expressed sequence tag) sequence entries, part 803.
1024. gbest804.seq - EST (expressed sequence tag) sequence entries, part 804.
1025. gbest805.seq - EST (expressed sequence tag) sequence entries, part 805.
1026. gbest806.seq - EST (expressed sequence tag) sequence entries, part 806.
1027. gbest807.seq - EST (expressed sequence tag) sequence entries, part 807.
1028. gbest808.seq - EST (expressed sequence tag) sequence entries, part 808.
1029. gbest809.seq - EST (expressed sequence tag) sequence entries, part 809.
1030. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1031. gbest810.seq - EST (expressed sequence tag) sequence entries, part 810.
1032. gbest811.seq - EST (expressed sequence tag) sequence entries, part 811.
1033. gbest812.seq - EST (expressed sequence tag) sequence entries, part 812.
1034. gbest813.seq - EST (expressed sequence tag) sequence entries, part 813.
1035. gbest814.seq - EST (expressed sequence tag) sequence entries, part 814.
1036. gbest815.seq - EST (expressed sequence tag) sequence entries, part 815.
1037. gbest816.seq - EST (expressed sequence tag) sequence entries, part 816.
1038. gbest817.seq - EST (expressed sequence tag) sequence entries, part 817.
1039. gbest818.seq - EST (expressed sequence tag) sequence entries, part 818.
1040. gbest819.seq - EST (expressed sequence tag) sequence entries, part 819.
1041. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1042. gbest820.seq - EST (expressed sequence tag) sequence entries, part 820.
1043. gbest821.seq - EST (expressed sequence tag) sequence entries, part 821.
1044. gbest822.seq - EST (expressed sequence tag) sequence entries, part 822.
1045. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1046. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1047. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1048. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1049. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1050. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1051. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1052. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1053. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1054. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1055. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1056. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1057. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1058. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1059. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1060. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1061. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1062. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1063. gbgen.idx - Index of the entries according to gene symbols.
1064. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1065. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1066. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1067. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1068. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1069. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1070. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1071. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1072. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1073. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1074. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1075. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1076. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1077. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1078. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1079. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1080. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1081. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1082. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1083. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1084. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1085. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1086. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1087. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1088. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1089. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1090. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1091. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1092. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1093. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1094. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1095. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1096. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1097. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1098. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1099. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1100. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1101. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1102. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1103. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1104. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1105. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1106. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1107. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1108. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1109. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1110. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1111. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1112. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1113. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1114. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1115. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1116. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1117. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1118. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1119. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1120. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1121. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1122. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1123. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1124. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1125. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1126. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1127. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1128. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1129. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1130. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1131. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1132. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1133. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1134. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1135. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1136. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1137. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1138. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1139. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1140. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1141. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1142. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1143. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1144. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1145. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1146. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1147. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1148. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1149. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1150. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1151. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1152. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1153. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1154. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1155. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1156. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1157. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1158. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1159. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1160. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1161. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1162. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1163. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1164. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1165. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1166. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1167. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1168. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1169. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1170. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1171. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1172. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1173. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1174. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1175. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1176. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1177. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1178. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1179. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1180. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1181. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1182. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1183. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1184. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1185. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1186. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1187. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1188. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1189. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1190. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1191. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1192. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1193. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1194. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1195. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1196. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1197. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1198. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1199. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1200. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1201. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1202. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1203. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1204. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1205. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1206. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1207. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1208. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1209. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1210. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1211. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1212. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1213. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1214. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1215. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1216. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1217. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1218. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1219. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1220. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1221. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1222. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1223. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1224. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1225. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1226. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1227. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1228. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1229. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1230. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1231. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1232. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1233. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1234. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1235. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1236. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1237. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1238. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1239. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1240. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1241. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1242. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1243. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1244. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1245. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1246. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1247. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1248. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1249. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1250. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1251. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1252. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1253. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1254. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1255. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1256. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1257. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1258. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1259. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1260. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1261. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1262. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1263. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1264. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1265. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1266. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1267. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1268. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1269. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1270. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1271. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1272. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1273. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1274. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1275. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1276. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1277. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1278. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1279. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1280. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1281. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1282. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1283. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1284. gbgss298.seq - GSS (genome survey sequence) sequence entries, part 298.
1285. gbgss299.seq - GSS (genome survey sequence) sequence entries, part 299.
1286. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1287. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1288. gbgss300.seq - GSS (genome survey sequence) sequence entries, part 300.
1289. gbgss301.seq - GSS (genome survey sequence) sequence entries, part 301.
1290. gbgss302.seq - GSS (genome survey sequence) sequence entries, part 302.
1291. gbgss303.seq - GSS (genome survey sequence) sequence entries, part 303.
1292. gbgss304.seq - GSS (genome survey sequence) sequence entries, part 304.
1293. gbgss305.seq - GSS (genome survey sequence) sequence entries, part 305.
1294. gbgss306.seq - GSS (genome survey sequence) sequence entries, part 306.
1295. gbgss307.seq - GSS (genome survey sequence) sequence entries, part 307.
1296. gbgss308.seq - GSS (genome survey sequence) sequence entries, part 308.
1297. gbgss309.seq - GSS (genome survey sequence) sequence entries, part 309.
1298. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1299. gbgss310.seq - GSS (genome survey sequence) sequence entries, part 310.
1300. gbgss311.seq - GSS (genome survey sequence) sequence entries, part 311.
1301. gbgss312.seq - GSS (genome survey sequence) sequence entries, part 312.
1302. gbgss313.seq - GSS (genome survey sequence) sequence entries, part 313.
1303. gbgss314.seq - GSS (genome survey sequence) sequence entries, part 314.
1304. gbgss315.seq - GSS (genome survey sequence) sequence entries, part 315.
1305. gbgss316.seq - GSS (genome survey sequence) sequence entries, part 316.
1306. gbgss317.seq - GSS (genome survey sequence) sequence entries, part 317.
1307. gbgss318.seq - GSS (genome survey sequence) sequence entries, part 318.
1308. gbgss319.seq - GSS (genome survey sequence) sequence entries, part 319.
1309. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1310. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1311. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1312. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1313. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1314. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1315. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1316. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1317. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1318. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1319. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1320. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1321. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1322. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1323. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1324. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1325. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1326. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1327. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1328. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1329. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1330. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1331. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1332. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1333. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1334. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1335. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1336. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1337. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1338. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1339. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1340. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1341. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1342. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1343. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1344. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1345. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1346. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1347. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1348. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1349. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1350. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1351. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1352. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1353. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1354. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1355. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1356. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1357. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1358. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1359. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1360. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1361. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1362. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1363. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1364. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1365. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1366. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1367. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1368. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1369. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1370. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1371. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1372. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1373. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1374. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1375. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1376. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1377. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1378. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1379. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1380. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1381. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1382. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1383. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1384. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1385. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1386. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1387. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1388. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1389. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1390. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1391. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1392. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1393. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1394. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1395. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1396. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1397. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1398. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1399. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1400. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1401. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1402. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1403. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1404. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1405. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1406. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1407. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1408. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1409. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1410. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1411. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1412. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1413. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1414. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1415. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1416. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1417. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1418. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1419. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1420. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1421. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1422. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1423. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1424. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1425. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1426. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1427. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1428. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1429. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1430. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1431. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1432. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1433. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1434. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1435. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1436. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1437. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1438. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1439. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1440. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1441. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1442. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1443. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1444. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1445. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1446. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1447. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1448. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1449. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1450. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1451. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1452. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1453. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1454. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1455. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1456. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1457. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1458. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1459. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1460. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1461. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1462. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1463. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1464. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1465. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1466. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1467. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1468. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1469. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1470. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1471. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1472. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1473. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1474. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1475. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1476. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1477. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1478. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1479. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1480. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1481. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1482. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1483. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1484. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1485. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1486. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1487. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1488. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1489. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1490. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1491. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1492. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1493. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1494. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1495. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1496. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1497. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1498. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1499. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1500. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1501. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1502. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1503. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1504. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1505. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1506. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1507. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1508. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1509. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1510. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1511. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1512. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1513. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1514. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1515. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1516. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1517. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1518. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1519. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1520. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1521. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1522. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1523. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1524. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1525. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1526. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1527. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1528. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1529. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1530. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1531. gbinv1.seq - Invertebrate sequence entries, part 1.
1532. gbinv10.seq - Invertebrate sequence entries, part 10.
1533. gbinv11.seq - Invertebrate sequence entries, part 11.
1534. gbinv12.seq - Invertebrate sequence entries, part 12.
1535. gbinv13.seq - Invertebrate sequence entries, part 13.
1536. gbinv14.seq - Invertebrate sequence entries, part 14.
1537. gbinv2.seq - Invertebrate sequence entries, part 2.
1538. gbinv3.seq - Invertebrate sequence entries, part 3.
1539. gbinv4.seq - Invertebrate sequence entries, part 4.
1540. gbinv5.seq - Invertebrate sequence entries, part 5.
1541. gbinv6.seq - Invertebrate sequence entries, part 6.
1542. gbinv7.seq - Invertebrate sequence entries, part 7.
1543. gbinv8.seq - Invertebrate sequence entries, part 8.
1544. gbinv9.seq - Invertebrate sequence entries, part 9.
1545. gbjou1.idx - Index of the entries according to journal citation, part 1.
1546. gbjou2.idx - Index of the entries according to journal citation, part 2.
1547. gbjou3.idx - Index of the entries according to journal citation, part 3.
1548. gbjou4.idx - Index of the entries according to journal citation, part 4.
1549. gbjou5.idx - Index of the entries according to journal citation, part 5.
1550. gbjou6.idx - Index of the entries according to journal citation, part 6.
1551. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1552. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1553. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1554. gbmam1.seq - Other mammalian sequence entries, part 1.
1555. gbmam2.seq - Other mammalian sequence entries, part 2.
1556. gbmam3.seq - Other mammalian sequence entries, part 3.
1557. gbmam4.seq - Other mammalian sequence entries, part 4.
1558. gbnew.txt - Accession numbers of entries new since the previous release.
1559. gbpat1.seq - Patent sequence entries, part 1.
1560. gbpat10.seq - Patent sequence entries, part 10.
1561. gbpat11.seq - Patent sequence entries, part 11.
1562. gbpat12.seq - Patent sequence entries, part 12.
1563. gbpat13.seq - Patent sequence entries, part 13.
1564. gbpat14.seq - Patent sequence entries, part 14.
1565. gbpat15.seq - Patent sequence entries, part 15.
1566. gbpat16.seq - Patent sequence entries, part 16.
1567. gbpat17.seq - Patent sequence entries, part 17.
1568. gbpat18.seq - Patent sequence entries, part 18.
1569. gbpat19.seq - Patent sequence entries, part 19.
1570. gbpat2.seq - Patent sequence entries, part 2.
1571. gbpat20.seq - Patent sequence entries, part 20.
1572. gbpat21.seq - Patent sequence entries, part 21.
1573. gbpat22.seq - Patent sequence entries, part 22.
1574. gbpat23.seq - Patent sequence entries, part 23.
1575. gbpat24.seq - Patent sequence entries, part 24.
1576. gbpat25.seq - Patent sequence entries, part 25.
1577. gbpat26.seq - Patent sequence entries, part 26.
1578. gbpat27.seq - Patent sequence entries, part 27.
1579. gbpat28.seq - Patent sequence entries, part 28.
1580. gbpat29.seq - Patent sequence entries, part 29.
1581. gbpat3.seq - Patent sequence entries, part 3.
1582. gbpat30.seq - Patent sequence entries, part 30.
1583. gbpat31.seq - Patent sequence entries, part 31.
1584. gbpat32.seq - Patent sequence entries, part 32.
1585. gbpat33.seq - Patent sequence entries, part 33.
1586. gbpat34.seq - Patent sequence entries, part 34.
1587. gbpat35.seq - Patent sequence entries, part 35.
1588. gbpat36.seq - Patent sequence entries, part 36.
1589. gbpat37.seq - Patent sequence entries, part 37.
1590. gbpat38.seq - Patent sequence entries, part 38.
1591. gbpat39.seq - Patent sequence entries, part 39.
1592. gbpat4.seq - Patent sequence entries, part 4.
1593. gbpat40.seq - Patent sequence entries, part 40.
1594. gbpat41.seq - Patent sequence entries, part 41.
1595. gbpat42.seq - Patent sequence entries, part 42.
1596. gbpat43.seq - Patent sequence entries, part 43.
1597. gbpat44.seq - Patent sequence entries, part 44.
1598. gbpat45.seq - Patent sequence entries, part 45.
1599. gbpat46.seq - Patent sequence entries, part 46.
1600. gbpat47.seq - Patent sequence entries, part 47.
1601. gbpat48.seq - Patent sequence entries, part 48.
1602. gbpat49.seq - Patent sequence entries, part 49.
1603. gbpat5.seq - Patent sequence entries, part 5.
1604. gbpat50.seq - Patent sequence entries, part 50.
1605. gbpat51.seq - Patent sequence entries, part 51.
1606. gbpat52.seq - Patent sequence entries, part 52.
1607. gbpat53.seq - Patent sequence entries, part 53.
1608. gbpat54.seq - Patent sequence entries, part 54.
1609. gbpat55.seq - Patent sequence entries, part 55.
1610. gbpat6.seq - Patent sequence entries, part 6.
1611. gbpat7.seq - Patent sequence entries, part 7.
1612. gbpat8.seq - Patent sequence entries, part 8.
1613. gbpat9.seq - Patent sequence entries, part 9.
1614. gbphg1.seq - Phage sequence entries, part 1.
1615. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1616. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1617. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1618. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1619. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1620. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1621. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1622. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1623. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1624. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1625. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1626. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1627. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1628. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1629. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1630. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1631. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1632. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1633. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1634. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1635. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1636. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1637. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1638. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1639. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1640. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1641. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1642. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1643. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1644. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1645. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1646. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1647. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1648. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1649. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1650. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1651. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1652. gbpri1.seq - Primate sequence entries, part 1.
1653. gbpri10.seq - Primate sequence entries, part 10.
1654. gbpri11.seq - Primate sequence entries, part 11.
1655. gbpri12.seq - Primate sequence entries, part 12.
1656. gbpri13.seq - Primate sequence entries, part 13.
1657. gbpri14.seq - Primate sequence entries, part 14.
1658. gbpri15.seq - Primate sequence entries, part 15.
1659. gbpri16.seq - Primate sequence entries, part 16.
1660. gbpri17.seq - Primate sequence entries, part 17.
1661. gbpri18.seq - Primate sequence entries, part 18.
1662. gbpri19.seq - Primate sequence entries, part 19.
1663. gbpri2.seq - Primate sequence entries, part 2.
1664. gbpri20.seq - Primate sequence entries, part 20.
1665. gbpri21.seq - Primate sequence entries, part 21.
1666. gbpri22.seq - Primate sequence entries, part 22.
1667. gbpri23.seq - Primate sequence entries, part 23.
1668. gbpri24.seq - Primate sequence entries, part 24.
1669. gbpri25.seq - Primate sequence entries, part 25.
