Release Notes For GenBank Release 170
GBREL.TXT Genetic Sequence Data Bank
February 15 2009
NCBI-GenBank Flat File Release 170.0
Distribution Release Notes
101815678 loci, 101467270308 bases, from 101815678 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 170.0
1.2 Cutoff Date
1.3 Important Changes in Release 170.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 170.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for GenBank's web-based submission tool (BankIt) :
http://www.ncbi.nlm.nih.gov/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 170.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:
ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/ (Japan)
ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/ (Korea)
ftp://bio-mirror.sg.apan.net/biomirrors/genbank/ (Singapore)
1.2 Cutoff Date
This full release, 170.0, incorporates data available to the collaborating
databases as of February 13, 2009 at approximately 1:30am EST. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 170.0
1.3.1 Organizational changes
The total number of sequence data files increased by 34 with this release:
- the BCT division is now composed of 38 files (+4)
- the ENV division is now composed of 12 files (+1)
- the EST division is now composed of 838 files (+16)
- the GSS division is now composed of 322 files (+3)
- the HTG division is now composed of 133 files (-1)
- the PAT division is now composed of 65 files (+10)
- the VRT division is now composed of 18 files (+1)
Note that the HTG division has one less file than previously. Occasional
decreases like this are now possible, given a new method of flatfile
processing that was adopted in December 2008. Essentially, records within
a particular sequence file (eg, gbhtg134.seq) can become absorbed in a
different file, depending on the overall distribution of the number of
records in the files that make up a division. Such decreases are reviewed,
to ensure that they do not indicate a loss of release content.
In addition, the total number of index files increased by 3 with this release:
- the AUT index is now composed of 65 files (+3)
1.3.2 New DBLINK linetype legal as of February 2009.
The PROJECT linetype allows a sequence record to be linked to information
about the sequencing project that generated the data which ultimately
resulted in the record's submission to the International Nucleotide Sequence
Database ( INSD; see http://www.insdc.org ) .
This complete bacterial GenBank record illustrates the use of the PROJECT
line:
LOCUS CP000964 5641239 bp DNA circular BCT 24-SEP-2008
DEFINITION Klebsiella pneumoniae 342, complete genome.
ACCESSION CP000964
VERSION CP000964.1 GI:206564770
PROJECT GenomeProject:28471
When viewed on the web in NCBI's Entrez:Nucleotide, the record's project
identifier (28471) links to an entry in the Genome Project Database (GPDB) :
http://www.ncbi.nlm.nih.gov/sites/entrez?db=genomeprj&cmd=Retrieve&dopt=Overview&uid=28471
where information about the sequencing center, the bacterium, and other
GenBank records (eg, plasmids) associated with the sequencing project
can be found.
Since the introduction of PROJECT, the scope of the "Genome Project"
Database has expanded, to include projects that are not necessarily targetted
to the sequencing of a complete genome.
In addition, there can be other resources which underlie an INSD sequence
record, such as the Trace Assembly Archive at the NCBI:
http://www.ncbi.nlm.nih.gov/Traces/assembly/assmbrowser.cgi?cmd=show&f=tree&m=main&s=tree
Because of the expanded scope of the GPDB, and because we anticipate a need
to link to more resources than just the GPDB, the PROJECT linetype is going to
be replaced by a new linetype:
DBLINK
With this release, the new DBLINK linetype is now legal for GenBank sequence
records, and it will begin to appear in GenBank Update files, soon after
GenBank 170.0 is made available.
The Genome Project ID and the Trace Assembly Archive ID will be presented
via DBLINK, and the existing PROJECT line will continue to be displayed, as
illustrated in the below mock-up of CP000964 :
LOCUS CP000964 5641239 bp DNA circular BCT 24-SEP-2008
DEFINITION Klebsiella pneumoniae 342, complete genome.
ACCESSION CP000964
VERSION CP000964.1 GI:206564770
PROJECT GenomeProject:28471
DBLINK Project:28471
Trace Assembly Archive:123456
....
COMMENT The source for the DNA and/or cells is: Professor Eric W.
Triplett, Chair, Department of Microbiology and Cell Science,
Institute of Food and Agricultural Sciences, University of Florida,
P.O. Box 110700, Gainesville, FL 32611-0700, [email protected].
Note: Use of the Trace Assembly Archive is still in its early stages, so only
a few records are expected to have that type of DBLINK in the short term.
For those who process sequence data in NCBI's ASN.1 format: The
underlying representation for (Genome) Project IDs will remain unchanged.
There will be no changes to the ASN.1 User-object that is used to store them:
user {
type
str "GenomeProjectsDB" ,
data {
{
label
str "ProjectID" ,
data
int 28471 } ,
{
label
str "ParentID" ,
data
int 0 } } } ,
However, to support linkages to other resources, such as the Trace
Assembly Archive, a new "DBLink" User-object will be introduced:
user {
type
str "DBLink" ,
data {
{
label
str "Trace Assembly Archive" ,
data
ints { 123456 } } } }
As new types of linkages are established, they will be added to
the DBLink User-object, and displayed via the DBLINK linetype in
the GenBank flatfile format.
There is a possibility that the GenomeProjectsDB User-object
might someday be incorporated into the new DBLink User-object.
But at the moment, there are no firm plans to do so.
1.3.3 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.4 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
sixty-nine of the GSS flatfiles in Release 170.0. Consider gbgss254.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
February 15 2009
NCBI-GenBank Flat File Release 170.0
GSS Sequences (Part 1)
87215 loci, 64322450 bases, from 87215 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "254" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 PROJECT linetype to be replaced by DBLINK (April 2009)
The new DBLINK linetype has been introduced as of the February 2009
GenBank Release 170.0.
Genome Project IDs and Trace Assembly Archive IDs can now be presented
via DBLINK, in conjunction with the legacy PROJECT linetype:
LOCUS CP000964 5641239 bp DNA circular BCT 24-SEP-2008
DEFINITION Klebsiella pneumoniae 342, complete genome.
ACCESSION CP000964
VERSION CP000964.1 GI:206564770
PROJECT GenomeProject:28471
DBLINK Project:28471
Trace Assembly Archive:123456
....
COMMENT The source for the DNA and/or cells is: Professor Eric W.
Triplett, Chair, Department of Microbiology and Cell Science,
Institute of Food and Agricultural Sciences, University of Florida,
P.O. Box 110700, Gainesville, FL 32611-0700, [email protected].
PROJECT and DBLINK will co-exist for one GenBank release, until Release 171.0
(April 15, 2009), at which point the PROJECT line will be removed from the
flatfile format. In its final state, the above mock-up for CP000964 becomes:
LOCUS CP000964 5641239 bp DNA circular BCT 24-SEP-2008
DEFINITION Klebsiella pneumoniae 342, complete genome.
ACCESSION CP000964
VERSION CP000964.1 GI:206564770
DBLINK Project:28471
Trace Assembly Archive:123456
....
COMMENT The source for the DNA and/or cells is: Professor Eric W.
Triplett, Chair, Department of Microbiology and Cell Science,
Institute of Food and Agricultural Sciences, University of Florida,
P.O. Box 110700, Gainesville, FL 32611-0700, [email protected].
In summary: The PROJECT linetype will be replaced by DBLINK as of GenBank
Release 171.0 in April 2009.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1812 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut7.idx - Index of the entries according to author name, part 7.
67. gbaut8.idx - Index of the entries according to author name, part 8.
68. gbaut9.idx - Index of the entries according to author name, part 9.
69. gbbct1.seq - Bacterial sequence entries, part 1.
70. gbbct10.seq - Bacterial sequence entries, part 10.
71. gbbct11.seq - Bacterial sequence entries, part 11.