1670. gbpri26.seq - Primate sequence entries, part 26.
1671. gbpri27.seq - Primate sequence entries, part 27.
1672. gbpri28.seq - Primate sequence entries, part 28.
1673. gbpri29.seq - Primate sequence entries, part 29.
1674. gbpri3.seq - Primate sequence entries, part 3.
1675. gbpri30.seq - Primate sequence entries, part 30.
1676. gbpri31.seq - Primate sequence entries, part 31.
1677. gbpri32.seq - Primate sequence entries, part 32.
1678. gbpri33.seq - Primate sequence entries, part 33.
1679. gbpri34.seq - Primate sequence entries, part 34.
1680. gbpri35.seq - Primate sequence entries, part 35.
1681. gbpri36.seq - Primate sequence entries, part 36.
1682. gbpri37.seq - Primate sequence entries, part 37.
1683. gbpri38.seq - Primate sequence entries, part 38.
1684. gbpri39.seq - Primate sequence entries, part 39.
1685. gbpri4.seq - Primate sequence entries, part 4.
1686. gbpri5.seq - Primate sequence entries, part 5.
1687. gbpri6.seq - Primate sequence entries, part 6.
1688. gbpri7.seq - Primate sequence entries, part 7.
1689. gbpri8.seq - Primate sequence entries, part 8.
1690. gbpri9.seq - Primate sequence entries, part 9.
1691. gbrel.txt - Release notes (this document).
1692. gbrod1.seq - Rodent sequence entries, part 1.
1693. gbrod10.seq - Rodent sequence entries, part 10.
1694. gbrod11.seq - Rodent sequence entries, part 11.
1695. gbrod12.seq - Rodent sequence entries, part 12.
1696. gbrod13.seq - Rodent sequence entries, part 13.
1697. gbrod14.seq - Rodent sequence entries, part 14.
1698. gbrod15.seq - Rodent sequence entries, part 15.
1699. gbrod16.seq - Rodent sequence entries, part 16.
1700. gbrod17.seq - Rodent sequence entries, part 17.
1701. gbrod18.seq - Rodent sequence entries, part 18.
1702. gbrod19.seq - Rodent sequence entries, part 19.
1703. gbrod2.seq - Rodent sequence entries, part 2.
1704. gbrod20.seq - Rodent sequence entries, part 20.
1705. gbrod21.seq - Rodent sequence entries, part 21.
1706. gbrod22.seq - Rodent sequence entries, part 22.
1707. gbrod23.seq - Rodent sequence entries, part 23.
1708. gbrod24.seq - Rodent sequence entries, part 24.
1709. gbrod25.seq - Rodent sequence entries, part 25.
1710. gbrod26.seq - Rodent sequence entries, part 26.
1711. gbrod27.seq - Rodent sequence entries, part 27.
1712. gbrod28.seq - Rodent sequence entries, part 28.
1713. gbrod3.seq - Rodent sequence entries, part 3.
1714. gbrod4.seq - Rodent sequence entries, part 4.
1715. gbrod5.seq - Rodent sequence entries, part 5.
1716. gbrod6.seq - Rodent sequence entries, part 6.
1717. gbrod7.seq - Rodent sequence entries, part 7.
1718. gbrod8.seq - Rodent sequence entries, part 8.
1719. gbrod9.seq - Rodent sequence entries, part 9.
1720. gbsdr1.txt - Short directory of the data bank, part 1.
1721. gbsdr2.txt - Short directory of the data bank, part 2.
1722. gbsdr3.txt - Short directory of the data bank, part 3.
1723. gbsec.idx - Index of the entries according to secondary accession number.
1724. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1725. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1726. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1727. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1728. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1729. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1730. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1731. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1732. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1733. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1734. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1735. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1736. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1737. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1738. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1739. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1740. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1741. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1742. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1743. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1744. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1745. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1746. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1747. gbuna1.seq - Unannotated sequence entries, part 1.
1748. gbvrl1.seq - Viral sequence entries, part 1.
1749. gbvrl10.seq - Viral sequence entries, part 10.
1750. gbvrl11.seq - Viral sequence entries, part 11.
1751. gbvrl2.seq - Viral sequence entries, part 2.
1752. gbvrl3.seq - Viral sequence entries, part 3.
1753. gbvrl4.seq - Viral sequence entries, part 4.
1754. gbvrl5.seq - Viral sequence entries, part 5.
1755. gbvrl6.seq - Viral sequence entries, part 6.
1756. gbvrl7.seq - Viral sequence entries, part 7.
1757. gbvrl8.seq - Viral sequence entries, part 8.
1758. gbvrl9.seq - Viral sequence entries, part 9.
1759. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1760. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1761. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1762. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1763. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1764. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1765. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1766. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1767. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1768. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1769. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1770. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1771. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1772. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1773. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1774. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1775. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 169.0 flatfiles require roughly 381 GB (sequence
files only) or 407 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
887138951 gbacc1.idx
1946796333 gbacc2.idx
634808829 gbacc3.idx
185535046 gbaut1.idx
250865014 gbaut10.idx
228760182 gbaut11.idx
183883412 gbaut12.idx
237174233 gbaut13.idx
246926300 gbaut14.idx
184544274 gbaut15.idx
186016018 gbaut16.idx
184084636 gbaut17.idx
186351182 gbaut18.idx
194596538 gbaut19.idx
251601785 gbaut2.idx
184586504 gbaut20.idx
184114711 gbaut21.idx
183971331 gbaut22.idx
187842012 gbaut23.idx
191229756 gbaut24.idx
193584530 gbaut25.idx
185656649 gbaut26.idx
183679724 gbaut27.idx
184042202 gbaut28.idx
200482636 gbaut29.idx
235377489 gbaut3.idx
222164084 gbaut30.idx
186775017 gbaut31.idx
254582924 gbaut32.idx
184430061 gbaut33.idx
185167578 gbaut34.idx
184061343 gbaut35.idx
183713370 gbaut36.idx
241288070 gbaut37.idx
184228642 gbaut38.idx
184402168 gbaut39.idx
183780065 gbaut4.idx
199601816 gbaut40.idx
251219266 gbaut41.idx
183807813 gbaut42.idx
186054442 gbaut43.idx
187022924 gbaut44.idx
188532072 gbaut45.idx
183925127 gbaut46.idx
186518862 gbaut47.idx
197719152 gbaut48.idx
229760822 gbaut49.idx
184250332 gbaut5.idx
247829598 gbaut50.idx
185274739 gbaut51.idx
184276343 gbaut52.idx
251374170 gbaut53.idx
183728021 gbaut54.idx
183940692 gbaut55.idx
184038263 gbaut56.idx
208709584 gbaut57.idx
245879391 gbaut58.idx
206092440 gbaut59.idx
184320147 gbaut6.idx
184799352 gbaut60.idx
206390721 gbaut61.idx
15936477 gbaut62.idx
248469071 gbaut7.idx
209564254 gbaut8.idx
185736751 gbaut9.idx
247245421 gbbct1.seq
188034860 gbbct10.seq
241473891 gbbct11.seq
243840735 gbbct12.seq
244185740 gbbct13.seq
248543019 gbbct14.seq
243113972 gbbct15.seq
240282722 gbbct16.seq
245637737 gbbct17.seq
248588869 gbbct18.seq
191124843 gbbct19.seq
246827477 gbbct2.seq
242657586 gbbct20.seq
239946432 gbbct21.seq
249632532 gbbct22.seq
242171267 gbbct23.seq
244707690 gbbct24.seq
247148339 gbbct25.seq
249790069 gbbct26.seq
244516249 gbbct27.seq
246665311 gbbct28.seq
246321804 gbbct29.seq
246343176 gbbct3.seq
233695728 gbbct30.seq
249998838 gbbct31.seq
194432922 gbbct32.seq
241993647 gbbct33.seq
249540073 gbbct34.seq
249998237 gbbct4.seq
103757737 gbbct5.seq
249790524 gbbct6.seq
238535120 gbbct7.seq
247280520 gbbct8.seq
241549783 gbbct9.seq
72185597 gbchg.txt
249980284 gbcon1.seq
249991673 gbcon10.seq
249994369 gbcon100.seq
249994433 gbcon101.seq
157277663 gbcon102.seq
249994644 gbcon103.seq
249998690 gbcon104.seq
249973265 gbcon105.seq
249996635 gbcon106.seq
155028911 gbcon107.seq
249999975 gbcon108.seq
249999369 gbcon109.seq
249985471 gbcon11.seq
249999268 gbcon110.seq
249999428 gbcon111.seq
250000108 gbcon112.seq
249997803 gbcon113.seq
250000185 gbcon114.seq
249999307 gbcon115.seq
249998683 gbcon116.seq
15726049 gbcon117.seq
249999594 gbcon118.seq
249999385 gbcon119.seq
249999663 gbcon12.seq
249998786 gbcon120.seq
249998646 gbcon121.seq
122840389 gbcon122.seq
249999949 gbcon123.seq
249999554 gbcon124.seq
249999546 gbcon125.seq
249998879 gbcon126.seq
118438535 gbcon127.seq
21415112 gbcon128.seq
146820410 gbcon13.seq
249998127 gbcon14.seq
250000180 gbcon15.seq
90359010 gbcon16.seq
249994324 gbcon17.seq
249969288 gbcon18.seq
108377660 gbcon19.seq
249775099 gbcon2.seq
249998391 gbcon20.seq
87602297 gbcon21.seq
249998105 gbcon22.seq
249808150 gbcon23.seq
249999054 gbcon24.seq
249998908 gbcon25.seq
192001073 gbcon26.seq
249999207 gbcon27.seq
249997328 gbcon28.seq
249999631 gbcon29.seq
249960341 gbcon3.seq
249999692 gbcon30.seq
249817371 gbcon31.seq
150908817 gbcon32.seq
249996991 gbcon33.seq
249998196 gbcon34.seq
249995927 gbcon35.seq
249997083 gbcon36.seq
249994783 gbcon37.seq
249995520 gbcon38.seq
62365932 gbcon39.seq
248147847 gbcon4.seq
249995165 gbcon40.seq
249995523 gbcon41.seq
249995997 gbcon42.seq
249998287 gbcon43.seq
249997419 gbcon44.seq
44061479 gbcon45.seq
249994534 gbcon46.seq
249999682 gbcon47.seq
249999450 gbcon48.seq
249996981 gbcon49.seq
249993821 gbcon5.seq
249999819 gbcon50.seq
37366136 gbcon51.seq
249994793 gbcon52.seq
249997146 gbcon53.seq
249999890 gbcon54.seq
249997325 gbcon55.seq
249995987 gbcon56.seq
153729264 gbcon57.seq
249996245 gbcon58.seq
249998868 gbcon59.seq
249998265 gbcon6.seq
249998776 gbcon60.seq
249995315 gbcon61.seq
184751617 gbcon62.seq
249999742 gbcon63.seq
249996805 gbcon64.seq
249996378 gbcon65.seq
249997731 gbcon66.seq
246704194 gbcon67.seq
249996123 gbcon68.seq
249996806 gbcon69.seq
241354227 gbcon7.seq
249994747 gbcon70.seq
249998911 gbcon71.seq
249998433 gbcon72.seq
97827765 gbcon73.seq
249996160 gbcon74.seq
249996456 gbcon75.seq
249999720 gbcon76.seq
249998702 gbcon77.seq
249999534 gbcon78.seq
63726819 gbcon79.seq
249996525 gbcon8.seq
249997709 gbcon80.seq
249996382 gbcon81.seq
249999225 gbcon82.seq
249997118 gbcon83.seq
249998473 gbcon84.seq
22747059 gbcon85.seq
249996051 gbcon86.seq
250000090 gbcon87.seq
249999511 gbcon88.seq
249999267 gbcon89.seq
249992660 gbcon9.seq
198915940 gbcon90.seq
249996015 gbcon91.seq
249994203 gbcon92.seq
250000238 gbcon93.seq
249998171 gbcon94.seq
249993618 gbcon95.seq
134239203 gbcon96.seq
249998824 gbcon97.seq
249999798 gbcon98.seq
249997479 gbcon99.seq
2045 gbdel.txt
249998458 gbenv1.seq
249999406 gbenv10.seq
63566692 gbenv11.seq
249999646 gbenv2.seq
249917648 gbenv3.seq
249997813 gbenv4.seq
223555312 gbenv5.seq
250000166 gbenv6.seq
249997087 gbenv7.seq
249998938 gbenv8.seq
249997191 gbenv9.seq
230688615 gbest1.seq
230687850 gbest10.seq
230687753 gbest100.seq
230687942 gbest101.seq
230689935 gbest102.seq
230688787 gbest103.seq
230689121 gbest104.seq
230689392 gbest105.seq
230690244 gbest106.seq
230688591 gbest107.seq
230688464 gbest108.seq
230688770 gbest109.seq
230688467 gbest11.seq
230689235 gbest110.seq
230687664 gbest111.seq
230690212 gbest112.seq
230687968 gbest113.seq
230689336 gbest114.seq
230689056 gbest115.seq
230690200 gbest116.seq
230689614 gbest117.seq
230689608 gbest118.seq
230618893 gbest119.seq
230689872 gbest12.seq
230687653 gbest120.seq
230688540 gbest121.seq
230687898 gbest122.seq
230689329 gbest123.seq
230688363 gbest124.seq
230690773 gbest125.seq
230690377 gbest126.seq
230690334 gbest127.seq
230687623 gbest128.seq
230689384 gbest129.seq
230689821 gbest13.seq
230689306 gbest130.seq
230687510 gbest131.seq
230690533 gbest132.seq
230688585 gbest133.seq
230688605 gbest134.seq
230689021 gbest135.seq
230688816 gbest136.seq
230690137 gbest137.seq
230689688 gbest138.seq
230689609 gbest139.seq
230688942 gbest14.seq
230689317 gbest140.seq
230688683 gbest141.seq
230689152 gbest142.seq
230688651 gbest143.seq
230687534 gbest144.seq
230688504 gbest145.seq
230687452 gbest146.seq
230690505 gbest147.seq
230687481 gbest148.seq
230687660 gbest149.seq
230687521 gbest15.seq
230690659 gbest150.seq
230687552 gbest151.seq
230688736 gbest152.seq
230688152 gbest153.seq
230691204 gbest154.seq
230687712 gbest155.seq
230687905 gbest156.seq
230688007 gbest157.seq
230688159 gbest158.seq
230688160 gbest159.seq
230688589 gbest16.seq
230690289 gbest160.seq
230687782 gbest161.seq
230688340 gbest162.seq
230687580 gbest163.seq
230688834 gbest164.seq
230696179 gbest165.seq
230689904 gbest166.seq
230688716 gbest167.seq
230689062 gbest168.seq
230689078 gbest169.seq
230689100 gbest17.seq
230689978 gbest170.seq
230689706 gbest171.seq
230687861 gbest172.seq
230688130 gbest173.seq
230688220 gbest174.seq
230687768 gbest175.seq
230687712 gbest176.seq
230688788 gbest177.seq
230688942 gbest178.seq
230689013 gbest179.seq
230688140 gbest18.seq
230689456 gbest180.seq
230689360 gbest181.seq
230687714 gbest182.seq
230687828 gbest183.seq
230689225 gbest184.seq
230688933 gbest185.seq
230688374 gbest186.seq
230688483 gbest187.seq
230689610 gbest188.seq
228736700 gbest189.seq
230689755 gbest19.seq
230690025 gbest190.seq
230689937 gbest191.seq
230689362 gbest192.seq
230687603 gbest193.seq
230688968 gbest194.seq
230688118 gbest195.seq
230689381 gbest196.seq
230689198 gbest197.seq
230690285 gbest198.seq
230689391 gbest199.seq
230689833 gbest2.seq
230687606 gbest20.seq
230689491 gbest200.seq
230690527 gbest201.seq
230690817 gbest202.seq
230689530 gbest203.seq
230688423 gbest204.seq
230690392 gbest205.seq
230690505 gbest206.seq
230688589 gbest207.seq
230690626 gbest208.seq
230688225 gbest209.seq
230688773 gbest21.seq
230687653 gbest210.seq
230687831 gbest211.seq
230689163 gbest212.seq
230688261 gbest213.seq
230688106 gbest214.seq
230687525 gbest215.seq
230689084 gbest216.seq
230689560 gbest217.seq
230688264 gbest218.seq
230689824 gbest219.seq
230690664 gbest22.seq
230688338 gbest220.seq
230687785 gbest221.seq
230689058 gbest222.seq
230688506 gbest223.seq
230689913 gbest224.seq
230690525 gbest225.seq
230690052 gbest226.seq
230689098 gbest227.seq
230689532 gbest228.seq
230690645 gbest229.seq
230689459 gbest23.seq
230690249 gbest230.seq
203046969 gbest231.seq
161786503 gbest232.seq
161568329 gbest233.seq
169186741 gbest234.seq
168087824 gbest235.seq
164196413 gbest236.seq
164372755 gbest237.seq
163707804 gbest238.seq
162982651 gbest239.seq
230689791 gbest24.seq
163481749 gbest240.seq
163034388 gbest241.seq
163179974 gbest242.seq
161997143 gbest243.seq
166979562 gbest244.seq
161901512 gbest245.seq
161462644 gbest246.seq
165558612 gbest247.seq
167141999 gbest248.seq
164834678 gbest249.seq
230689917 gbest25.seq
164628743 gbest250.seq
164323365 gbest251.seq
164078661 gbest252.seq
163233843 gbest253.seq
163092554 gbest254.seq
163877339 gbest255.seq
163725847 gbest256.seq
178909050 gbest257.seq
172025266 gbest258.seq
180019839 gbest259.seq
230688750 gbest26.seq
230689238 gbest260.seq
230692586 gbest261.seq
230688756 gbest262.seq
230689270 gbest263.seq
230690590 gbest264.seq
230689211 gbest265.seq
230690587 gbest266.seq
230690095 gbest267.seq
230687889 gbest268.seq
230690562 gbest269.seq
230689775 gbest27.seq
230690078 gbest270.seq
230691753 gbest271.seq
230687705 gbest272.seq
230687484 gbest273.seq
230687657 gbest274.seq
230688246 gbest275.seq
230688980 gbest276.seq
230689746 gbest277.seq
230689093 gbest278.seq
230689253 gbest279.seq
230688789 gbest28.seq
230690005 gbest280.seq
230688668 gbest281.seq
230688307 gbest282.seq
230689670 gbest283.seq
230689245 gbest284.seq
230689020 gbest285.seq
230689167 gbest286.seq
230687853 gbest287.seq
230689951 gbest288.seq
230687643 gbest289.seq
230688434 gbest29.seq
230690457 gbest290.seq
220813339 gbest291.seq
207475946 gbest292.seq
230688292 gbest293.seq
230690149 gbest294.seq
230689241 gbest295.seq
230688115 gbest296.seq
230690006 gbest297.seq
230690232 gbest298.seq
230690520 gbest299.seq
230690315 gbest3.seq
230688305 gbest30.seq
230688432 gbest300.seq
230688059 gbest301.seq
230688060 gbest302.seq
230688151 gbest303.seq
230688607 gbest304.seq
230689020 gbest305.seq
230687899 gbest306.seq
230688985 gbest307.seq
230689109 gbest308.seq
230688341 gbest309.seq
230689806 gbest31.seq
230689957 gbest310.seq
230693159 gbest311.seq
230687826 gbest312.seq
230690492 gbest313.seq
230689903 gbest314.seq
230689420 gbest315.seq
230689692 gbest316.seq
230690867 gbest317.seq
230691115 gbest318.seq
230689921 gbest319.seq
230688985 gbest32.seq
230691126 gbest320.seq
230688584 gbest321.seq
230690413 gbest322.seq
230689084 gbest323.seq
230690222 gbest324.seq
230687957 gbest325.seq
230688186 gbest326.seq
230688346 gbest327.seq
230687648 gbest328.seq
230688766 gbest329.seq
230689020 gbest33.seq
230687926 gbest330.seq
230689848 gbest331.seq
230689509 gbest332.seq
230689977 gbest333.seq
230688565 gbest334.seq
230689331 gbest335.seq
230691106 gbest336.seq
230688983 gbest337.seq
230688284 gbest338.seq
230689519 gbest339.seq
230689585 gbest34.seq
230687635 gbest340.seq
230689518 gbest341.seq
230689500 gbest342.seq
206123073 gbest343.seq
230688944 gbest344.seq
230688005 gbest345.seq
230687801 gbest346.seq
230687486 gbest347.seq
230690363 gbest348.seq
230690194 gbest349.seq
230689822 gbest35.seq
155844739 gbest350.seq
165688246 gbest351.seq
230688405 gbest352.seq
230689857 gbest353.seq
230688098 gbest354.seq
230689951 gbest355.seq
230689606 gbest356.seq
230687782 gbest357.seq
230688506 gbest358.seq
230691349 gbest359.seq
230688064 gbest36.seq
230688392 gbest360.seq
230688664 gbest361.seq
230687757 gbest362.seq
230687965 gbest363.seq
230687706 gbest364.seq
230691618 gbest365.seq
230688369 gbest366.seq
230689960 gbest367.seq
230687852 gbest368.seq
230688653 gbest369.seq
230689539 gbest37.seq
230687548 gbest370.seq
230688479 gbest371.seq
230688431 gbest372.seq
230690731 gbest373.seq
230690375 gbest374.seq
230688304 gbest375.seq
230688512 gbest376.seq
230690689 gbest377.seq
230688282 gbest378.seq
230690164 gbest379.seq
230689695 gbest38.seq
230688881 gbest380.seq
230688332 gbest381.seq
230688842 gbest382.seq
230687590 gbest383.seq
230694352 gbest384.seq
230691181 gbest385.seq
230688282 gbest386.seq
230688015 gbest387.seq
230689324 gbest388.seq
230688470 gbest389.seq
230690245 gbest39.seq
230688493 gbest390.seq
230689905 gbest391.seq
230688730 gbest392.seq
230687658 gbest393.seq
230689437 gbest394.seq
230687784 gbest395.seq
221368906 gbest396.seq
230689799 gbest397.seq
219320400 gbest398.seq
230693423 gbest399.seq
230688895 gbest4.seq
230690362 gbest40.seq
230688726 gbest400.seq
230691696 gbest401.seq
230689570 gbest402.seq
230687692 gbest403.seq
227010331 gbest404.seq
230689898 gbest405.seq
230690038 gbest406.seq
230691765 gbest407.seq
230688948 gbest408.seq
230689575 gbest409.seq
230688741 gbest41.seq
230688220 gbest410.seq
217834420 gbest411.seq
230689941 gbest412.seq
230688175 gbest413.seq
230689290 gbest414.seq
230688173 gbest415.seq
230689958 gbest416.seq
230691332 gbest417.seq
230689532 gbest418.seq
230690958 gbest419.seq
230688011 gbest42.seq
230690008 gbest420.seq
230690110 gbest421.seq
230688082 gbest422.seq
230687551 gbest423.seq
230688118 gbest424.seq
230689724 gbest425.seq
230690548 gbest426.seq
230687769 gbest427.seq
230688808 gbest428.seq
208791060 gbest429.seq
230687599 gbest43.seq
208318385 gbest430.seq
208205101 gbest431.seq
208406619 gbest432.seq
208362922 gbest433.seq
208529928 gbest434.seq
209250905 gbest435.seq
209653294 gbest436.seq
209563938 gbest437.seq
209947476 gbest438.seq
211823720 gbest439.seq
230690102 gbest44.seq
209536608 gbest440.seq
208836532 gbest441.seq
208803872 gbest442.seq
208664202 gbest443.seq
208195098 gbest444.seq
208292127 gbest445.seq
208257944 gbest446.seq
208166107 gbest447.seq
224440782 gbest448.seq
230689188 gbest449.seq
230688500 gbest45.seq
230688194 gbest450.seq
230689117 gbest451.seq
230690102 gbest452.seq
230688319 gbest453.seq
230688035 gbest454.seq
230689920 gbest455.seq
230687865 gbest456.seq
230688323 gbest457.seq
230689995 gbest458.seq
230688586 gbest459.seq
230689964 gbest46.seq
230689886 gbest460.seq
230687751 gbest461.seq
230688887 gbest462.seq
230689582 gbest463.seq
230689435 gbest464.seq
230689526 gbest465.seq
230687831 gbest466.seq
230688582 gbest467.seq
230689611 gbest468.seq
230689294 gbest469.seq
189054924 gbest47.seq
230688112 gbest470.seq
230690883 gbest471.seq
230688175 gbest472.seq
230688542 gbest473.seq
230689215 gbest474.seq
230687784 gbest475.seq
230688899 gbest476.seq
230691446 gbest477.seq
230690701 gbest478.seq
230692037 gbest479.seq
188236866 gbest48.seq
230691067 gbest480.seq
230690120 gbest481.seq
230688836 gbest482.seq
230688386 gbest483.seq
230690291 gbest484.seq
230690031 gbest485.seq
230688506 gbest486.seq
230687512 gbest487.seq
230689967 gbest488.seq
230688099 gbest489.seq
205044616 gbest49.seq
230688054 gbest490.seq
230688844 gbest491.seq
230687615 gbest492.seq
230688612 gbest493.seq
230690318 gbest494.seq
230689505 gbest495.seq
230689374 gbest496.seq
230691131 gbest497.seq
230687921 gbest498.seq
230689095 gbest499.seq
164142208 gbest5.seq
215087618 gbest50.seq
230688640 gbest500.seq
230687510 gbest501.seq
230688926 gbest502.seq
230689708 gbest503.seq
230688350 gbest504.seq
230690721 gbest505.seq
230688482 gbest506.seq
230689040 gbest507.seq
230689911 gbest508.seq
230688644 gbest509.seq
214790142 gbest51.seq
230689246 gbest510.seq
230690164 gbest511.seq
230689362 gbest512.seq
230687670 gbest513.seq
230689304 gbest514.seq
230688919 gbest515.seq
230688899 gbest516.seq
230689707 gbest517.seq
230688177 gbest518.seq
230687989 gbest519.seq
215563481 gbest52.seq
230688368 gbest520.seq
230688290 gbest521.seq
230689885 gbest522.seq
230690154 gbest523.seq
230688111 gbest524.seq
230688036 gbest525.seq
224963384 gbest526.seq
230689086 gbest527.seq
230690042 gbest528.seq
230689831 gbest529.seq
229547316 gbest53.seq
230688418 gbest530.seq
230688875 gbest531.seq
230688434 gbest532.seq
230689059 gbest533.seq
230689408 gbest534.seq
230687747 gbest535.seq
230689549 gbest536.seq
230689703 gbest537.seq
230688940 gbest538.seq
230689034 gbest539.seq
230688036 gbest54.seq
230688609 gbest540.seq
205398372 gbest541.seq
196098356 gbest542.seq
230688791 gbest543.seq
230687760 gbest544.seq
230689491 gbest545.seq
230689678 gbest546.seq
230687445 gbest547.seq
230688150 gbest548.seq
230688647 gbest549.seq
230688898 gbest55.seq
230688105 gbest550.seq
230687768 gbest551.seq
230689872 gbest552.seq
230688604 gbest553.seq
230688039 gbest554.seq
230689566 gbest555.seq
222238207 gbest556.seq
230688814 gbest557.seq
230687651 gbest558.seq
230689700 gbest559.seq
230281664 gbest56.seq
230689989 gbest560.seq
230687741 gbest561.seq
230688744 gbest562.seq
230687592 gbest563.seq
220186972 gbest564.seq
226180399 gbest565.seq
230688460 gbest566.seq
230688312 gbest567.seq
230688478 gbest568.seq
230689486 gbest569.seq
224657702 gbest57.seq
230688181 gbest570.seq
230689120 gbest571.seq
230689169 gbest572.seq
230690781 gbest573.seq
230689076 gbest574.seq