72. gbbct12.seq - Bacterial sequence entries, part 12.
73. gbbct13.seq - Bacterial sequence entries, part 13.
74. gbbct14.seq - Bacterial sequence entries, part 14.
75. gbbct15.seq - Bacterial sequence entries, part 15.
76. gbbct16.seq - Bacterial sequence entries, part 16.
77. gbbct17.seq - Bacterial sequence entries, part 17.
78. gbbct18.seq - Bacterial sequence entries, part 18.
79. gbbct19.seq - Bacterial sequence entries, part 19.
80. gbbct2.seq - Bacterial sequence entries, part 2.
81. gbbct20.seq - Bacterial sequence entries, part 20.
82. gbbct21.seq - Bacterial sequence entries, part 21.
83. gbbct22.seq - Bacterial sequence entries, part 22.
84. gbbct23.seq - Bacterial sequence entries, part 23.
85. gbbct24.seq - Bacterial sequence entries, part 24.
86. gbbct25.seq - Bacterial sequence entries, part 25.
87. gbbct26.seq - Bacterial sequence entries, part 26.
88. gbbct27.seq - Bacterial sequence entries, part 27.
89. gbbct28.seq - Bacterial sequence entries, part 28.
90. gbbct29.seq - Bacterial sequence entries, part 29.
91. gbbct3.seq - Bacterial sequence entries, part 3.
92. gbbct30.seq - Bacterial sequence entries, part 30.
93. gbbct31.seq - Bacterial sequence entries, part 31.
94. gbbct32.seq - Bacterial sequence entries, part 32.
95. gbbct33.seq - Bacterial sequence entries, part 33.
96. gbbct34.seq - Bacterial sequence entries, part 34.
97. gbbct35.seq - Bacterial sequence entries, part 35.
98. gbbct36.seq - Bacterial sequence entries, part 36.
99. gbbct37.seq - Bacterial sequence entries, part 37.
100. gbbct38.seq - Bacterial sequence entries, part 38.
101. gbbct4.seq - Bacterial sequence entries, part 4.
102. gbbct5.seq - Bacterial sequence entries, part 5.
103. gbbct6.seq - Bacterial sequence entries, part 6.
104. gbbct7.seq - Bacterial sequence entries, part 7.
105. gbbct8.seq - Bacterial sequence entries, part 8.
106. gbbct9.seq - Bacterial sequence entries, part 9.
107. gbchg.txt - Accession numbers of entries updated since the previous release.
108. gbcon1.seq - Constructed sequence entries, part 1.
109. gbcon10.seq - Constructed sequence entries, part 10.
110. gbcon100.seq - Constructed sequence entries, part 100.
111. gbcon101.seq - Constructed sequence entries, part 101.
112. gbcon102.seq - Constructed sequence entries, part 102.
113. gbcon103.seq - Constructed sequence entries, part 103.
114. gbcon104.seq - Constructed sequence entries, part 104.
115. gbcon105.seq - Constructed sequence entries, part 105.
116. gbcon106.seq - Constructed sequence entries, part 106.
117. gbcon107.seq - Constructed sequence entries, part 107.
118. gbcon108.seq - Constructed sequence entries, part 108.
119. gbcon109.seq - Constructed sequence entries, part 109.
120. gbcon11.seq - Constructed sequence entries, part 11.
121. gbcon110.seq - Constructed sequence entries, part 110.
122. gbcon111.seq - Constructed sequence entries, part 111.
123. gbcon112.seq - Constructed sequence entries, part 112.
124. gbcon113.seq - Constructed sequence entries, part 113.
125. gbcon114.seq - Constructed sequence entries, part 114.
126. gbcon115.seq - Constructed sequence entries, part 115.
127. gbcon116.seq - Constructed sequence entries, part 116.
128. gbcon117.seq - Constructed sequence entries, part 117.
129. gbcon118.seq - Constructed sequence entries, part 118.
130. gbcon119.seq - Constructed sequence entries, part 119.
131. gbcon12.seq - Constructed sequence entries, part 12.
132. gbcon120.seq - Constructed sequence entries, part 120.
133. gbcon121.seq - Constructed sequence entries, part 121.
134. gbcon122.seq - Constructed sequence entries, part 122.
135. gbcon123.seq - Constructed sequence entries, part 123.
136. gbcon124.seq - Constructed sequence entries, part 124.
137. gbcon125.seq - Constructed sequence entries, part 125.
138. gbcon126.seq - Constructed sequence entries, part 126.
139. gbcon127.seq - Constructed sequence entries, part 127.
140. gbcon128.seq - Constructed sequence entries, part 128.
141. gbcon13.seq - Constructed sequence entries, part 13.
142. gbcon14.seq - Constructed sequence entries, part 14.
143. gbcon15.seq - Constructed sequence entries, part 15.
144. gbcon16.seq - Constructed sequence entries, part 16.
145. gbcon17.seq - Constructed sequence entries, part 17.
146. gbcon18.seq - Constructed sequence entries, part 18.
147. gbcon19.seq - Constructed sequence entries, part 19.
148. gbcon2.seq - Constructed sequence entries, part 2.
149. gbcon20.seq - Constructed sequence entries, part 20.
150. gbcon21.seq - Constructed sequence entries, part 21.
151. gbcon22.seq - Constructed sequence entries, part 22.
152. gbcon23.seq - Constructed sequence entries, part 23.
153. gbcon24.seq - Constructed sequence entries, part 24.
154. gbcon25.seq - Constructed sequence entries, part 25.
155. gbcon26.seq - Constructed sequence entries, part 26.
156. gbcon27.seq - Constructed sequence entries, part 27.
157. gbcon28.seq - Constructed sequence entries, part 28.
158. gbcon29.seq - Constructed sequence entries, part 29.
159. gbcon3.seq - Constructed sequence entries, part 3.
160. gbcon30.seq - Constructed sequence entries, part 30.
161. gbcon31.seq - Constructed sequence entries, part 31.
162. gbcon32.seq - Constructed sequence entries, part 32.
163. gbcon33.seq - Constructed sequence entries, part 33.
164. gbcon34.seq - Constructed sequence entries, part 34.
165. gbcon35.seq - Constructed sequence entries, part 35.
166. gbcon36.seq - Constructed sequence entries, part 36.
167. gbcon37.seq - Constructed sequence entries, part 37.
168. gbcon38.seq - Constructed sequence entries, part 38.
169. gbcon39.seq - Constructed sequence entries, part 39.
170. gbcon4.seq - Constructed sequence entries, part 4.
171. gbcon40.seq - Constructed sequence entries, part 40.
172. gbcon41.seq - Constructed sequence entries, part 41.
173. gbcon42.seq - Constructed sequence entries, part 42.
174. gbcon43.seq - Constructed sequence entries, part 43.
175. gbcon44.seq - Constructed sequence entries, part 44.
176. gbcon45.seq - Constructed sequence entries, part 45.
177. gbcon46.seq - Constructed sequence entries, part 46.
178. gbcon47.seq - Constructed sequence entries, part 47.
179. gbcon48.seq - Constructed sequence entries, part 48.
180. gbcon49.seq - Constructed sequence entries, part 49.
181. gbcon5.seq - Constructed sequence entries, part 5.
182. gbcon50.seq - Constructed sequence entries, part 50.
183. gbcon51.seq - Constructed sequence entries, part 51.
184. gbcon52.seq - Constructed sequence entries, part 52.
185. gbcon53.seq - Constructed sequence entries, part 53.
186. gbcon54.seq - Constructed sequence entries, part 54.
187. gbcon55.seq - Constructed sequence entries, part 55.
188. gbcon56.seq - Constructed sequence entries, part 56.
189. gbcon57.seq - Constructed sequence entries, part 57.
190. gbcon58.seq - Constructed sequence entries, part 58.
191. gbcon59.seq - Constructed sequence entries, part 59.
192. gbcon6.seq - Constructed sequence entries, part 6.
193. gbcon60.seq - Constructed sequence entries, part 60.
194. gbcon61.seq - Constructed sequence entries, part 61.
195. gbcon62.seq - Constructed sequence entries, part 62.
196. gbcon63.seq - Constructed sequence entries, part 63.
197. gbcon64.seq - Constructed sequence entries, part 64.
198. gbcon65.seq - Constructed sequence entries, part 65.
199. gbcon66.seq - Constructed sequence entries, part 66.
200. gbcon67.seq - Constructed sequence entries, part 67.
201. gbcon68.seq - Constructed sequence entries, part 68.
202. gbcon69.seq - Constructed sequence entries, part 69.
203. gbcon7.seq - Constructed sequence entries, part 7.
204. gbcon70.seq - Constructed sequence entries, part 70.
205. gbcon71.seq - Constructed sequence entries, part 71.
206. gbcon72.seq - Constructed sequence entries, part 72.
207. gbcon73.seq - Constructed sequence entries, part 73.
208. gbcon74.seq - Constructed sequence entries, part 74.
209. gbcon75.seq - Constructed sequence entries, part 75.
210. gbcon76.seq - Constructed sequence entries, part 76.
211. gbcon77.seq - Constructed sequence entries, part 77.
212. gbcon78.seq - Constructed sequence entries, part 78.
213. gbcon79.seq - Constructed sequence entries, part 79.
214. gbcon8.seq - Constructed sequence entries, part 8.
215. gbcon80.seq - Constructed sequence entries, part 80.
216. gbcon81.seq - Constructed sequence entries, part 81.
217. gbcon82.seq - Constructed sequence entries, part 82.
218. gbcon83.seq - Constructed sequence entries, part 83.
219. gbcon84.seq - Constructed sequence entries, part 84.
220. gbcon85.seq - Constructed sequence entries, part 85.
221. gbcon86.seq - Constructed sequence entries, part 86.
222. gbcon87.seq - Constructed sequence entries, part 87.
223. gbcon88.seq - Constructed sequence entries, part 88.
224. gbcon89.seq - Constructed sequence entries, part 89.
225. gbcon9.seq - Constructed sequence entries, part 9.
226. gbcon90.seq - Constructed sequence entries, part 90.
227. gbcon91.seq - Constructed sequence entries, part 91.
228. gbcon92.seq - Constructed sequence entries, part 92.
229. gbcon93.seq - Constructed sequence entries, part 93.
230. gbcon94.seq - Constructed sequence entries, part 94.
231. gbcon95.seq - Constructed sequence entries, part 95.
232. gbcon96.seq - Constructed sequence entries, part 96.
233. gbcon97.seq - Constructed sequence entries, part 97.
234. gbcon98.seq - Constructed sequence entries, part 98.
235. gbcon99.seq - Constructed sequence entries, part 99.
236. gbdel.txt - Accession numbers of entries deleted since the previous release.
237. gbenv1.seq - Environmental sampling sequence entries, part 1.
238. gbenv10.seq - Environmental sampling sequence entries, part 10.
239. gbenv11.seq - Environmental sampling sequence entries, part 11.
240. gbenv12.seq - Environmental sampling sequence entries, part 12.
241. gbenv2.seq - Environmental sampling sequence entries, part 2.
242. gbenv3.seq - Environmental sampling sequence entries, part 3.
243. gbenv4.seq - Environmental sampling sequence entries, part 4.
244. gbenv5.seq - Environmental sampling sequence entries, part 5.
245. gbenv6.seq - Environmental sampling sequence entries, part 6.
246. gbenv7.seq - Environmental sampling sequence entries, part 7.
247. gbenv8.seq - Environmental sampling sequence entries, part 8.
248. gbenv9.seq - Environmental sampling sequence entries, part 9.
249. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
250. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
251. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
252. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
253. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
254. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
255. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
256. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
257. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
258. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
259. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
260. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
261. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
262. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
263. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
264. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
265. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
266. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
267. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
268. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
269. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
270. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
271. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
272. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
273. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
274. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
275. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
276. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
277. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
278. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
279. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
280. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
281. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
282. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
283. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
284. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
285. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
286. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
287. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
288. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
289. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
290. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
291. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
292. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
293. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
294. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
295. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
296. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
297. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
298. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
299. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
300. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
301. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
302. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
303. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
304. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
305. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
306. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
307. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
308. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
309. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
310. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
311. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
312. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
313. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
314. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
315. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
316. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
317. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
318. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
319. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
320. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
321. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
322. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
323. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
324. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
325. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
326. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
327. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
328. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
329. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
330. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
331. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
332. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
333. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
334. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
335. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
336. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
337. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
338. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
339. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
340. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
341. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
342. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
343. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
344. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
345. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
346. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
347. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
348. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
349. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
350. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
351. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
352. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
353. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
354. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
355. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
356. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
357. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
358. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
359. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
360. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
361. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
362. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
363. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
364. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
365. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
366. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
367. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
368. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
369. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
370. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
371. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
372. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
373. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
374. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
375. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
376. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
377. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
378. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
379. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
380. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
381. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
382. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
383. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
384. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
385. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
386. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
387. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
388. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
389. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
390. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
391. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
392. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
393. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
394. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
395. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
396. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
397. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
398. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
399. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
400. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
401. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
402. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
403. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
404. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
405. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
406. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
407. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
408. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
409. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
410. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
411. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
412. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
413. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
414. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
415. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
416. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
417. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
418. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
419. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
420. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
421. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
422. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
423. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
424. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
425. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
426. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
427. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
428. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
429. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
430. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
431. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
432. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
433. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
434. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
435. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
436. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
437. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
438. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
439. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
440. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
441. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
442. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
443. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
444. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
445. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
446. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
447. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
448. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
449. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
450. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
451. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
452. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
453. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
454. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
455. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
456. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
457. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
458. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
459. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
460. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
461. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
462. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
463. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
464. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
465. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
466. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
467. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
468. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
469. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
470. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
471. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
472. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
473. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
474. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
475. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
476. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
477. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
478. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
479. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
480. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
481. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
482. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
483. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
484. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
485. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
486. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
487. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
488. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
489. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
490. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
491. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
492. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
493. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
494. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
495. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
496. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
497. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
498. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
499. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
500. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
501. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
502. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
503. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
504. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
505. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
506. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
507. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
508. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
509. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
510. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
511. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
512. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
513. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
514. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
515. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
516. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
517. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
518. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
519. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
520. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
521. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
522. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
523. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
524. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
525. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
526. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
527. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
528. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
529. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
530. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
531. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
532. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
533. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
534. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
535. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
536. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
537. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
538. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
539. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
540. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
541. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
542. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
543. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
544. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
545. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
546. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
547. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
548. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
549. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
550. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
551. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
552. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
553. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
554. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
555. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
556. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
557. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
558. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
559. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
560. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
561. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
562. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
563. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
564. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
565. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
566. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
567. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
568. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
569. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
570. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
571. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
572. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
573. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
574. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
575. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
576. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
577. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
578. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
579. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
580. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
581. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
582. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
583. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
584. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
585. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
586. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
587. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
588. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
589. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
590. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
591. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
592. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
593. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
594. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
595. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
596. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
597. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
598. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
599. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
600. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
601. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
602. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
603. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
604. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
605. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
606. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
607. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
608. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
609. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
610. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
611. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
612. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
613. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
614. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
615. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
616. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
617. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
618. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
619. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
620. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
621. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
622. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
623. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
624. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
625. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
626. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
627. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
628. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
629. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
630. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
631. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
632. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
633. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
634. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
635. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
636. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
637. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
638. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
639. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
640. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
641. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
642. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
643. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
644. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
645. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
646. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
647. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
648. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
649. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
650. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
651. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
652. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
653. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
654. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
655. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
656. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
657. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
658. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
659. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
660. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
661. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
662. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
663. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
664. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
665. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
666. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
667. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
668. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
669. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
670. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
671. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
672. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
673. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
674. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
675. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
676. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
677. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
678. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
679. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
680. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
681. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
682. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
683. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
684. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
685. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
686. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
687. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
688. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
689. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
690. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
691. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
692. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
693. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
694. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
695. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
696. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
697. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
698. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
699. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
700. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
701. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
702. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
703. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
704. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
705. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
706. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
707. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
708. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
709. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
710. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
711. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
712. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
713. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
714. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
715. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
716. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
717. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
718. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
719. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
720. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
721. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
722. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
723. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
724. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
725. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
726. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
727. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
728. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
729. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
730. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
731. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
732. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
733. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
734. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
735. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
736. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
737. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
738. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
739. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
740. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
741. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
742. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
743. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
744. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
745. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
746. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
747. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
748. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
749. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
750. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
751. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
752. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
753. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
754. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
755. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
756. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
757. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
758. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
759. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
760. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
761. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
762. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
763. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
764. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
765. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
766. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
767. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
768. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
769. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
770. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
771. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
772. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
773. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
774. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
775. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
776. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
777. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
778. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
779. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
780. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
781. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
782. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
783. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
784. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
785. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
786. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
787. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
788. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
789. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
790. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
791. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
792. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
793. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
794. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
795. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
796. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
797. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
798. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
799. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
800. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
801. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
802. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
803. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
804. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
805. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
806. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
807. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
808. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
809. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
810. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
811. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
812. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
813. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
814. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
815. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
816. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
817. gbest610.seq - EST (expressed sequence tag) sequence entries, part 610.