230690901 gbest575.seq
230687584 gbest576.seq
230687601 gbest577.seq
230690548 gbest578.seq
230689975 gbest579.seq
230689023 gbest58.seq
222074614 gbest580.seq
230687572 gbest581.seq
230689685 gbest582.seq
230687526 gbest583.seq
230688072 gbest584.seq
230687929 gbest585.seq
230690014 gbest586.seq
230690342 gbest587.seq
230689475 gbest588.seq
230688436 gbest589.seq
230689745 gbest59.seq
230688784 gbest590.seq
230688713 gbest591.seq
230688536 gbest592.seq
230689795 gbest593.seq
230688788 gbest594.seq
230689196 gbest595.seq
230690189 gbest596.seq
230688924 gbest597.seq
230689360 gbest598.seq
230688981 gbest599.seq
177420861 gbest6.seq
230690098 gbest60.seq
230690502 gbest600.seq
229480762 gbest601.seq
230689249 gbest602.seq
230689243 gbest603.seq
230688628 gbest604.seq
230689351 gbest605.seq
230689969 gbest606.seq
230688068 gbest607.seq
230690276 gbest608.seq
230689856 gbest609.seq
230689011 gbest61.seq
230690301 gbest610.seq
230688194 gbest611.seq
230688053 gbest612.seq
230688225 gbest613.seq
230688081 gbest614.seq
230688592 gbest615.seq
230690400 gbest616.seq
230690224 gbest617.seq
230688484 gbest618.seq
230688233 gbest619.seq
230688606 gbest62.seq
230690729 gbest620.seq
230687814 gbest621.seq
230690404 gbest622.seq
230691137 gbest623.seq
230687919 gbest624.seq
230688459 gbest625.seq
230689535 gbest626.seq
230688377 gbest627.seq
230688927 gbest628.seq
230688232 gbest629.seq
230689820 gbest63.seq
230688561 gbest630.seq
230689929 gbest631.seq
230690437 gbest632.seq
230689707 gbest633.seq
230688060 gbest634.seq
230689454 gbest635.seq
230687787 gbest636.seq
230688501 gbest637.seq
230688617 gbest638.seq
230688130 gbest639.seq
230687698 gbest64.seq
213909103 gbest640.seq
230688293 gbest641.seq
230687899 gbest642.seq
230689732 gbest643.seq
217325036 gbest644.seq
230687960 gbest645.seq
230688548 gbest646.seq
190890290 gbest647.seq
190682333 gbest648.seq
192290570 gbest649.seq
230690039 gbest65.seq
192746529 gbest650.seq
191298146 gbest651.seq
192198297 gbest652.seq
192108990 gbest653.seq
193108960 gbest654.seq
190549536 gbest655.seq
191750489 gbest656.seq
225090486 gbest657.seq
230688403 gbest658.seq
230687727 gbest659.seq
230690938 gbest66.seq
230689653 gbest660.seq
230689610 gbest661.seq
230689858 gbest662.seq
230687792 gbest663.seq
206589285 gbest664.seq
178799015 gbest665.seq
230688166 gbest666.seq
230687742 gbest667.seq
230689728 gbest668.seq
230689251 gbest669.seq
230690129 gbest67.seq
230689543 gbest670.seq
230687814 gbest671.seq
230690825 gbest672.seq
230690619 gbest673.seq
230689426 gbest674.seq
230689104 gbest675.seq
230689012 gbest676.seq
230687909 gbest677.seq
230690605 gbest678.seq
230690236 gbest679.seq
230688934 gbest68.seq
230688529 gbest680.seq
230689134 gbest681.seq
230689042 gbest682.seq
230688403 gbest683.seq
230690613 gbest684.seq
230690289 gbest685.seq
230688755 gbest686.seq
230688649 gbest687.seq
230688631 gbest688.seq
230690540 gbest689.seq
230689759 gbest69.seq
230687519 gbest690.seq
230690265 gbest691.seq
230689343 gbest692.seq
230687648 gbest693.seq
230690451 gbest694.seq
230689017 gbest695.seq
230690698 gbest696.seq
230690007 gbest697.seq
230689655 gbest698.seq
230688170 gbest699.seq
230687843 gbest7.seq
230687578 gbest70.seq
230690292 gbest700.seq
230688903 gbest701.seq
230688598 gbest702.seq
230688250 gbest703.seq
216405699 gbest704.seq
218359672 gbest705.seq
217244135 gbest706.seq
215041952 gbest707.seq
220312496 gbest708.seq
230689284 gbest709.seq
230155399 gbest71.seq
230688583 gbest710.seq
230691296 gbest711.seq
230687966 gbest712.seq
230689991 gbest713.seq
230690791 gbest714.seq
230689475 gbest715.seq
230687571 gbest716.seq
230688977 gbest717.seq
230689190 gbest718.seq
230688410 gbest719.seq
230687560 gbest72.seq
230688284 gbest720.seq
230690554 gbest721.seq
230690248 gbest722.seq
230688521 gbest723.seq
230687865 gbest724.seq
230690535 gbest725.seq
230690170 gbest726.seq
230691963 gbest727.seq
230688528 gbest728.seq
230688787 gbest729.seq
209320296 gbest73.seq
230688088 gbest730.seq
230688778 gbest731.seq
230687765 gbest732.seq
222572678 gbest733.seq
203689655 gbest734.seq
230688344 gbest735.seq
230688456 gbest736.seq
230688196 gbest737.seq
230690339 gbest738.seq
230687967 gbest739.seq
208181718 gbest74.seq
230688906 gbest740.seq
230691383 gbest741.seq
230691369 gbest742.seq
230690761 gbest743.seq
230690909 gbest744.seq
230690074 gbest745.seq
230689388 gbest746.seq
230689646 gbest747.seq
230689612 gbest748.seq
230691062 gbest749.seq
207452169 gbest75.seq
206773243 gbest750.seq
199728788 gbest751.seq
230688415 gbest752.seq
230689552 gbest753.seq
230688664 gbest754.seq
230693984 gbest755.seq
230688645 gbest756.seq
230689051 gbest757.seq
230689245 gbest758.seq
230689843 gbest759.seq
207840246 gbest76.seq
230688687 gbest760.seq
230690738 gbest761.seq
230690231 gbest762.seq
230689237 gbest763.seq
230688426 gbest764.seq
230687772 gbest765.seq
230687781 gbest766.seq
230689723 gbest767.seq
230690103 gbest768.seq
230688102 gbest769.seq
208464217 gbest77.seq
230687749 gbest770.seq
230688956 gbest771.seq
230687530 gbest772.seq
230689227 gbest773.seq
230689295 gbest774.seq
230687701 gbest775.seq
230688661 gbest776.seq
230688283 gbest777.seq
230688921 gbest778.seq
230688521 gbest779.seq
209181057 gbest78.seq
230688760 gbest780.seq
230691087 gbest781.seq
230687454 gbest782.seq
230689113 gbest783.seq
230691784 gbest784.seq
230689553 gbest785.seq
230688961 gbest786.seq
230689425 gbest787.seq
230688541 gbest788.seq
230690118 gbest789.seq
208507472 gbest79.seq
230688985 gbest790.seq
230689114 gbest791.seq
230687469 gbest792.seq
230688551 gbest793.seq
230689064 gbest794.seq
230689301 gbest795.seq
230689050 gbest796.seq
230689320 gbest797.seq
230688475 gbest798.seq
230689510 gbest799.seq
230688355 gbest8.seq
207062534 gbest80.seq
230688913 gbest800.seq
230690735 gbest801.seq
230689293 gbest802.seq
230687448 gbest803.seq
230688726 gbest804.seq
230687526 gbest805.seq
230688301 gbest806.seq
230690229 gbest807.seq
230687591 gbest808.seq
230687780 gbest809.seq
209023953 gbest81.seq
230690710 gbest810.seq
230689222 gbest811.seq
230690651 gbest812.seq
230688531 gbest813.seq
230690205 gbest814.seq
230687819 gbest815.seq
230688367 gbest816.seq
230689043 gbest817.seq
230688328 gbest818.seq
226194582 gbest819.seq
207051431 gbest82.seq
230687930 gbest820.seq
230689835 gbest821.seq
45915661 gbest822.seq
204135767 gbest83.seq
207232389 gbest84.seq
206991457 gbest85.seq
210742946 gbest86.seq
226847452 gbest87.seq
230692184 gbest88.seq
230691464 gbest89.seq
230689534 gbest9.seq
217145410 gbest90.seq
213200465 gbest91.seq
214687903 gbest92.seq
230688039 gbest93.seq
230690573 gbest94.seq
230688717 gbest95.seq
230690030 gbest96.seq
230688994 gbest97.seq
230688519 gbest98.seq
230689348 gbest99.seq
95229781 gbgen.idx
230688559 gbgss1.seq
230690079 gbgss10.seq
230687985 gbgss100.seq
227641348 gbgss101.seq
228853960 gbgss102.seq
228577797 gbgss103.seq
228616146 gbgss104.seq
227678395 gbgss105.seq
230160460 gbgss106.seq
230687600 gbgss107.seq
230687841 gbgss108.seq
230688889 gbgss109.seq
230689764 gbgss11.seq
230689869 gbgss110.seq
230689355 gbgss111.seq
230690249 gbgss112.seq
230688184 gbgss113.seq
230687967 gbgss114.seq
230687862 gbgss115.seq
230687621 gbgss116.seq
230689054 gbgss117.seq
230689483 gbgss118.seq
230687486 gbgss119.seq
230687679 gbgss12.seq
230689336 gbgss120.seq
230688021 gbgss121.seq
230687870 gbgss122.seq
230688758 gbgss123.seq
230688880 gbgss124.seq
230688977 gbgss125.seq
230688685 gbgss126.seq
230689349 gbgss127.seq
230687906 gbgss128.seq
230690119 gbgss129.seq
230690347 gbgss13.seq
230690398 gbgss130.seq
230688922 gbgss131.seq
230689134 gbgss132.seq
230688439 gbgss133.seq
230689347 gbgss134.seq
230689748 gbgss135.seq
230689964 gbgss136.seq
230688112 gbgss137.seq
230687742 gbgss138.seq
230689718 gbgss139.seq
230689893 gbgss14.seq
230688478 gbgss140.seq
230688707 gbgss141.seq
230687637 gbgss142.seq
230688128 gbgss143.seq
230689634 gbgss144.seq
224596261 gbgss145.seq
230688928 gbgss146.seq
230689242 gbgss147.seq
199926342 gbgss148.seq
230687975 gbgss149.seq
230689648 gbgss15.seq
230689173 gbgss150.seq
230690086 gbgss151.seq
230688702 gbgss152.seq
230688526 gbgss153.seq
230688862 gbgss154.seq
230690645 gbgss155.seq
230689917 gbgss156.seq
230690080 gbgss157.seq
230689704 gbgss158.seq
230688846 gbgss159.seq
230689778 gbgss16.seq
230689436 gbgss160.seq
230688896 gbgss161.seq
230687994 gbgss162.seq
230688883 gbgss163.seq
230689554 gbgss164.seq
230689807 gbgss165.seq
230690344 gbgss166.seq
230689712 gbgss167.seq
230687456 gbgss168.seq
230687884 gbgss169.seq
230688655 gbgss17.seq
230688579 gbgss170.seq
230688194 gbgss171.seq
230689609 gbgss172.seq
230690192 gbgss173.seq
214234168 gbgss174.seq
207652601 gbgss175.seq
210032882 gbgss176.seq
210673479 gbgss177.seq
209682737 gbgss178.seq
209419935 gbgss179.seq
230688580 gbgss18.seq
207488497 gbgss180.seq
207258661 gbgss181.seq
207746756 gbgss182.seq
209295008 gbgss183.seq
209292810 gbgss184.seq
208633189 gbgss185.seq
205849089 gbgss186.seq
205574453 gbgss187.seq
205287402 gbgss188.seq
205471077 gbgss189.seq
230688247 gbgss19.seq
205274267 gbgss190.seq
206071536 gbgss191.seq
207492338 gbgss192.seq
208615158 gbgss193.seq
207878465 gbgss194.seq
207952517 gbgss195.seq
208773079 gbgss196.seq
208858605 gbgss197.seq
208919436 gbgss198.seq
205753134 gbgss199.seq
230688628 gbgss2.seq
230689216 gbgss20.seq
206170741 gbgss200.seq
206444403 gbgss201.seq
205509371 gbgss202.seq
206015118 gbgss203.seq
207311751 gbgss204.seq
207132626 gbgss205.seq
207106159 gbgss206.seq
207240480 gbgss207.seq
207062724 gbgss208.seq
207144456 gbgss209.seq
230687808 gbgss21.seq
206857452 gbgss210.seq
206971198 gbgss211.seq
206675381 gbgss212.seq
207873592 gbgss213.seq
207897566 gbgss214.seq
209406681 gbgss215.seq
210075460 gbgss216.seq
209272247 gbgss217.seq
210246552 gbgss218.seq
218145551 gbgss219.seq
230691288 gbgss22.seq
218861294 gbgss220.seq
230687457 gbgss221.seq
230688281 gbgss222.seq
230687821 gbgss223.seq
230688349 gbgss224.seq
230688627 gbgss225.seq
230689911 gbgss226.seq
217912709 gbgss227.seq
217931097 gbgss228.seq
230688238 gbgss229.seq
230690275 gbgss23.seq
230688491 gbgss230.seq
230689278 gbgss231.seq
230688951 gbgss232.seq
230687740 gbgss233.seq
230689203 gbgss234.seq
230688714 gbgss235.seq
230687742 gbgss236.seq
230689747 gbgss237.seq
230689836 gbgss238.seq
230688189 gbgss239.seq
230687584 gbgss24.seq
230687671 gbgss240.seq
230689100 gbgss241.seq
230688500 gbgss242.seq
230688265 gbgss243.seq
230688105 gbgss244.seq
230687554 gbgss245.seq
230687712 gbgss246.seq
230689469 gbgss247.seq
230687625 gbgss248.seq
230688220 gbgss249.seq
230688860 gbgss25.seq
119303689 gbgss250.seq
249997480 gbgss251.seq
250000166 gbgss252.seq
249998086 gbgss253.seq
249997032 gbgss254.seq
27044721 gbgss255.seq
249999305 gbgss256.seq
249998059 gbgss257.seq
249997528 gbgss258.seq
249998601 gbgss259.seq
230689933 gbgss26.seq
223609630 gbgss260.seq
249998415 gbgss261.seq
249998761 gbgss262.seq
249998880 gbgss263.seq
249998478 gbgss264.seq
172395526 gbgss265.seq
249996883 gbgss266.seq
249998407 gbgss267.seq
249998682 gbgss268.seq
249999133 gbgss269.seq
230687500 gbgss27.seq
249997900 gbgss270.seq
77373170 gbgss271.seq
249999629 gbgss272.seq
2536160 gbgss273.seq
79503481 gbgss274.seq
249999793 gbgss275.seq
249999574 gbgss276.seq
80246184 gbgss277.seq
249998484 gbgss278.seq
249999450 gbgss279.seq
230691150 gbgss28.seq
249999932 gbgss280.seq
106015837 gbgss281.seq
249999531 gbgss282.seq
249999540 gbgss283.seq
249999193 gbgss284.seq
245561962 gbgss285.seq
249997836 gbgss286.seq
249999279 gbgss287.seq
249999994 gbgss288.seq
237545866 gbgss289.seq
230689347 gbgss29.seq
249999336 gbgss290.seq
249999456 gbgss291.seq
249998293 gbgss292.seq
249999491 gbgss293.seq