818. gbest611.seq - EST (expressed sequence tag) sequence entries, part 611.
819. gbest612.seq - EST (expressed sequence tag) sequence entries, part 612.
820. gbest613.seq - EST (expressed sequence tag) sequence entries, part 613.
821. gbest614.seq - EST (expressed sequence tag) sequence entries, part 614.
822. gbest615.seq - EST (expressed sequence tag) sequence entries, part 615.
823. gbest616.seq - EST (expressed sequence tag) sequence entries, part 616.
824. gbest617.seq - EST (expressed sequence tag) sequence entries, part 617.
825. gbest618.seq - EST (expressed sequence tag) sequence entries, part 618.
826. gbest619.seq - EST (expressed sequence tag) sequence entries, part 619.
827. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
828. gbest620.seq - EST (expressed sequence tag) sequence entries, part 620.
829. gbest621.seq - EST (expressed sequence tag) sequence entries, part 621.
830. gbest622.seq - EST (expressed sequence tag) sequence entries, part 622.
831. gbest623.seq - EST (expressed sequence tag) sequence entries, part 623.
832. gbest624.seq - EST (expressed sequence tag) sequence entries, part 624.
833. gbest625.seq - EST (expressed sequence tag) sequence entries, part 625.
834. gbest626.seq - EST (expressed sequence tag) sequence entries, part 626.
835. gbest627.seq - EST (expressed sequence tag) sequence entries, part 627.
836. gbest628.seq - EST (expressed sequence tag) sequence entries, part 628.
837. gbest629.seq - EST (expressed sequence tag) sequence entries, part 629.
838. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
839. gbest630.seq - EST (expressed sequence tag) sequence entries, part 630.
840. gbest631.seq - EST (expressed sequence tag) sequence entries, part 631.
841. gbest632.seq - EST (expressed sequence tag) sequence entries, part 632.
842. gbest633.seq - EST (expressed sequence tag) sequence entries, part 633.
843. gbest634.seq - EST (expressed sequence tag) sequence entries, part 634.
844. gbest635.seq - EST (expressed sequence tag) sequence entries, part 635.
845. gbest636.seq - EST (expressed sequence tag) sequence entries, part 636.
846. gbest637.seq - EST (expressed sequence tag) sequence entries, part 637.
847. gbest638.seq - EST (expressed sequence tag) sequence entries, part 638.
848. gbest639.seq - EST (expressed sequence tag) sequence entries, part 639.
849. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
850. gbest640.seq - EST (expressed sequence tag) sequence entries, part 640.
851. gbest641.seq - EST (expressed sequence tag) sequence entries, part 641.
852. gbest642.seq - EST (expressed sequence tag) sequence entries, part 642.
853. gbest643.seq - EST (expressed sequence tag) sequence entries, part 643.
854. gbest644.seq - EST (expressed sequence tag) sequence entries, part 644.
855. gbest645.seq - EST (expressed sequence tag) sequence entries, part 645.
856. gbest646.seq - EST (expressed sequence tag) sequence entries, part 646.
857. gbest647.seq - EST (expressed sequence tag) sequence entries, part 647.
858. gbest648.seq - EST (expressed sequence tag) sequence entries, part 648.
859. gbest649.seq - EST (expressed sequence tag) sequence entries, part 649.
860. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
861. gbest650.seq - EST (expressed sequence tag) sequence entries, part 650.
862. gbest651.seq - EST (expressed sequence tag) sequence entries, part 651.
863. gbest652.seq - EST (expressed sequence tag) sequence entries, part 652.
864. gbest653.seq - EST (expressed sequence tag) sequence entries, part 653.
865. gbest654.seq - EST (expressed sequence tag) sequence entries, part 654.
866. gbest655.seq - EST (expressed sequence tag) sequence entries, part 655.
867. gbest656.seq - EST (expressed sequence tag) sequence entries, part 656.
868. gbest657.seq - EST (expressed sequence tag) sequence entries, part 657.
869. gbest658.seq - EST (expressed sequence tag) sequence entries, part 658.
870. gbest659.seq - EST (expressed sequence tag) sequence entries, part 659.
871. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
872. gbest660.seq - EST (expressed sequence tag) sequence entries, part 660.
873. gbest661.seq - EST (expressed sequence tag) sequence entries, part 661.
874. gbest662.seq - EST (expressed sequence tag) sequence entries, part 662.
875. gbest663.seq - EST (expressed sequence tag) sequence entries, part 663.
876. gbest664.seq - EST (expressed sequence tag) sequence entries, part 664.
877. gbest665.seq - EST (expressed sequence tag) sequence entries, part 665.
878. gbest666.seq - EST (expressed sequence tag) sequence entries, part 666.
879. gbest667.seq - EST (expressed sequence tag) sequence entries, part 667.
880. gbest668.seq - EST (expressed sequence tag) sequence entries, part 668.
881. gbest669.seq - EST (expressed sequence tag) sequence entries, part 669.
882. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
883. gbest670.seq - EST (expressed sequence tag) sequence entries, part 670.
884. gbest671.seq - EST (expressed sequence tag) sequence entries, part 671.
885. gbest672.seq - EST (expressed sequence tag) sequence entries, part 672.
886. gbest673.seq - EST (expressed sequence tag) sequence entries, part 673.
887. gbest674.seq - EST (expressed sequence tag) sequence entries, part 674.
888. gbest675.seq - EST (expressed sequence tag) sequence entries, part 675.
889. gbest676.seq - EST (expressed sequence tag) sequence entries, part 676.
890. gbest677.seq - EST (expressed sequence tag) sequence entries, part 677.
891. gbest678.seq - EST (expressed sequence tag) sequence entries, part 678.
892. gbest679.seq - EST (expressed sequence tag) sequence entries, part 679.
893. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
894. gbest680.seq - EST (expressed sequence tag) sequence entries, part 680.
895. gbest681.seq - EST (expressed sequence tag) sequence entries, part 681.
896. gbest682.seq - EST (expressed sequence tag) sequence entries, part 682.
897. gbest683.seq - EST (expressed sequence tag) sequence entries, part 683.
898. gbest684.seq - EST (expressed sequence tag) sequence entries, part 684.
899. gbest685.seq - EST (expressed sequence tag) sequence entries, part 685.
900. gbest686.seq - EST (expressed sequence tag) sequence entries, part 686.
901. gbest687.seq - EST (expressed sequence tag) sequence entries, part 687.
902. gbest688.seq - EST (expressed sequence tag) sequence entries, part 688.
903. gbest689.seq - EST (expressed sequence tag) sequence entries, part 689.
904. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
905. gbest690.seq - EST (expressed sequence tag) sequence entries, part 690.
906. gbest691.seq - EST (expressed sequence tag) sequence entries, part 691.
907. gbest692.seq - EST (expressed sequence tag) sequence entries, part 692.
908. gbest693.seq - EST (expressed sequence tag) sequence entries, part 693.
909. gbest694.seq - EST (expressed sequence tag) sequence entries, part 694.
910. gbest695.seq - EST (expressed sequence tag) sequence entries, part 695.
911. gbest696.seq - EST (expressed sequence tag) sequence entries, part 696.
912. gbest697.seq - EST (expressed sequence tag) sequence entries, part 697.
913. gbest698.seq - EST (expressed sequence tag) sequence entries, part 698.
914. gbest699.seq - EST (expressed sequence tag) sequence entries, part 699.
915. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
916. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
917. gbest700.seq - EST (expressed sequence tag) sequence entries, part 700.
918. gbest701.seq - EST (expressed sequence tag) sequence entries, part 701.
919. gbest702.seq - EST (expressed sequence tag) sequence entries, part 702.
920. gbest703.seq - EST (expressed sequence tag) sequence entries, part 703.
921. gbest704.seq - EST (expressed sequence tag) sequence entries, part 704.
922. gbest705.seq - EST (expressed sequence tag) sequence entries, part 705.
923. gbest706.seq - EST (expressed sequence tag) sequence entries, part 706.
924. gbest707.seq - EST (expressed sequence tag) sequence entries, part 707.
925. gbest708.seq - EST (expressed sequence tag) sequence entries, part 708.
926. gbest709.seq - EST (expressed sequence tag) sequence entries, part 709.
927. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
928. gbest710.seq - EST (expressed sequence tag) sequence entries, part 710.
929. gbest711.seq - EST (expressed sequence tag) sequence entries, part 711.
930. gbest712.seq - EST (expressed sequence tag) sequence entries, part 712.
931. gbest713.seq - EST (expressed sequence tag) sequence entries, part 713.
932. gbest714.seq - EST (expressed sequence tag) sequence entries, part 714.
933. gbest715.seq - EST (expressed sequence tag) sequence entries, part 715.
934. gbest716.seq - EST (expressed sequence tag) sequence entries, part 716.
935. gbest717.seq - EST (expressed sequence tag) sequence entries, part 717.
936. gbest718.seq - EST (expressed sequence tag) sequence entries, part 718.
937. gbest719.seq - EST (expressed sequence tag) sequence entries, part 719.
938. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
939. gbest720.seq - EST (expressed sequence tag) sequence entries, part 720.
940. gbest721.seq - EST (expressed sequence tag) sequence entries, part 721.
941. gbest722.seq - EST (expressed sequence tag) sequence entries, part 722.
942. gbest723.seq - EST (expressed sequence tag) sequence entries, part 723.
943. gbest724.seq - EST (expressed sequence tag) sequence entries, part 724.
944. gbest725.seq - EST (expressed sequence tag) sequence entries, part 725.
945. gbest726.seq - EST (expressed sequence tag) sequence entries, part 726.
946. gbest727.seq - EST (expressed sequence tag) sequence entries, part 727.
947. gbest728.seq - EST (expressed sequence tag) sequence entries, part 728.
948. gbest729.seq - EST (expressed sequence tag) sequence entries, part 729.
949. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
950. gbest730.seq - EST (expressed sequence tag) sequence entries, part 730.
951. gbest731.seq - EST (expressed sequence tag) sequence entries, part 731.
952. gbest732.seq - EST (expressed sequence tag) sequence entries, part 732.
953. gbest733.seq - EST (expressed sequence tag) sequence entries, part 733.
954. gbest734.seq - EST (expressed sequence tag) sequence entries, part 734.
955. gbest735.seq - EST (expressed sequence tag) sequence entries, part 735.
956. gbest736.seq - EST (expressed sequence tag) sequence entries, part 736.
957. gbest737.seq - EST (expressed sequence tag) sequence entries, part 737.
958. gbest738.seq - EST (expressed sequence tag) sequence entries, part 738.
959. gbest739.seq - EST (expressed sequence tag) sequence entries, part 739.
960. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
961. gbest740.seq - EST (expressed sequence tag) sequence entries, part 740.
962. gbest741.seq - EST (expressed sequence tag) sequence entries, part 741.
963. gbest742.seq - EST (expressed sequence tag) sequence entries, part 742.
964. gbest743.seq - EST (expressed sequence tag) sequence entries, part 743.
965. gbest744.seq - EST (expressed sequence tag) sequence entries, part 744.
966. gbest745.seq - EST (expressed sequence tag) sequence entries, part 745.
967. gbest746.seq - EST (expressed sequence tag) sequence entries, part 746.
968. gbest747.seq - EST (expressed sequence tag) sequence entries, part 747.
969. gbest748.seq - EST (expressed sequence tag) sequence entries, part 748.
970. gbest749.seq - EST (expressed sequence tag) sequence entries, part 749.
971. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
972. gbest750.seq - EST (expressed sequence tag) sequence entries, part 750.
973. gbest751.seq - EST (expressed sequence tag) sequence entries, part 751.
974. gbest752.seq - EST (expressed sequence tag) sequence entries, part 752.
975. gbest753.seq - EST (expressed sequence tag) sequence entries, part 753.
976. gbest754.seq - EST (expressed sequence tag) sequence entries, part 754.
977. gbest755.seq - EST (expressed sequence tag) sequence entries, part 755.
978. gbest756.seq - EST (expressed sequence tag) sequence entries, part 756.
979. gbest757.seq - EST (expressed sequence tag) sequence entries, part 757.
980. gbest758.seq - EST (expressed sequence tag) sequence entries, part 758.
981. gbest759.seq - EST (expressed sequence tag) sequence entries, part 759.
982. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
983. gbest760.seq - EST (expressed sequence tag) sequence entries, part 760.
984. gbest761.seq - EST (expressed sequence tag) sequence entries, part 761.
985. gbest762.seq - EST (expressed sequence tag) sequence entries, part 762.
986. gbest763.seq - EST (expressed sequence tag) sequence entries, part 763.
987. gbest764.seq - EST (expressed sequence tag) sequence entries, part 764.
988. gbest765.seq - EST (expressed sequence tag) sequence entries, part 765.
989. gbest766.seq - EST (expressed sequence tag) sequence entries, part 766.
990. gbest767.seq - EST (expressed sequence tag) sequence entries, part 767.
991. gbest768.seq - EST (expressed sequence tag) sequence entries, part 768.