114414437 gbgss294.seq
249998009 gbgss295.seq
250000031 gbgss296.seq
249998209 gbgss297.seq
249999909 gbgss298.seq
94193676 gbgss299.seq
230689286 gbgss3.seq
230689385 gbgss30.seq
249998892 gbgss300.seq
249999850 gbgss301.seq
250000016 gbgss302.seq
203677706 gbgss303.seq
249999236 gbgss304.seq
249997993 gbgss305.seq
249998006 gbgss306.seq
249999353 gbgss307.seq
95926739 gbgss308.seq
249999461 gbgss309.seq
230690225 gbgss31.seq
249999350 gbgss310.seq
249998406 gbgss311.seq
249998619 gbgss312.seq
104014105 gbgss313.seq
249999853 gbgss314.seq
249998411 gbgss315.seq
249998272 gbgss316.seq
42310440 gbgss317.seq
52138985 gbgss318.seq
85042894 gbgss319.seq
230688976 gbgss32.seq
230688128 gbgss33.seq
230690193 gbgss34.seq
230688810 gbgss35.seq
230689089 gbgss36.seq
230689278 gbgss37.seq
230688359 gbgss38.seq
230689487 gbgss39.seq
230688064 gbgss4.seq
230688189 gbgss40.seq
230687914 gbgss41.seq
230689468 gbgss42.seq
230689860 gbgss43.seq
230688625 gbgss44.seq
230688829 gbgss45.seq
230690346 gbgss46.seq
230688963 gbgss47.seq
230687625 gbgss48.seq
230688321 gbgss49.seq
230688342 gbgss5.seq
230688467 gbgss50.seq
230688749 gbgss51.seq
230689377 gbgss52.seq
230689505 gbgss53.seq
230690049 gbgss54.seq
230688759 gbgss55.seq
230687592 gbgss56.seq
230688956 gbgss57.seq
230690150 gbgss58.seq
230688240 gbgss59.seq
230689182 gbgss6.seq
230689458 gbgss60.seq
228978887 gbgss61.seq
230688786 gbgss62.seq
230688562 gbgss63.seq
230688493 gbgss64.seq
230688511 gbgss65.seq
230688084 gbgss66.seq
230688090 gbgss67.seq
230687948 gbgss68.seq
230687896 gbgss69.seq
230687458 gbgss7.seq
230689872 gbgss70.seq
230689371 gbgss71.seq
230689612 gbgss72.seq
230689793 gbgss73.seq
230688465 gbgss74.seq
230687944 gbgss75.seq
230688682 gbgss76.seq
230688590 gbgss77.seq
230688102 gbgss78.seq
230688694 gbgss79.seq
230690430 gbgss8.seq
230688922 gbgss80.seq
225707360 gbgss81.seq
194162099 gbgss82.seq
194321118 gbgss83.seq
230691378 gbgss84.seq
230689444 gbgss85.seq
230688634 gbgss86.seq
230689771 gbgss87.seq
230688430 gbgss88.seq
230689328 gbgss89.seq
230689298 gbgss9.seq
230689609 gbgss90.seq
230689497 gbgss91.seq
230687463 gbgss92.seq
230688240 gbgss93.seq
230689328 gbgss94.seq
230690844 gbgss95.seq
230688483 gbgss96.seq
230689657 gbgss97.seq
230688630 gbgss98.seq
230689972 gbgss99.seq
249998256 gbhtc1.seq
250000248 gbhtc10.seq
186743521 gbhtc11.seq
249998738 gbhtc12.seq
249999223 gbhtc13.seq
38121098 gbhtc14.seq
249993961 gbhtc2.seq
249987935 gbhtc3.seq
249988571 gbhtc4.seq
249999714 gbhtc5.seq
249988093 gbhtc6.seq
249999558 gbhtc7.seq
71734126 gbhtc8.seq
249995727 gbhtc9.seq
249927410 gbhtg1.seq
249805795 gbhtg10.seq
249975235 gbhtg100.seq
249999934 gbhtg101.seq
249974558 gbhtg102.seq
249673124 gbhtg103.seq
197948537 gbhtg104.seq
249860310 gbhtg105.seq
249957961 gbhtg106.seq
249946058 gbhtg107.seq
249778385 gbhtg108.seq
249791420 gbhtg109.seq
1643239 gbhtg11.seq
19927072 gbhtg110.seq
249909312 gbhtg111.seq
249985108 gbhtg112.seq
249968855 gbhtg113.seq
249828377 gbhtg114.seq
249885278 gbhtg115.seq
120027757 gbhtg116.seq
249627266 gbhtg117.seq
249820018 gbhtg118.seq
249818470 gbhtg119.seq
249672637 gbhtg12.seq
249909630 gbhtg120.seq
249939215 gbhtg121.seq
119533813 gbhtg122.seq
249859177 gbhtg123.seq
249852624 gbhtg124.seq
249745100 gbhtg125.seq
249828132 gbhtg126.seq
249800281 gbhtg127.seq
209121808 gbhtg128.seq
249853612 gbhtg129.seq
249796886 gbhtg13.seq
249906332 gbhtg130.seq
249953231 gbhtg131.seq
249996683 gbhtg132.seq
249983518 gbhtg133.seq
237609709 gbhtg134.seq
249852455 gbhtg14.seq
249713866 gbhtg15.seq
249908296 gbhtg16.seq
249726057 gbhtg17.seq
249966459 gbhtg18.seq
249970703 gbhtg19.seq
249995175 gbhtg2.seq
249860520 gbhtg20.seq
249652221 gbhtg21.seq
3348908 gbhtg22.seq
249684160 gbhtg23.seq
249709648 gbhtg24.seq
249730078 gbhtg25.seq
249979217 gbhtg26.seq
249961691 gbhtg27.seq
249885413 gbhtg28.seq
249953949 gbhtg29.seq
249928345 gbhtg3.seq
249647179 gbhtg30.seq
249785501 gbhtg31.seq
249890258 gbhtg32.seq
3326431 gbhtg33.seq
249694729 gbhtg34.seq
249850785 gbhtg35.seq
249883008 gbhtg36.seq
249757537 gbhtg37.seq
249992469 gbhtg38.seq
249890470 gbhtg39.seq
249925673 gbhtg4.seq
249826065 gbhtg40.seq
249828923 gbhtg41.seq
249782309 gbhtg42.seq
249841317 gbhtg43.seq
1878062 gbhtg44.seq
249971937 gbhtg45.seq
249772816 gbhtg46.seq
249825136 gbhtg47.seq
249889579 gbhtg48.seq
249821799 gbhtg49.seq
249980040 gbhtg5.seq
249801675 gbhtg50.seq
249944901 gbhtg51.seq
249956388 gbhtg52.seq
249774469 gbhtg53.seq
249747465 gbhtg54.seq
476392 gbhtg55.seq
249884740 gbhtg56.seq
249973120 gbhtg57.seq
249950141 gbhtg58.seq
249761669 gbhtg59.seq
249974518 gbhtg6.seq
249989784 gbhtg60.seq
21324925 gbhtg61.seq
249812692 gbhtg62.seq
249739402 gbhtg63.seq
249846287 gbhtg64.seq
249867399 gbhtg65.seq
229373446 gbhtg66.seq
249806515 gbhtg67.seq
249755309 gbhtg68.seq
249740650 gbhtg69.seq
249851850 gbhtg7.seq
249970992 gbhtg70.seq
249987615 gbhtg71.seq
19859935 gbhtg72.seq
249955271 gbhtg73.seq
249973586 gbhtg74.seq
249953795 gbhtg75.seq
249861943 gbhtg76.seq
229535846 gbhtg77.seq
249664812 gbhtg78.seq
249967758 gbhtg79.seq
249791419 gbhtg8.seq
249927176 gbhtg80.seq
249879745 gbhtg81.seq
249970853 gbhtg82.seq
6040638 gbhtg83.seq
249838731 gbhtg84.seq
249949459 gbhtg85.seq
249857196 gbhtg86.seq
249850808 gbhtg87.seq
228625164 gbhtg88.seq
249909892 gbhtg89.seq
249971606 gbhtg9.seq
249945206 gbhtg90.seq
249975497 gbhtg91.seq
249929758 gbhtg92.seq
242204300 gbhtg93.seq
249995487 gbhtg94.seq
249936444 gbhtg95.seq
249810601 gbhtg96.seq
249994920 gbhtg97.seq
249966213 gbhtg98.seq
3838802 gbhtg99.seq
249900491 gbinv1.seq
249998919 gbinv10.seq
113653548 gbinv11.seq
249998879 gbinv12.seq
249936414 gbinv13.seq
184893333 gbinv14.seq
249884239 gbinv2.seq
232067366 gbinv3.seq
250000022 gbinv4.seq
249999264 gbinv5.seq
247954050 gbinv6.seq
196145513 gbinv7.seq
250000228 gbinv8.seq
249998076 gbinv9.seq
142567575 gbjou1.idx
148796036 gbjou2.idx
206912431 gbjou3.idx
295630137 gbjou4.idx
283638081 gbjou5.idx
41291563 gbjou6.idx
185018194 gbkey1.idx
289154337 gbkey2.idx
64171863 gbkey3.idx
249925159 gbmam1.seq
249998732 gbmam2.seq
249999589 gbmam3.seq
216225800 gbmam4.seq
60914552 gbnew.txt
249999968 gbpat1.seq
249999425 gbpat10.seq
178569723 gbpat11.seq
249999637 gbpat12.seq
249999879 gbpat13.seq
249999048 gbpat14.seq
249998797 gbpat15.seq
249999816 gbpat16.seq
66708391 gbpat17.seq
250000049 gbpat18.seq
250000127 gbpat19.seq
249999480 gbpat2.seq
249999084 gbpat20.seq
249993011 gbpat21.seq
183857147 gbpat22.seq
249999856 gbpat23.seq
249901163 gbpat24.seq
249999395 gbpat25.seq
250000179 gbpat26.seq
70897332 gbpat27.seq
250000183 gbpat28.seq
249997829 gbpat29.seq
249999446 gbpat3.seq
249997594 gbpat30.seq
249999020 gbpat31.seq
249998802 gbpat32.seq
179933900 gbpat33.seq
249997548 gbpat34.seq
249999765 gbpat35.seq
249996681 gbpat36.seq
250000184 gbpat37.seq
249999284 gbpat38.seq
249998280 gbpat39.seq
249999110 gbpat4.seq
249999600 gbpat40.seq
249999794 gbpat41.seq
72312095 gbpat42.seq
249998738 gbpat43.seq
249999246 gbpat44.seq
249999730 gbpat45.seq
249999601 gbpat46.seq
222932013 gbpat47.seq
249999057 gbpat48.seq
249999815 gbpat49.seq
71756414 gbpat5.seq
249999501 gbpat50.seq
249999789 gbpat51.seq
249999725 gbpat52.seq
249999879 gbpat53.seq
250000056 gbpat54.seq
162603761 gbpat55.seq
249999527 gbpat6.seq
250000131 gbpat7.seq
249994213 gbpat8.seq
250000235 gbpat9.seq
80682901 gbphg1.seq
249999806 gbpln1.seq
249955296 gbpln10.seq
249976885 gbpln11.seq
75388895 gbpln12.seq
249993089 gbpln13.seq
249982135 gbpln14.seq
249998087 gbpln15.seq
248456529 gbpln16.seq
249935495 gbpln17.seq
249917910 gbpln18.seq
206769104 gbpln19.seq
249875736 gbpln2.seq
249163495 gbpln20.seq
249938236 gbpln21.seq
107925139 gbpln22.seq
249999082 gbpln23.seq
93772842 gbpln24.seq
249999527 gbpln25.seq
249601700 gbpln26.seq
249996992 gbpln27.seq
249998865 gbpln28.seq
249999859 gbpln29.seq
249930977 gbpln3.seq
249999957 gbpln30.seq
105707553 gbpln31.seq
249999676 gbpln32.seq
249998682 gbpln33.seq
249999020 gbpln34.seq
249999121 gbpln35.seq
249998207 gbpln36.seq
53217965 gbpln37.seq
249964611 gbpln4.seq
249998980 gbpln5.seq
249996539 gbpln6.seq
17584403 gbpln7.seq
249997283 gbpln8.seq
249995084 gbpln9.seq
148888621 gbpri1.seq
249873756 gbpri10.seq
111091253 gbpri11.seq
249966221 gbpri12.seq
249900325 gbpri13.seq
249891160 gbpri14.seq
249940560 gbpri15.seq
249905101 gbpri16.seq
249997194 gbpri17.seq
249995017 gbpri18.seq
249826114 gbpri19.seq
249989611 gbpri2.seq
249868865 gbpri20.seq
153553233 gbpri21.seq
179997338 gbpri22.seq
249998472 gbpri23.seq
192540777 gbpri24.seq
249846407 gbpri25.seq
249925342 gbpri26.seq
249785204 gbpri27.seq
249942175 gbpri28.seq
249797391 gbpri29.seq
249800421 gbpri3.seq
249851368 gbpri30.seq
249860130 gbpri31.seq
250000013 gbpri32.seq
60658566 gbpri33.seq
249995319 gbpri34.seq
249976921 gbpri35.seq
249944392 gbpri36.seq
249998506 gbpri37.seq
250000099 gbpri38.seq
157047401 gbpri39.seq
249936780 gbpri4.seq
249875665 gbpri5.seq
249965316 gbpri6.seq
249942196 gbpri7.seq
249933382 gbpri8.seq
249936040 gbpri9.seq
0 gbrel.txt
249903863 gbrod1.seq
249752303 gbrod10.seq
4959596 gbrod11.seq
249940888 gbrod12.seq
249993965 gbrod13.seq
249852228 gbrod14.seq
249820063 gbrod15.seq
249873002 gbrod16.seq
249762749 gbrod17.seq
249999503 gbrod18.seq
35211845 gbrod19.seq
249865460 gbrod2.seq
249826653 gbrod20.seq
249825756 gbrod21.seq
222602425 gbrod22.seq
249996283 gbrod23.seq
249997524 gbrod24.seq
249963220 gbrod25.seq
249933395 gbrod26.seq
249999941 gbrod27.seq
176763512 gbrod28.seq
249952252 gbrod3.seq
249788367 gbrod4.seq
249880951 gbrod5.seq
249882838 gbrod6.seq
249913943 gbrod7.seq
249917722 gbrod8.seq
249966432 gbrod9.seq
1725726429 gbsdr1.txt
4729597867 gbsdr2.txt
1972922209 gbsdr3.txt
149909260 gbsec.idx
249997891 gbsts1.seq
249997362 gbsts10.seq
212226966 gbsts11.seq
249996524 gbsts12.seq
249999267 gbsts13.seq
249998123 gbsts14.seq
249998620 gbsts15.seq
9710933 gbsts16.seq
249999730 gbsts17.seq
249999742 gbsts18.seq
250000256 gbsts19.seq
249999218 gbsts2.seq
86947132 gbsts20.seq
249998732 gbsts3.seq
249998299 gbsts4.seq
28203837 gbsts5.seq
249997222 gbsts6.seq
249997899 gbsts7.seq
249998458 gbsts8.seq
249996448 gbsts9.seq
249997947 gbsyn1.seq
147248648 gbsyn2.seq
10973061 gbtsa1.seq
430852 gbuna1.seq
249999988 gbvrl1.seq
249990912 gbvrl10.seq
21452698 gbvrl11.seq
249994056 gbvrl2.seq
249999982 gbvrl3.seq
249993016 gbvrl4.seq
95569681 gbvrl5.seq
249998093 gbvrl6.seq
249995938 gbvrl7.seq
249998313 gbvrl8.seq
249998023 gbvrl9.seq
249780345 gbvrt1.seq
249994741 gbvrt10.seq
124292148 gbvrt11.seq
249945418 gbvrt12.seq
249922671 gbvrt13.seq
249966335 gbvrt14.seq
249996566 gbvrt15.seq
249998515 gbvrt16.seq
230047186 gbvrt17.seq
249999666 gbvrt2.seq
249958522 gbvrt3.seq
210295945 gbvrt4.seq
249996643 gbvrt5.seq
249999418 gbvrt6.seq
249902989 gbvrt7.seq
249857979 gbvrt8.seq
249707074 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 38399 97732217
BCT10 16123 80555205
BCT11 53633 85142430
BCT12 98 108531102
BCT13 151 93984019
BCT14 61 112455059
BCT15 51 108348224
BCT16 44 110061272
BCT17 57 113989395
BCT18 67 112830215
BCT19 33 84321683
BCT2 3250 107237197
BCT20 40 106881287
BCT21 58 105533856
BCT22 65 110783247
BCT23 58 107450077
BCT24 60 105492102
BCT25 58 109666487
BCT26 47 109689548
BCT27 80 107842667
BCT28 67 108744698
BCT29 62 108948940
BCT3 52 109691243
BCT30 245 96732818
BCT31 42515 91707302
BCT32 56898 62853585
BCT33 74686 78297293
BCT34 35100 95326890
BCT4 14520 106332585
BCT5 23937 37978600
BCT6 39028 87437940
BCT7 6940 90996770
BCT8 13938 93230307
BCT9 4178 106953398
ENV1 91430 71752745
ENV10 84950 89180806
ENV11 24942 19045362
ENV2 94835 69230292
ENV3 84330 80991178
ENV4 89048 87108090
ENV5 93216 56343217
ENV6 131949 31466569
ENV7 87089 71324789