992. gbest769.seq - EST (expressed sequence tag) sequence entries, part 769.
993. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
994. gbest770.seq - EST (expressed sequence tag) sequence entries, part 770.
995. gbest771.seq - EST (expressed sequence tag) sequence entries, part 771.
996. gbest772.seq - EST (expressed sequence tag) sequence entries, part 772.
997. gbest773.seq - EST (expressed sequence tag) sequence entries, part 773.
998. gbest774.seq - EST (expressed sequence tag) sequence entries, part 774.
999. gbest775.seq - EST (expressed sequence tag) sequence entries, part 775.
1000. gbest776.seq - EST (expressed sequence tag) sequence entries, part 776.
1001. gbest777.seq - EST (expressed sequence tag) sequence entries, part 777.
1002. gbest778.seq - EST (expressed sequence tag) sequence entries, part 778.
1003. gbest779.seq - EST (expressed sequence tag) sequence entries, part 779.
1004. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1005. gbest780.seq - EST (expressed sequence tag) sequence entries, part 780.
1006. gbest781.seq - EST (expressed sequence tag) sequence entries, part 781.
1007. gbest782.seq - EST (expressed sequence tag) sequence entries, part 782.
1008. gbest783.seq - EST (expressed sequence tag) sequence entries, part 783.
1009. gbest784.seq - EST (expressed sequence tag) sequence entries, part 784.
1010. gbest785.seq - EST (expressed sequence tag) sequence entries, part 785.
1011. gbest786.seq - EST (expressed sequence tag) sequence entries, part 786.
1012. gbest787.seq - EST (expressed sequence tag) sequence entries, part 787.
1013. gbest788.seq - EST (expressed sequence tag) sequence entries, part 788.
1014. gbest789.seq - EST (expressed sequence tag) sequence entries, part 789.
1015. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1016. gbest790.seq - EST (expressed sequence tag) sequence entries, part 790.
1017. gbest791.seq - EST (expressed sequence tag) sequence entries, part 791.
1018. gbest792.seq - EST (expressed sequence tag) sequence entries, part 792.
1019. gbest793.seq - EST (expressed sequence tag) sequence entries, part 793.
1020. gbest794.seq - EST (expressed sequence tag) sequence entries, part 794.
1021. gbest795.seq - EST (expressed sequence tag) sequence entries, part 795.
1022. gbest796.seq - EST (expressed sequence tag) sequence entries, part 796.
1023. gbest797.seq - EST (expressed sequence tag) sequence entries, part 797.
1024. gbest798.seq - EST (expressed sequence tag) sequence entries, part 798.
1025. gbest799.seq - EST (expressed sequence tag) sequence entries, part 799.
1026. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1027. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1028. gbest800.seq - EST (expressed sequence tag) sequence entries, part 800.
1029. gbest801.seq - EST (expressed sequence tag) sequence entries, part 801.
1030. gbest802.seq - EST (expressed sequence tag) sequence entries, part 802.
1031. gbest803.seq - EST (expressed sequence tag) sequence entries, part 803.
1032. gbest804.seq - EST (expressed sequence tag) sequence entries, part 804.
1033. gbest805.seq - EST (expressed sequence tag) sequence entries, part 805.
1034. gbest806.seq - EST (expressed sequence tag) sequence entries, part 806.
1035. gbest807.seq - EST (expressed sequence tag) sequence entries, part 807.
1036. gbest808.seq - EST (expressed sequence tag) sequence entries, part 808.
1037. gbest809.seq - EST (expressed sequence tag) sequence entries, part 809.
1038. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1039. gbest810.seq - EST (expressed sequence tag) sequence entries, part 810.
1040. gbest811.seq - EST (expressed sequence tag) sequence entries, part 811.
1041. gbest812.seq - EST (expressed sequence tag) sequence entries, part 812.
1042. gbest813.seq - EST (expressed sequence tag) sequence entries, part 813.
1043. gbest814.seq - EST (expressed sequence tag) sequence entries, part 814.
1044. gbest815.seq - EST (expressed sequence tag) sequence entries, part 815.
1045. gbest816.seq - EST (expressed sequence tag) sequence entries, part 816.
1046. gbest817.seq - EST (expressed sequence tag) sequence entries, part 817.
1047. gbest818.seq - EST (expressed sequence tag) sequence entries, part 818.
1048. gbest819.seq - EST (expressed sequence tag) sequence entries, part 819.
1049. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1050. gbest820.seq - EST (expressed sequence tag) sequence entries, part 820.
1051. gbest821.seq - EST (expressed sequence tag) sequence entries, part 821.
1052. gbest822.seq - EST (expressed sequence tag) sequence entries, part 822.
1053. gbest823.seq - EST (expressed sequence tag) sequence entries, part 823.
1054. gbest824.seq - EST (expressed sequence tag) sequence entries, part 824.
1055. gbest825.seq - EST (expressed sequence tag) sequence entries, part 825.
1056. gbest826.seq - EST (expressed sequence tag) sequence entries, part 826.
1057. gbest827.seq - EST (expressed sequence tag) sequence entries, part 827.
1058. gbest828.seq - EST (expressed sequence tag) sequence entries, part 828.
1059. gbest829.seq - EST (expressed sequence tag) sequence entries, part 829.
1060. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1061. gbest830.seq - EST (expressed sequence tag) sequence entries, part 830.
1062. gbest831.seq - EST (expressed sequence tag) sequence entries, part 831.
1063. gbest832.seq - EST (expressed sequence tag) sequence entries, part 832.
1064. gbest833.seq - EST (expressed sequence tag) sequence entries, part 833.
1065. gbest834.seq - EST (expressed sequence tag) sequence entries, part 834.
1066. gbest835.seq - EST (expressed sequence tag) sequence entries, part 835.
1067. gbest836.seq - EST (expressed sequence tag) sequence entries, part 836.
1068. gbest837.seq - EST (expressed sequence tag) sequence entries, part 837.
1069. gbest838.seq - EST (expressed sequence tag) sequence entries, part 838.
1070. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1071. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1072. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1073. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1074. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1075. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1076. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1077. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1078. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1079. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1080. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1081. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1082. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1083. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1084. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1085. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1086. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1087. gbgen.idx - Index of the entries according to gene symbols.
1088. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1089. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1090. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1091. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1092. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1093. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1094. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1095. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1096. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1097. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1098. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1099. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1100. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1101. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1102. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1103. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1104. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1105. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1106. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1107. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1108. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1109. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1110. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1111. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1112. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1113. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1114. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1115. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1116. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1117. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1118. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1119. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1120. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1121. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1122. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1123. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1124. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1125. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1126. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1127. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1128. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1129. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1130. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1131. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1132. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1133. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1134. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1135. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1136. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1137. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1138. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1139. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1140. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1141. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1142. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1143. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1144. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1145. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1146. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1147. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1148. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1149. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1150. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1151. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1152. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1153. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1154. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1155. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1156. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1157. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1158. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1159. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1160. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1161. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1162. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1163. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1164. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1165. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1166. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1167. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1168. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1169. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1170. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1171. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1172. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1173. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1174. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1175. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1176. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1177. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1178. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1179. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1180. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1181. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1182. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1183. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1184. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1185. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1186. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1187. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1188. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1189. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1190. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1191. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1192. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1193. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1194. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1195. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1196. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1197. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1198. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1199. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1200. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1201. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1202. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1203. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1204. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1205. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1206. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1207. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1208. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1209. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1210. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1211. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1212. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1213. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1214. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1215. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1216. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1217. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1218. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1219. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1220. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1221. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1222. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1223. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1224. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1225. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1226. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1227. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1228. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1229. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1230. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1231. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1232. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1233. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1234. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1235. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1236. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1237. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1238. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1239. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1240. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1241. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1242. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1243. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1244. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1245. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1246. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1247. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1248. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1249. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1250. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1251. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1252. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1253. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1254. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1255. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1256. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1257. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1258. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1259. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1260. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1261. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1262. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1263. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1264. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1265. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1266. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1267. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1268. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1269. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1270. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1271. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1272. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1273. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1274. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1275. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1276. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1277. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1278. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1279. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1280. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1281. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1282. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1283. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1284. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1285. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1286. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1287. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1288. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1289. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1290. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1291. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1292. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1293. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1294. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1295. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1296. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1297. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1298. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1299. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1300. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1301. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1302. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1303. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1304. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1305. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1306. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1307. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1308. gbgss298.seq - GSS (genome survey sequence) sequence entries, part 298.