ENV8 91884 76888673
ENV9 85110 88258245
EST1 68125 26289403
EST10 76524 29834002
EST100 76044 34952255
EST101 74554 43227172
EST102 71518 36589930
EST103 74095 37502131
EST104 73201 39486451
EST105 74449 40400226
EST106 70233 40084783
EST107 68824 36375038
EST108 73127 36412428
EST109 72293 45599774
EST11 75175 28789926
EST110 72714 45394655
EST111 69467 42722091
EST112 72629 33220991
EST113 69685 29557514
EST114 67315 38145052
EST115 68235 36144227
EST116 68335 42162637
EST117 72651 36081301
EST118 75075 34646729
EST119 74543 27227193
EST12 77544 30745583
EST120 73627 35310612
EST121 74220 35053899
EST122 64664 37397166
EST123 80548 44576247
EST124 77816 43657482
EST125 68438 47327188
EST126 67697 40311573
EST127 74431 50782970
EST128 69151 41735960
EST129 74804 44689418
EST13 76983 29267115
EST130 73558 45694124
EST131 71715 49643526
EST132 72438 47571351
EST133 78967 43763100
EST134 75346 31153913
EST135 78149 34447109
EST136 79304 45716496
EST137 74618 43483159
EST138 64604 34213226
EST139 70278 36440403
EST14 78808 31965249
EST140 68148 37673260
EST141 65720 36633561
EST142 71583 43136446
EST143 72644 46028501
EST144 67888 39272640
EST145 69033 39252616
EST146 73653 45102171
EST147 67463 39517573
EST148 63531 36335843
EST149 99569 54183966
EST15 74538 31501732
EST150 78466 44760171
EST151 85446 44542169
EST152 104014 55221395
EST153 104684 56852825
EST154 98377 56274686
EST155 74862 44788571
EST156 93859 55946950
EST157 98445 58991704
EST158 92671 54666338
EST159 79004 45573944
EST16 75869 33347307
EST160 68938 37548666
EST161 65879 29947152
EST162 60182 27751852
EST163 56238 27383234
EST164 64753 31441222
EST165 54144 27195910
EST166 79871 53581401
EST167 67942 36854656
EST168 72170 52490576
EST169 72250 41152763
EST17 82082 33820800
EST170 60388 30347382
EST171 63828 37618288
EST172 65788 33030873
EST173 63229 45738008
EST174 63525 36565289
EST175 106845 47427217
EST176 87307 51852290
EST177 103580 59961921
EST178 108042 59278717
EST179 96607 52123434
EST18 80691 32364991
EST180 82154 38177370
EST181 96418 44936414
EST182 97667 47905176
EST183 93005 37493533
EST184 89889 43095710
EST185 64072 44378854
EST186 70596 37648861
EST187 57704 34264926
EST188 71305 43102187
EST189 72331 26518285
EST19 78660 31714971
EST190 75623 45620401
EST191 73334 36990744
EST192 68318 34644567
EST193 68213 40217665
EST194 69600 51870787
EST195 69027 39461025
EST196 67465 33595929
EST197 69098 53218558
EST198 68141 45900260
EST199 72208 37059394
EST2 74644 28643983
EST20 74626 30757121
EST200 68153 46082800
EST201 70100 58308525
EST202 63794 47384017
EST203 63489 46619507
EST204 63757 46076534
EST205 64756 45850689
EST206 66972 50432969
EST207 61553 40227362
EST208 61775 35469482
EST209 66468 37665455
EST21 74039 34350318
EST210 68921 38946439
EST211 91230 51377139
EST212 71055 50466381
EST213 88831 52258989
EST214 113279 69991681
EST215 115174 68281314
EST216 103550 62496414
EST217 98482 64055205
EST218 119124 55807945
EST219 86444 45629866
EST22 74912 30008939
EST220 85803 52404157
EST221 92675 41788168
EST222 89202 45163929
EST223 73110 48207417
EST224 66738 41406835
EST225 68757 57890979
EST226 68730 59168516
EST227 78223 42229318
EST228 81258 44203827
EST229 73407 52842535
EST23 77381 32706122
EST230 70643 50801424
EST231 49969 28831049
EST232 27985 10643194
EST233 27985 10369265
EST234 26685 9909811
EST235 26928 9169580
EST236 27595 9580690
EST237 27360 10252564
EST238 27384 9830842
EST239 27520 10255442
EST24 74758 32788912
EST240 27332 12119702
EST241 27421 11350841
EST242 27496 10309417
EST243 27806 9419527
EST244 27071 9236629
EST245 27997 11297478
EST246 28019 10864600
EST247 27322 11413762
EST248 26796 12019541
EST249 27271 11457369
EST25 74100 31977000
EST250 27258 10973151
EST251 27226 11596851
EST252 27344 11637224
EST253 27474 11236022
EST254 27474 10912054
EST255 27391 10624113
EST256 27413 10897068
EST257 24734 17528723
EST258 25854 17230159
EST259 42294 19426236
EST26 75168 31024139
EST260 87950 40476404
EST261 75929 43914463
EST262 60013 30966046
EST263 100529 41323084
EST264 70711 42432572
EST265 68806 44601269
EST266 69426 44286056
EST267 69848 43766313
EST268 69032 40718923
EST269 69345 39995469
EST27 74427 32413665
EST270 64808 49403459
EST271 63583 30961552
EST272 86502 42550692
EST273 98187 46026239
EST274 71530 40772181
EST275 64281 32430833
EST276 70077 33756969
EST277 69690 42780153
EST278 74645 34595621
EST279 70797 36980253
EST28 107890 51048594
EST280 72063 46308677
EST281 64080 35671080
EST282 68005 35484334
EST283 84597 45221464
EST284 71983 39895297
EST285 81976 55460575
EST286 83252 52774106
EST287 109507 49116106
EST288 77860 42787839
EST289 73537 45232811
EST29 97107 45876086
EST290 72968 40433698
EST291 69900 34164490
EST292 70147 27266328
EST293 67591 41082213
EST294 62370 35192085
EST295 64762 41529068
EST296 70333 40500500
EST297 64759 44514625
EST298 63217 32290530
EST299 80526 42757851
EST3 73730 29915710
EST30 98633 53896345
EST300 83364 44279949
EST301 81707 50278350
EST302 109138 53985259
EST303 116491 48270596
EST304 72729 35305783
EST305 67348 36556610
EST306 70950 46488900
EST307 81622 40325959
EST308 69709 41687048
EST309 71297 41468720
EST31 86682 50561991
EST310 60032 34193349
EST311 52853 31886330
EST312 67546 42798174
EST313 69535 45145400
EST314 66454 41507846
EST315 69280 40063605
EST316 74189 37585706
EST317 60286 31597260
EST318 55681 28503291
EST319 54598 29111137
EST32 65470 41011402
EST320 54900 29323887
EST321 53721 28872779
EST322 57011 25909782
EST323 58049 25548976
EST324 56875 23534873
EST325 56966 23143515
EST326 57428 21948224
EST327 57967 23633997
EST328 57525 22477561
EST329 57888 21704861
EST33 71130 57736361
EST330 59034 22272915
EST331 74994 43734026
EST332 77189 34846067
EST333 79019 32054573
EST334 76149 32650306
EST335 85999 49837306
EST336 66663 50289825
EST337 70811 47262781
EST338 95879 59496750
EST339 96786 58465890
EST34 84889 48600072
EST340 101824 57226605
EST341 99897 54736656
EST342 76279 41076384
EST343 70136 39325376
EST344 76722 43249097
EST345 62409 55332044
EST346 64007 46041292
EST347 63614 40750660
EST348 61810 34918302
EST349 72196 51138327
EST35 85765 42945449
EST350 50375 27578060
EST351 52755 26217693
EST352 71219 38469016
EST353 60144 32668685
EST354 62491 31520598
EST355 64449 41466531
EST356 84982 43232109
EST357 70155 41854449
EST358 68147 43947240
EST359 67213 37162248
EST36 90290 48706594
EST360 63594 41794796
EST361 86835 50161123
EST362 84356 50008132
EST363 78530 42684963
EST364 63588 37308578
EST365 65749 33905956
EST366 73822 40570216
EST367 46809 24257669
EST368 67634 38135863
EST369 69193 42515194
EST37 86907 61545526
EST370 98870 45769311
EST371 74837 45167053
EST372 71400 47158223
EST373 71370 45909679
EST374 62762 35701537
EST375 75169 36575805
EST376 82182 37890601
EST377 57965 41077015
EST378 54047 38131357
EST379 64119 37309975
EST38 76873 50436743
EST380 85858 51832872
EST381 88050 47976661
EST382 67979 42361100
EST383 77978 41351182
EST384 54925 35774799
EST385 43673 22301225
EST386 63036 39642677
EST387 82094 43113561
EST388 77632 46379945
EST389 72779 45038868
EST39 95491 56096320
EST390 79099 47008188
EST391 76759 49208879
EST392 88874 62845145
EST393 77479 71730706
EST394 86122 50223715
EST395 89289 48909689
EST396 78949 38493935
EST397 72209 49561314
EST398 71393 56938297
EST399 71189 40269852
EST4 74560 28391201
EST40 63820 49149838
EST400 59764 38927632
EST401 74827 39994600
EST402 52651 32834084
EST403 77553 30721235
EST404 80579 28345514
EST405 70047 44344933
EST406 64420 36896299
EST407 68051 35295362
EST408 71999 42683085
EST409 69233 46497994
EST41 78033 55075092
EST410 66223 44539727
EST411 75757 44319391
EST412 58781 32811437
EST413 60787 37532002
EST414 81222 51883528
EST415 83234 48362705
EST416 77446 43884507
EST417 58759 40845312
EST418 56136 40608842
EST419 56771 39972509
EST42 101456 48420795
EST420 60295 38441882
EST421 78533 49004758
EST422 48710 30162936
EST423 65414 40048987
EST424 59100 39964966
EST425 60248 41528175
EST426 56269 41239307
EST427 47294 33352121
EST428 89337 42908215
EST429 70217 39044592
EST43 75859 46413250
EST430 70545 38846032
EST431 70680 38775765
EST432 70465 39144459
EST433 70464 38997520
EST434 70369 39242347
EST435 69852 38775378
EST436 69849 38713842
EST437 69849 39768865
EST438 69301 38299360
EST439 68283 38854309
EST44 104555 44579452
EST440 70163 39592722
EST441 70179 38655789
EST442 70286 38963373
EST443 70352 38487535
EST444 70721 38616789
EST445 70540 38847360
EST446 70611 38768522
EST447 70817 37790726
EST448 85551 49031882
EST449 86390 44498290
EST45 92879 51501643
EST450 84813 40843091
EST451 101697 57450729
EST452 82118 44699899
EST453 76354 49768350
EST454 82067 47103700
EST455 79181 42118478
EST456 94623 59705874
EST457 95784 57482109
EST458 79871 45483846
EST459 87753 48425797
EST46 103229 45334096
EST460 85437 55454026
EST461 83674 54650876
EST462 75636 51971935
EST463 75376 44665108
EST464 81500 56244723
EST465 97453 65197052
EST466 97248 66928075
EST467 111019 47546659
EST468 101626 45609866
EST469 51622 40167295
EST47 70162 18975387
EST470 51223 40306627
EST471 76836 45042841
EST472 57082 34485669
EST473 80918 47185642
EST474 116716 58962624
EST475 73264 45302235
EST476 81505 58208249
EST477 43509 24329031
EST478 48452 50265581
EST479 46464 58732661
EST48 70449 18763480
EST480 77119 55119462
EST481 63797 36091476
EST482 72356 41915936
EST483 70132 42231967
EST484 70866 43525796
EST485 61521 51902081
EST486 81676 44105599
EST487 109118 47980599
EST488 82546 53299597
EST489 61810 40037651
EST49 72493 21619903
EST490 56877 40921173
EST491 56923 38286650
EST492 66055 49211838
EST493 65029 45085517
EST494 61140 44535951
EST495 51918 37766273
EST496 52576 37857457
EST497 59186 42301864
EST498 64501 36553537
EST499 69259 44521256
EST5 48193 15292118
EST50 44089 12134910
EST500 57209 37948381
EST501 57327 40481706
EST502 62408 46493304
EST503 63069 47552827
EST504 66673 43897442
EST505 49891 39813691
EST506 57858 38694470
EST507 53100 35241295
EST508 58387 39551133
EST509 60738 37672478
EST51 44037 12254462
EST510 71275 44839712
EST511 70768 59629956
EST512 70243 49806121
EST513 70239 51843305
EST514 46511 57669321
EST515 57762 50102552
EST516 66788 44683915
EST517 65085 40566267
EST518 77403 46413177
EST519 82515 53600958
EST52 43821 11842714
EST520 82315 51645955
EST521 67027 40660957
EST522 65015 39572467
EST523 72331 50643369
EST524 81115 49092126
EST525 76966 62196102
EST526 69019 47797489
EST527 70027 47225999
EST528 68664 49225141
EST529 59998 47385451
EST53 65319 24845265
EST530 62812 45441005
EST531 83987 45993929
EST532 75395 40580594
EST533 113821 45952455
EST534 108462 50435192
EST535 72092 49707863
EST536 50478 49618875
EST537 66078 45141968
EST538 99772 10936431
EST539 99756 10963458
EST54 96397 39190466
EST540 97825 27391578
EST541 87900 35380632
EST542 86884 31661595
EST543 77533 45028936
EST544 67266 59665304
EST545 91159 55646249
EST546 80400 44044540
EST547 67267 44336317
EST548 71243 46675400
EST549 75326 50189056
EST55 97014 42800207
EST550 85201 50881387
EST551 73534 53622487
EST552 67109 46819588
EST553 72754 55181242
EST554 86188 50359637
EST555 83447 45953426
EST556 82521 45352934
EST557 83958 40548630
EST558 84196 46016794
EST559 75389 51671238
EST56 97468 47084139
EST560 72560 55379471
EST561 75013 52003930
EST562 82879 44257795
EST563 103022 46967182
EST564 111024 49060108
EST565 121549 50726365
EST566 131888 59086632
EST567 89058 53651956
EST568 80382 51802486
EST569 81211 22588775
EST57 92566 46121812
EST570 84289 8746236
EST571 105244 44844604
EST572 115796 56075293
EST573 100508 51535869
EST574 66095 43833542
EST575 70820 41731907
EST576 73794 51675835
EST577 72853 43441711
EST578 77802 46992347
EST579 67691 47454553
EST58 104150 51701067
EST580 73046 51521998
EST581 98249 53915421
EST582 89294 43940692
EST583 65017 41176213
EST584 62256 46865672
EST585 94435 57114582
EST586 91704 53846350
EST587 75277 43102979
EST588 83686 30528838
EST589 96798 10417924
EST59 105854 54228497
EST590 96880 10271597
EST591 94829 22342086
EST592 69482 44730581
EST593 93950 45616225
EST594 73115 49840055
EST595 78157 54323985
EST596 84694 52349377
EST597 78456 51145366
EST598 77613 51898047
EST599 80078 45525003
EST6 54905 17436848
EST60 75879 33103849
EST600 84328 49993280
EST601 74155 46560230
EST602 66813 46460917
EST603 57614 36813192
EST604 108949 31688083
EST605 58384 39194617
EST606 51217 32161144
EST607 51160 33909601
EST608 57823 39843375
EST609 73505 47374303
EST61 66698 28818578
EST610 65004 47819518
EST611 104451 23518932
EST612 120199 13002612
EST613 120615 12660625
EST614 122476 11299660
EST615 112630 17778094
EST616 65585 47233118
EST617 63870 49596999
EST618 75537 49037812
EST619 77341 49173934
EST62 72804 32336776
EST620 67800 49148266
EST621 77114 44848162
EST622 62519 41870733
EST623 68861 39931708
EST624 112388 24327267
EST625 127223 11797027
EST626 89271 29786369
EST627 77780 51520595
EST628 72917 51535271
EST629 84520 44865777
EST63 70522 30034249
EST630 89010 51230140
EST631 72610 45422478
EST632 63330 32470621
EST633 75577 54308826
EST634 68393 48064932
EST635 104612 49762803
EST636 96182 54980151
EST637 61836 46899753
EST638 61100 48213147
EST639 73068 53810671
EST64 79867 32556951
EST640 74232 33731467
EST641 88209 55166932
EST642 84062 50504978
EST643 83787 39876298
EST644 71416 47101244
EST645 69315 52164858
EST646 88727 45658049
EST647 77103 27184296
EST648 77516 24560334
EST649 76238 28405262
EST65 76504 30019757
EST650 75956 27814305
EST651 76688 27426951
EST652 75839 30593062
EST653 76274 28041148
EST654 75646 28398756
EST655 77096 27999969
EST656 76008 30619025
EST657 83535 40536565
EST658 80618 50650401
EST659 81928 59885437
EST66 70730 28492096
EST660 83061 58196203
EST661 71782 39731028
EST662 61495 36944503
EST663 78005 47444631
EST664 61352 30060012
EST665 40163 35268978
EST666 59162 43079903
EST667 58854 46013151
EST668 64563 44620454
EST669 77512 42862457
EST67 64957 29711233
EST670 66367 37854311
EST671 85508 52102017
EST672 80823 43569933
EST673 65608 41592283
EST674 72184 47963286
EST675 79861 46505030
EST676 66718 35441628
EST677 70344 48441696
EST678 76784 50798811
EST679 58079 40113849
EST68 72755 32616894
EST680 70011 50460317
EST681 73442 49745510
EST682 71854 45830592
EST683 70336 47374851
EST684 67896 48672646
EST685 81035 69291540
EST686 82163 69219428
EST687 82616 69033988
EST688 75084 39022255
EST689 77276 34987340
EST69 79433 35474537
EST690 54350 30800089
EST691 65839 46148993
EST692 62743 41843133
EST693 65037 44997537
EST694 70964 48755825
EST695 58518 39753615
EST696 58556 39463226
EST697 59342 39825118
EST698 68774 43623167
EST699 64434 44994245
EST7 74531 29353676
EST70 73542 29398940
EST700 65935 45626312
EST701 65910 45566285
EST702 69255 45258552
EST703 73684 41404234
EST704 68306 37801787
EST705 66695 39827068
EST706 67705 37337229
EST707 68946 39725684
EST708 66648 42386129
EST709 70455 56397267
EST71 73971 24859288
EST710 65308 42005706
EST711 70160 42561488
EST712 64741 42200405
EST713 59337 40701185
EST714 67643 38786169
EST715 61978 37862435
EST716 66699 42302318
EST717 84848 51598271
EST718 101396 50835154
EST719 79925 43796195
EST72 86815 42378664
EST720 59874 32027973
EST721 53242 29285600
EST722 51064 31878577
EST723 57616 38118328
EST724 61042 40166858
EST725 56743 37976473
EST726 65010 39824577
EST727 59678 39024003
EST728 56174 34863478
EST729 52982 31420079
EST73 43437 12364261
EST730 74842 43737432
EST731 109130 34928277
EST732 99188 45001394
EST733 77810 34405539
EST734 75055 27411783
EST735 70577 47553915
EST736 68392 42986285
EST737 85309 50474205
EST738 78705 50165347
EST739 70754 42017124
EST74 40877 11254133
EST740 68839 40353473
EST741 57451 38527919
EST742 57606 38129417
EST743 61878 41590604
EST744 59757 39273799
EST745 60982 38505993
EST746 70494 48258280
EST747 84601 56631536
EST748 81031 47735038
EST749 79526 45731018
EST75 40845 12527458
EST750 64691 29659202
EST751 58709 32203619
EST752 87073 53493616
EST753 78784 59334921
EST754 77488 58974333
EST755 38756 24418437
EST756 32436 19716081
EST757 32563 19614650
EST758 32690 18992826
EST759 59850 34225515
EST76 41234 12723883
EST760 58858 34899623
EST761 58656 35423065
EST762 58809 35039391
EST763 63330 32490229
EST764 70991 14745715
EST765 71057 14548477
EST766 71057 14531697
EST767 71225 14142101
EST768 70900 14901443
EST769 66747 26535014
EST77 41287 12379581
EST770 90488 53086972
EST771 90857 54755324
EST772 113080 52898843
EST773 113770 52096456
EST774 113845 52036885
EST775 113519 52409556
EST776 86586 48099475
EST777 67130 42633236
EST778 61014 40737308
EST779 59926 40030587
EST78 41235 13283307
EST780 61594 38062910
EST781 63090 37890793
EST782 61228 37717498
EST783 78496 45667730
EST784 72878 45338709
EST785 80751 53083012
EST786 76669 34232725
EST787 76919 51637487
EST788 76787 9037132
EST789 75661 5864144
EST79 40970 13085638
EST790 75774 5846599
EST791 69367 6139586
EST792 69084 6154205
EST793 70847 12073809
EST794 70844 15033247
EST795 71193 14217875
EST796 71151 14315463
EST797 70921 14851329
EST798 71330 13893936
EST799 70614 16286067
EST8 75810 30584188
EST80 41056 12200687
EST800 66335 45878540
EST801 64971 40367597
EST802 79563 40813231
EST803 87154 58529380
EST804 72933 50604049
EST805 75250 51601091
EST806 76719 46005426
EST807 73957 43753115
EST808 76181 56762336
EST809 65073 41100700
EST81 40616 12145230
EST810 63533 44604842
EST811 62954 44078574
EST812 64771 45231068
EST813 62970 44873804
EST814 64567 37147195
EST815 73327 37865188
EST816 71674 25907268
EST817 73217 26801841
EST818 72756 26324957
EST819 78285 26361666
EST82 41382 12898230
EST820 72529 28118907
EST821 68493 28259297
EST822 19500 5807846
EST83 41899 11985601
EST84 41488 13227762
EST85 41343 13090257
EST86 43027 13028439
EST87 46734 17650566
EST88 43317 27182796
EST89 43085 19388789
EST9 77564 29870697
EST90 49565 20446244
EST91 51579 22126971
EST92 50914 22038815
EST93 84503 50131616
EST94 79377 38453211
EST95 73134 27943957
EST96 74267 29185167
EST97 74803 41170567
EST98 77283 40672328
EST99 76370 43671834
GSS1 90430 38662943
GSS10 74787 43607320
GSS100 80735 53971664
GSS101 74738 42240517
GSS102 73329 45795023
GSS103 73648 44992357
GSS104 73318 45586185
GSS105 73322 44678178
GSS106 74426 45470373
GSS107 81407 54214366
GSS108 83607 55584656
GSS109 80497 53099504
GSS11 70802 35983221
GSS110 83236 50414169
GSS111 84022 55210073
GSS112 79938 61714412
GSS113 90046 45964896
GSS114 90349 54605890
GSS115 75631 49835317
GSS116 87925 63549447
GSS117 82334 60106582
GSS118 75605 39949531
GSS119 81448 52672069
GSS12 73150 38495437
GSS120 95653 53247821
GSS121 84443 55332718
GSS122 85011 54678646
GSS123 82368 54883067
GSS124 76259 69411509
GSS125 76066 67163569
GSS126 79639 56039680
GSS127 72433 50238646
GSS128 72549 50010064
GSS129 73030 49226869
GSS13 76795 38906116
GSS130 72287 50500475
GSS131 73656 49939229
GSS132 83999 59977943
GSS133 81197 58380156
GSS134 70044 56408758
GSS135 70519 55044741
GSS136 75952 67607108
GSS137 75457 63186502
GSS138 77457 52326030
GSS139 85499 53662696
GSS14 71379 32114760
GSS140 94711 58049538
GSS141 93303 59893634
GSS142 81958 53929946
GSS143 89769 50595823
GSS144 72103 59089999
GSS145 114930 59511141
GSS146 111067 58394437
GSS147 86226 63647366
GSS148 55179 31343953
GSS149 67100 47296040
GSS15 70493 35055254
GSS150 72995 55896458
GSS151 72982 55920461
GSS152 73000 55888554
GSS153 73012 55866465
GSS154 72970 55939832
GSS155 72981 55922768
GSS156 75707 57785758
GSS157 83528 39195724
GSS158 88049 60128335
GSS159 86772 64919430
GSS16 78213 46093569
GSS160 88031 59820864
GSS161 92551 57472512
GSS162 82885 57226584
GSS163 76243 49678298
GSS164 75771 48590238
GSS165 92705 58637901
GSS166 88992 59730684
GSS167 85988 61453690
GSS168 102783 26256270
GSS169 103093 29418413
GSS17 70895 33315071
GSS170 78937 46758671
GSS171 80953 52896574
GSS172 54394 39355505
GSS173 52628 40814397
GSS174 61916 51490322
GSS175 59033 45446997
GSS176 57769 48362134
GSS177 57489 48794219
GSS178 58190 46600140
GSS179 58380 46034384
GSS18 58792 27918452
GSS180 58913 47989933
GSS181 58948 48421703
GSS182 58611 49465418
GSS183 58246 48435350
GSS184 58637 46079755
GSS185 58719 49348887
GSS186 60103 50320808
GSS187 60304 49771194
GSS188 60508 49164404
GSS189 60377 49554787
GSS19 56814 29015258
GSS190 60516 49138897
GSS191 60060 46962253
GSS192 59200 45202582
GSS193 58414 47678025
GSS194 58931 46062884
GSS195 58876 46232205
GSS196 58306 48020144
GSS197 58245 48209968
GSS198 58202 48388065
GSS199 60128 50007490
GSS2 89000 39334171
GSS20 57683 26671178
GSS200 59839 50876247
GSS201 59838 49497316
GSS202 60655 45813853
GSS203 60308 46893737
GSS204 59407 49677849
GSS205 59530 49301014
GSS206 59551 49238653
GSS207 59455 49530518
GSS208 59579 49153705
GSS209 59522 49326394
GSS21 61491 29519987
GSS210 59724 48713770
GSS211 59642 48960474
GSS212 59849 48330910
GSS213 58886 46171533
GSS214 58868 45994018
GSS215 58413 47567226
GSS216 58238 48171747
GSS217 58744 46253030
GSS218 57876 48031968
GSS219 64297 54162239
GSS22 64602 37591837
GSS220 64817 54769903
GSS221 89899 58795443
GSS222 84300 44773629
GSS223 78132 60370271
GSS224 83482 53268139
GSS225 91297 49817917
GSS226 75288 51937210
GSS227 71267 47114128
GSS228 71251 47155448
GSS229 95860 51402015
GSS23 57530 27078431
GSS230 99937 64619616
GSS231 86960 56293139
GSS232 96187 62491501
GSS233 95177 63747532
GSS234 96245 62424151
GSS235 95245 63547922
GSS236 95362 63297185
GSS237 92354 67042014
GSS238 94161 64797524
GSS239 94730 64083462
GSS24 66204 42045465
GSS240 92708 66603106
GSS241 93223 65960182
GSS242 93514 65605110
GSS243 92264 67436388
GSS244 94722 64620318
GSS245 90095 69967002
GSS246 88197 68096608
GSS247 73442 52096647
GSS248 58380 34889498
GSS249 58483 38085997
GSS25 68012 28208036
GSS250 36496 22425317
GSS251 87209 64341123
GSS252 83563 62780890
GSS253 103512 48467445
GSS254 68547 58487558
GSS255 7225 6693959
GSS256 68689 57997997
GSS257 69318 56731875
GSS258 69558 56262131
GSS259 71310 56073507
GSS26 58165 25385995
GSS260 68163 51560938
GSS261 75915 58209304
GSS262 87237 74898207
GSS263 81830 44609896
GSS264 92577 44779809
GSS265 56441 44219573
GSS266 77450 61364360
GSS267 69674 58716476
GSS268 67726 62729803
GSS269 62115 53378890
GSS27 65496 32012382
GSS270 95374 42846906
GSS271 21124 4925389
GSS272 112777 70738610
GSS273 983 698223
GSS274 23226 28867035
GSS275 106545 69076642
GSS276 84506 34579222
GSS277 38340 23887677
GSS278 120690 73137800
GSS279 118608 75280747
GSS28 65277 32524263
GSS280 107827 64313380
GSS281 44875 22452831
GSS282 83122 54662699
GSS283 95854 61476351
GSS284 107385 78564022
GSS285 106112 76516066
GSS286 106101 79982459
GSS287 104023 80029991
GSS288 76699 51240599
GSS289 104177 63042260
GSS29 77560 39751724
GSS290 109868 66415305
GSS291 106304 59376521
GSS292 68468 37495987
GSS293 70288 39120208
GSS294 36242 16959499
GSS295 85481 46023427
GSS296 97119 55907586
GSS297 94941 49578268
GSS298 96269 55917369
GSS299 42190 23639634
GSS3 87422 41844005
GSS30 82722 39709532
GSS300 114638 43642267
GSS301 117085 39368203
GSS302 103278 77900651
GSS303 81613 53566266
GSS304 95891 36542252
GSS305 95417 37268709
GSS306 96671 35161518
GSS307 94285 39167432
GSS308 37736 17626556
GSS309 103939 66277823
GSS31 74196 40403296
GSS310 94551 61190929
GSS311 95128 60357048
GSS312 94773 60868501
GSS313 33134 33073975
GSS314 83875 28283031
GSS315 84362 27389237