1309. gbgss299.seq - GSS (genome survey sequence) sequence entries, part 299.
1310. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1311. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1312. gbgss300.seq - GSS (genome survey sequence) sequence entries, part 300.
1313. gbgss301.seq - GSS (genome survey sequence) sequence entries, part 301.
1314. gbgss302.seq - GSS (genome survey sequence) sequence entries, part 302.
1315. gbgss303.seq - GSS (genome survey sequence) sequence entries, part 303.
1316. gbgss304.seq - GSS (genome survey sequence) sequence entries, part 304.
1317. gbgss305.seq - GSS (genome survey sequence) sequence entries, part 305.
1318. gbgss306.seq - GSS (genome survey sequence) sequence entries, part 306.
1319. gbgss307.seq - GSS (genome survey sequence) sequence entries, part 307.
1320. gbgss308.seq - GSS (genome survey sequence) sequence entries, part 308.
1321. gbgss309.seq - GSS (genome survey sequence) sequence entries, part 309.
1322. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1323. gbgss310.seq - GSS (genome survey sequence) sequence entries, part 310.
1324. gbgss311.seq - GSS (genome survey sequence) sequence entries, part 311.
1325. gbgss312.seq - GSS (genome survey sequence) sequence entries, part 312.
1326. gbgss313.seq - GSS (genome survey sequence) sequence entries, part 313.
1327. gbgss314.seq - GSS (genome survey sequence) sequence entries, part 314.
1328. gbgss315.seq - GSS (genome survey sequence) sequence entries, part 315.
1329. gbgss316.seq - GSS (genome survey sequence) sequence entries, part 316.
1330. gbgss317.seq - GSS (genome survey sequence) sequence entries, part 317.
1331. gbgss318.seq - GSS (genome survey sequence) sequence entries, part 318.
1332. gbgss319.seq - GSS (genome survey sequence) sequence entries, part 319.
1333. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1334. gbgss320.seq - GSS (genome survey sequence) sequence entries, part 320.
1335. gbgss321.seq - GSS (genome survey sequence) sequence entries, part 321.
1336. gbgss322.seq - GSS (genome survey sequence) sequence entries, part 322.
1337. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1338. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1339. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1340. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1341. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1342. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1343. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1344. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1345. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1346. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1347. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1348. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1349. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1350. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1351. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1352. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1353. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1354. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1355. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1356. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1357. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1358. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1359. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1360. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1361. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1362. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1363. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1364. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1365. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1366. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1367. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1368. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1369. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1370. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1371. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1372. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1373. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1374. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1375. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1376. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1377. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1378. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1379. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1380. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1381. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1382. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1383. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1384. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1385. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1386. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1387. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1388. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1389. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1390. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1391. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1392. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1393. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1394. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1395. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1396. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1397. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1398. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1399. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1400. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1401. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1402. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1403. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1404. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1405. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1406. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1407. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1408. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1409. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1410. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1411. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1412. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1413. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1414. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1415. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1416. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1417. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1418. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1419. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1420. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1421. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1422. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1423. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1424. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1425. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1426. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1427. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1428. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1429. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1430. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1431. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1432. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1433. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1434. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1435. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1436. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1437. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1438. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1439. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1440. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1441. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1442. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1443. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1444. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1445. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1446. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1447. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1448. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1449. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1450. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1451. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1452. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1453. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1454. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1455. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1456. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1457. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1458. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1459. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1460. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1461. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1462. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1463. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1464. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1465. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1466. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1467. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1468. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1469. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1470. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1471. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1472. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1473. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1474. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1475. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1476. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1477. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1478. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1479. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1480. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1481. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1482. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1483. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1484. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1485. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1486. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1487. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1488. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1489. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1490. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1491. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1492. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1493. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1494. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1495. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1496. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1497. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1498. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1499. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1500. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1501. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1502. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1503. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1504. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1505. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1506. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1507. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1508. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1509. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1510. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1511. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1512. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1513. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1514. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1515. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1516. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1517. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1518. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1519. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1520. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1521. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1522. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1523. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1524. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1525. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1526. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1527. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1528. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1529. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1530. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1531. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1532. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1533. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1534. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1535. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1536. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1537. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1538. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1539. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1540. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1541. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1542. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1543. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1544. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1545. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1546. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1547. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1548. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1549. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1550. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1551. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1552. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1553. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1554. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1555. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1556. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1557. gbinv1.seq - Invertebrate sequence entries, part 1.
1558. gbinv10.seq - Invertebrate sequence entries, part 10.
1559. gbinv11.seq - Invertebrate sequence entries, part 11.
1560. gbinv12.seq - Invertebrate sequence entries, part 12.
1561. gbinv13.seq - Invertebrate sequence entries, part 13.
1562. gbinv14.seq - Invertebrate sequence entries, part 14.
1563. gbinv2.seq - Invertebrate sequence entries, part 2.
1564. gbinv3.seq - Invertebrate sequence entries, part 3.
1565. gbinv4.seq - Invertebrate sequence entries, part 4.
1566. gbinv5.seq - Invertebrate sequence entries, part 5.
1567. gbinv6.seq - Invertebrate sequence entries, part 6.
1568. gbinv7.seq - Invertebrate sequence entries, part 7.
1569. gbinv8.seq - Invertebrate sequence entries, part 8.
1570. gbinv9.seq - Invertebrate sequence entries, part 9.
1571. gbjou1.idx - Index of the entries according to journal citation, part 1.
1572. gbjou2.idx - Index of the entries according to journal citation, part 2.
1573. gbjou3.idx - Index of the entries according to journal citation, part 3.
1574. gbjou4.idx - Index of the entries according to journal citation, part 4.
1575. gbjou5.idx - Index of the entries according to journal citation, part 5.
1576. gbjou6.idx - Index of the entries according to journal citation, part 6.
1577. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1578. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1579. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1580. gbmam1.seq - Other mammalian sequence entries, part 1.
1581. gbmam2.seq - Other mammalian sequence entries, part 2.
1582. gbmam3.seq - Other mammalian sequence entries, part 3.
1583. gbmam4.seq - Other mammalian sequence entries, part 4.
1584. gbnew.txt - Accession numbers of entries new since the previous release.
1585. gbpat1.seq - Patent sequence entries, part 1.
1586. gbpat10.seq - Patent sequence entries, part 10.
1587. gbpat11.seq - Patent sequence entries, part 11.
1588. gbpat12.seq - Patent sequence entries, part 12.
1589. gbpat13.seq - Patent sequence entries, part 13.
1590. gbpat14.seq - Patent sequence entries, part 14.
1591. gbpat15.seq - Patent sequence entries, part 15.
1592. gbpat16.seq - Patent sequence entries, part 16.
1593. gbpat17.seq - Patent sequence entries, part 17.
1594. gbpat18.seq - Patent sequence entries, part 18.