GSS316 85085 25924821
GSS317 14410 4314220
GSS318 16547 7508221
GSS319 30203 14154252
GSS32 70296 48150506
GSS33 79819 37806757
GSS34 75886 40326853
GSS35 74137 39965937
GSS36 87407 56321961
GSS37 87597 58175336
GSS38 85527 44938754
GSS39 86748 50382457
GSS4 79227 41150659
GSS40 86338 39890925
GSS41 83128 32053103
GSS42 81246 56934526
GSS43 80119 58036205
GSS44 72015 47522099
GSS45 72042 47418737
GSS46 77593 45700878
GSS47 77817 38710219
GSS48 83136 57946480
GSS49 86562 64736594
GSS5 78819 40567994
GSS50 81619 54415202
GSS51 93859 59286241
GSS52 88468 58760461
GSS53 76598 42227197
GSS54 72837 40526305
GSS55 86497 47027164
GSS56 88038 58467263
GSS57 76195 63888101
GSS58 70809 77994698
GSS59 85505 69015835
GSS6 78088 38842501
GSS60 89580 60228581
GSS61 63450 44798512
GSS62 66010 45382089
GSS63 89643 67177279
GSS64 84960 58429020
GSS65 86085 52989465
GSS66 85463 55672245
GSS67 93346 57853897
GSS68 97857 52536797
GSS69 97528 52972908
GSS7 77657 39174963
GSS70 98228 52048388
GSS71 99183 50781820
GSS72 99205 50753178
GSS73 99077 50923874
GSS74 99695 50102347
GSS75 97770 52652118
GSS76 91867 64654021
GSS77 89865 70740033
GSS78 88925 70111547
GSS79 87858 69635748
GSS8 75881 38134490
GSS80 87908 63986891
GSS81 88312 44882444
GSS82 78277 23271484
GSS83 78145 23584254
GSS84 84149 48917342
GSS85 77098 45548204
GSS86 88958 56028697
GSS87 84342 58665578
GSS88 75464 75654161
GSS89 78488 73099327
GSS9 72240 37167492
GSS90 83987 46687847
GSS91 85043 49406143
GSS92 73869 40395541
GSS93 80113 56218088
GSS94 76471 56905463
GSS95 82996 52877042
GSS96 82955 59174299
GSS97 85633 57672356
GSS98 86989 52201941
GSS99 82545 66443743
HTC1 25181 27238735
HTC10 77726 71533057
HTC11 48239 67020709
HTC12 66997 61008541
HTC13 68496 69600603
HTC14 14147 9054486
HTC2 16162 36527196
HTC3 16149 36808896
HTC4 16389 35873366
HTC5 16090 40456968
HTC6 16183 37872493
HTC7 55450 33944681
HTC8 28838 15503974
HTC9 65502 65512606
HTG1 1317 188816214
HTG10 1297 186286287
HTG100 1075 191119924
HTG101 1179 191244728
HTG102 1060 189547128
HTG103 1076 189402958
HTG104 803 150303768
HTG105 1023 189791146
HTG106 992 189493559
HTG107 998 189461130
HTG108 986 189298618
HTG109 1222 190532185
HTG11 9 1245953
HTG110 107 15228729
HTG111 1168 189985586
HTG112 1076 189793603
HTG113 1423 191733006
HTG114 1286 189663584
HTG115 1069 187661069
HTG116 562 90458565
HTG117 1620 188255526
HTG118 968 193182838
HTG119 744 168761581
HTG12 1451 183812880
HTG120 1093 193782917
HTG121 1102 193062593
HTG122 497 92572899
HTG123 1037 189382427
HTG124 1074 191978101
HTG125 1120 191766388
HTG126 1160 192370905
HTG127 1110 192625029
HTG128 953 161176456
HTG129 1171 192379534
HTG13 874 191660453
HTG130 1141 191902610
HTG131 1168 191641695
HTG132 1261 191463329
HTG133 1274 191111735
HTG134 1296 181842114
HTG14 749 192119092
HTG15 743 191912522
HTG16 781 192058116
HTG17 802 191740276
HTG18 767 192122403
HTG19 2060 171005924
HTG2 2450 186032194
HTG20 1066 187750579
HTG21 971 189001584
HTG22 10 2576485
HTG23 783 191603739
HTG24 922 190054738
HTG25 901 190325895
HTG26 809 191385146
HTG27 777 191955594
HTG28 865 191172912
HTG29 882 190698357
HTG3 2521 185182868
HTG30 952 189589120
HTG31 895 190867299
HTG32 929 190231949
HTG33 10 2551973
HTG34 869 191033582
HTG35 964 189451245
HTG36 883 190994771
HTG37 861 191194957
HTG38 822 191809458
HTG39 946 189933403
HTG4 2561 188413286
HTG40 929 190575711
HTG41 936 190221999
HTG42 1039 189062487
HTG43 1207 186705135
HTG44 6 1440836
HTG45 1260 188090390
HTG46 1173 187776255
HTG47 1151 187762861
HTG48 1118 191315832
HTG49 1271 190542083
HTG5 1284 185519279
HTG50 1175 190964995
HTG51 1132 191312261
HTG52 1038 191365443
HTG53 1018 189641828
HTG54 1124 189871810
HTG55 1 356290
HTG56 970 190170079
HTG57 1108 190207800
HTG58 1046 190300011
HTG59 1014 189664607
HTG6 1274 185170203
HTG60 968 189200544
HTG61 92 16208344
HTG62 1010 189318336
HTG63 1030 189824223
HTG64 1067 187350605
HTG65 1128 188132641
HTG66 1011 174017282
HTG67 1086 189542144
HTG68 1067 189359832
HTG69 1170 188690627
HTG7 1275 185326125
HTG70 1173 187621233
HTG71 1287 184462593
HTG72 108 14625200
HTG73 1221 185311372
HTG74 1239 184674446
HTG75 1244 184625496
HTG76 1183 187621779
HTG77 1040 173550055
HTG78 1118 188186640
HTG79 1101 190885879
HTG8 1459 184483094
HTG80 1137 190921555
HTG81 1187 190869757
HTG82 1121 190429755
HTG83 26 4635039
HTG84 1173 190261148
HTG85 1116 190096668
HTG86 1213 189967044
HTG87 1123 189767404
HTG88 1015 173845199
HTG89 1225 188570929
HTG9 1200 186953640
HTG90 1273 187736405
HTG91 1147 190220854
HTG92 1158 189907425
HTG93 1074 184272715
HTG94 1193 190090541
HTG95 1136 190358125
HTG96 1153 190261076
HTG97 1107 190775977
HTG98 1161 191016622
HTG99 19 2961888
INV1 87174 61291697
INV10 83147 66155619
INV11 39064 29291514
INV12 86533 64312350
INV13 76915 72553910
INV14 20336 84093256
INV2 1594 184911688
INV3 837 145737262
INV4 34701 109806973
INV5 79490 70310402
INV6 27622 122046449
INV7 40401 73529046
INV8 80864 72010593
INV9 60949 87565658
MAM1 12621 165735748
MAM2 57374 103593783
MAM3 33945 124272149
MAM4 70080 65058658
PAT1 222592 70119231
PAT10 124662 102623629
PAT11 98038 63865682
PAT12 141721 62598360
PAT13 105778 59940133
PAT14 103495 50220603
PAT15 121403 53121635
PAT16 112890 61312711
PAT17 39713 16493824
PAT18 147080 52719692
PAT19 154046 77955924
PAT2 194509 84662483
PAT20 104975 118360610
PAT21 133104 95934759
PAT22 84414 77984688
PAT23 123593 103416980
PAT24 119386 105821309
PAT25 145827 86560758
PAT26 175047 64237480
PAT27 71147 1778675
PAT28 102205 77408400
PAT29 93953 87654524
PAT3 171989 95891307
PAT30 119938 61664315
PAT31 96671 78978369
PAT32 128430 55051342
PAT33 92094 51065481
PAT34 111309 78153687
PAT35 138110 29117720
PAT36 158494 24101055
PAT37 114726 49001210
PAT38 88808 90768098
PAT39 107101 72497480
PAT4 153748 106057898
PAT40 100251 75398789
PAT41 160038 12232851
PAT42 34860 14799849
PAT43 135194 108002157
PAT44 167081 97033001
PAT45 116398 127555097
PAT46 196344 76721733
PAT47 80299 127990882
PAT48 27631 180872621
PAT49 185408 93066629
PAT5 57162 23941642
PAT50 274454 6861350
PAT51 204271 44986697
PAT52 199178 69018356
PAT53 342935 8573375
PAT54 164648 101090342
PAT55 141888 49658673
PAT6 170642 91909261
PAT7 154872 88278449
PAT8 131154 97088564
PAT9 129741 101115498
PHG1 4115 32656810
PLN1 60082 93237222
PLN10 35602 75742656
PLN11 13902 135955303
PLN12 7324 32342473
PLN13 17560 144723042
PLN14 17617 146198585
PLN15 17555 146290364
PLN16 22532 130686413
PLN17 3305 155959031
PLN18 1218 171377451
PLN19 414 127683665
PLN2 3236 162536219
PLN20 5 161804357
PLN21 417 169286391
PLN22 20217 47268586
PLN23 67586 69953268
PLN24 28168 30508700
PLN25 77116 76845538
PLN26 54872 91702478
PLN27 12761 134993916
PLN28 25176 133727571
PLN29 78131 75178672
PLN3 1547 182714150
PLN30 99694 58364331
PLN31 30456 31657561
PLN32 80354 72899807
PLN33 78985 75630269
PLN34 85860 70632220
PLN35 104823 58265089
PLN36 73685 79484829
PLN37 9334 20755208
PLN4 1987 190979615
PLN5 18149 149743526
PLN6 75845 79209778
PLN7 5450 5097529
PLN8 73567 76146336
PLN9 37010 49221382
PRI1 23000 59621544
PRI10 1295 179722091
PRI11 668 80557260
PRI12 1278 179183454
PRI13 1451 177770436
PRI14 1589 180081042
PRI15 1591 181937113
PRI16 1285 191718955
PRI17 1138 193767758
PRI18 1099 194325738
PRI19 1183 193471568
PRI2 13669 156227120
PRI20 1933 191458289
PRI21 20806 81900105
PRI22 32471 85298122
PRI23 61498 78361061
PRI24 28503 64719723
PRI25 5235 171179726
PRI26 2193 182099570
PRI27 1545 182671572
PRI28 2054 182728377
PRI29 2037 181856757
PRI3 1434 175953829
PRI30 12995 155650879
PRI31 1298 183102036
PRI32 51136 94304654
PRI33 13941 20739185
PRI34 32270 63837414
PRI35 18942 124537058
PRI36 20763 144473515
PRI37 67106 84838719
PRI38 63230 86513190
PRI39 36258 64483656
PRI4 1294 186736077
PRI5 1302 182716315
PRI6 1191 181008521
PRI7 1240 180854611
PRI8 1233 177722022
PRI9 1344 174760766
ROD1 29439 144963687
ROD10 974 181161700
ROD11 21 3667193
ROD12 1036 185708772
ROD13 942 182941776
ROD14 1037 189219090
ROD15 950 180240633
ROD16 966 181922926
ROD17 994 185916783
ROD18 9341 176406549
ROD19 7747 14255466
ROD2 912 174937174
ROD20 20165 149739747
ROD21 1145 183609456
ROD22 1049 163592512
ROD23 14066 163320993
ROD24 38388 69821660
ROD25 19584 114102480
ROD26 1507 190056750
ROD27 151287 18206406
ROD28 49409 57071597
ROD3 912 173456352
ROD4 901 173880971
ROD5 929 174042414
ROD6 981 179155375
ROD7 956 179721423
ROD8 994 182023919
ROD9 998 182087122
STS1 84834 36486301
STS10 57907 44419978
STS11 49213 37736560
STS12 57924 43637361
STS13 64551 42980742
STS14 96057 34661440
STS15 107342 27440184
STS16 4142 1105755
STS17 106233 28257593
STS18 86058 34188117
STS19 102882 33846511
STS2 84925 49969163
STS20 35235 11810061
STS3 70540 26667289
STS4 73628 37206645
STS5 6078 3576403
STS6 54177 31603126
STS7 54081 31788805
STS8 54235 31906296
STS9 55657 37682948
SYN1 48025 72256925
SYN2 29008 40027238
TSA1 3512 2884284
UNA1 214 116246
VRL1 72140 66577137
VRL10 67109 73162970
VRL11 6606 5253329
VRL2 70757 64880771
VRL3 73236 63241165
VRL4 69188 69918266
VRL5 21852 26846869
VRL6 57996 73467202
VRL7 62043 72851969
VRL8 68668 67359382
VRL9 55293 74508301
VRT1 24841 152302287
VRT10 8905 178255718
VRT11 3044 91574466
VRT12 13328 171079472
VRT13 5287 184104269
VRT14 4064 187572266
VRT15 64650 91979353
VRT16 79834 68745242
VRT17 74379 60801382
VRT2 40598 133488682
VRT3 33143 136193031
VRT4 37504 100111952
VRT5 72885 66795658
VRT6 31745 63557811
VRT7 19321 136610615
VRT8 1229 190515429
VRT9 1283 189841675
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 168.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:
Entries Bases Species
11725758 13255901864 Homo sapiens
7272337 8375177717 Mus musculus
1759359 6061264442 Rattus norvegicus
2087158 5243823410 Bos taurus
3771697 4902700435 Zea mays
2492407 3701037666 Sus scrofa
1592287 2997379279 Danio rerio
1207764 1535228811 Oryza sativa Japonica Group
228092 1352741094 Strongylocentrotus purpuratus
1422988 1146635741 Xenopus (Silurana) tropicalis
1674950 1143387586 Nicotiana tabacum
213019 996699045 Pan troglodytes
1432736 926659932 Canis lupus familiaris
783363 915969702 Drosophila melanogaster
2212733 914030499 Arabidopsis thaliana
650388 905817474 Vitis vinifera
804573 871708350 Gallus gallus
77498 804487478 Macaca mulatta
1216100 748117035 Ciona intestinalis
1771894 709407636 Glycine max
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
December 15 2008
NCBI-GenBank Flat File Release 169.0
Bacterial Sequences (Part 1)
25389 loci, 102437874 bases, from 25389 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
or 2010.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 PROJECT Format
This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
PROJECT GenomeProject:18787
A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second
contains the actual project identifier ("18787").
PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:
http://www.ncbi.nlm.nih.gov/genomes/static/gprj_help.html#introduction
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 169.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
Andrea Gocke, Anjanette Johnston, Mark Landree, Richard McVeigh,
Ilene Mizrachi, DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,
Gert Roosen, Susan Schafer, Melissa Wright, and Linda Yankie
Data Management and Preparation
Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
Eugene Yaschenko, Sergey Zhdanov
Database Administration
Slava Khotomliansky, Igor Lozitskiy, Ben Slade, Constantin Vasilyev
User Support
Medha Bhagwat, Peter Cooper, Wayne Matten, Scott McGinnis, Monica Romiti,
Eric Sayers, Tao Tao, Majda Valjavec-Gratian, David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