1595. gbpat19.seq - Patent sequence entries, part 19.
1596. gbpat2.seq - Patent sequence entries, part 2.
1597. gbpat20.seq - Patent sequence entries, part 20.
1598. gbpat21.seq - Patent sequence entries, part 21.
1599. gbpat22.seq - Patent sequence entries, part 22.
1600. gbpat23.seq - Patent sequence entries, part 23.
1601. gbpat24.seq - Patent sequence entries, part 24.
1602. gbpat25.seq - Patent sequence entries, part 25.
1603. gbpat26.seq - Patent sequence entries, part 26.
1604. gbpat27.seq - Patent sequence entries, part 27.
1605. gbpat28.seq - Patent sequence entries, part 28.
1606. gbpat29.seq - Patent sequence entries, part 29.
1607. gbpat3.seq - Patent sequence entries, part 3.
1608. gbpat30.seq - Patent sequence entries, part 30.
1609. gbpat31.seq - Patent sequence entries, part 31.
1610. gbpat32.seq - Patent sequence entries, part 32.
1611. gbpat33.seq - Patent sequence entries, part 33.
1612. gbpat34.seq - Patent sequence entries, part 34.
1613. gbpat35.seq - Patent sequence entries, part 35.
1614. gbpat36.seq - Patent sequence entries, part 36.
1615. gbpat37.seq - Patent sequence entries, part 37.
1616. gbpat38.seq - Patent sequence entries, part 38.
1617. gbpat39.seq - Patent sequence entries, part 39.
1618. gbpat4.seq - Patent sequence entries, part 4.
1619. gbpat40.seq - Patent sequence entries, part 40.
1620. gbpat41.seq - Patent sequence entries, part 41.
1621. gbpat42.seq - Patent sequence entries, part 42.
1622. gbpat43.seq - Patent sequence entries, part 43.
1623. gbpat44.seq - Patent sequence entries, part 44.
1624. gbpat45.seq - Patent sequence entries, part 45.
1625. gbpat46.seq - Patent sequence entries, part 46.
1626. gbpat47.seq - Patent sequence entries, part 47.
1627. gbpat48.seq - Patent sequence entries, part 48.
1628. gbpat49.seq - Patent sequence entries, part 49.
1629. gbpat5.seq - Patent sequence entries, part 5.
1630. gbpat50.seq - Patent sequence entries, part 50.
1631. gbpat51.seq - Patent sequence entries, part 51.
1632. gbpat52.seq - Patent sequence entries, part 52.
1633. gbpat53.seq - Patent sequence entries, part 53.
1634. gbpat54.seq - Patent sequence entries, part 54.
1635. gbpat55.seq - Patent sequence entries, part 55.
1636. gbpat56.seq - Patent sequence entries, part 56.
1637. gbpat57.seq - Patent sequence entries, part 57.
1638. gbpat58.seq - Patent sequence entries, part 58.
1639. gbpat59.seq - Patent sequence entries, part 59.
1640. gbpat6.seq - Patent sequence entries, part 6.
1641. gbpat60.seq - Patent sequence entries, part 60.
1642. gbpat61.seq - Patent sequence entries, part 61.
1643. gbpat62.seq - Patent sequence entries, part 62.
1644. gbpat63.seq - Patent sequence entries, part 63.
1645. gbpat64.seq - Patent sequence entries, part 64.
1646. gbpat65.seq - Patent sequence entries, part 65.
1647. gbpat7.seq - Patent sequence entries, part 7.
1648. gbpat8.seq - Patent sequence entries, part 8.
1649. gbpat9.seq - Patent sequence entries, part 9.
1650. gbphg1.seq - Phage sequence entries, part 1.
1651. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1652. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1653. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1654. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1655. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1656. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1657. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1658. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1659. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1660. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1661. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1662. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1663. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1664. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1665. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1666. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1667. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1668. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1669. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1670. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1671. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1672. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1673. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1674. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1675. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1676. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1677. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1678. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1679. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1680. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1681. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1682. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1683. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1684. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1685. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1686. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1687. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1688. gbpri1.seq - Primate sequence entries, part 1.
1689. gbpri10.seq - Primate sequence entries, part 10.
1690. gbpri11.seq - Primate sequence entries, part 11.
1691. gbpri12.seq - Primate sequence entries, part 12.
1692. gbpri13.seq - Primate sequence entries, part 13.
1693. gbpri14.seq - Primate sequence entries, part 14.
1694. gbpri15.seq - Primate sequence entries, part 15.
1695. gbpri16.seq - Primate sequence entries, part 16.
1696. gbpri17.seq - Primate sequence entries, part 17.
1697. gbpri18.seq - Primate sequence entries, part 18.
1698. gbpri19.seq - Primate sequence entries, part 19.
1699. gbpri2.seq - Primate sequence entries, part 2.
1700. gbpri20.seq - Primate sequence entries, part 20.
1701. gbpri21.seq - Primate sequence entries, part 21.
1702. gbpri22.seq - Primate sequence entries, part 22.
1703. gbpri23.seq - Primate sequence entries, part 23.
1704. gbpri24.seq - Primate sequence entries, part 24.
1705. gbpri25.seq - Primate sequence entries, part 25.
1706. gbpri26.seq - Primate sequence entries, part 26.
1707. gbpri27.seq - Primate sequence entries, part 27.
1708. gbpri28.seq - Primate sequence entries, part 28.
1709. gbpri29.seq - Primate sequence entries, part 29.
1710. gbpri3.seq - Primate sequence entries, part 3.
1711. gbpri30.seq - Primate sequence entries, part 30.
1712. gbpri31.seq - Primate sequence entries, part 31.
1713. gbpri32.seq - Primate sequence entries, part 32.
1714. gbpri33.seq - Primate sequence entries, part 33.
1715. gbpri34.seq - Primate sequence entries, part 34.
1716. gbpri35.seq - Primate sequence entries, part 35.
1717. gbpri36.seq - Primate sequence entries, part 36.
1718. gbpri37.seq - Primate sequence entries, part 37.
1719. gbpri38.seq - Primate sequence entries, part 38.
1720. gbpri39.seq - Primate sequence entries, part 39.
1721. gbpri4.seq - Primate sequence entries, part 4.
1722. gbpri5.seq - Primate sequence entries, part 5.
1723. gbpri6.seq - Primate sequence entries, part 6.
1724. gbpri7.seq - Primate sequence entries, part 7.
1725. gbpri8.seq - Primate sequence entries, part 8.
1726. gbpri9.seq - Primate sequence entries, part 9.
1727. gbrel.txt - Release notes (this document).
1728. gbrod1.seq - Rodent sequence entries, part 1.
1729. gbrod10.seq - Rodent sequence entries, part 10.
1730. gbrod11.seq - Rodent sequence entries, part 11.
1731. gbrod12.seq - Rodent sequence entries, part 12.
1732. gbrod13.seq - Rodent sequence entries, part 13.
1733. gbrod14.seq - Rodent sequence entries, part 14.
1734. gbrod15.seq - Rodent sequence entries, part 15.
1735. gbrod16.seq - Rodent sequence entries, part 16.
1736. gbrod17.seq - Rodent sequence entries, part 17.
1737. gbrod18.seq - Rodent sequence entries, part 18.
1738. gbrod19.seq - Rodent sequence entries, part 19.
1739. gbrod2.seq - Rodent sequence entries, part 2.
1740. gbrod20.seq - Rodent sequence entries, part 20.
1741. gbrod21.seq - Rodent sequence entries, part 21.
1742. gbrod22.seq - Rodent sequence entries, part 22.
1743. gbrod23.seq - Rodent sequence entries, part 23.
1744. gbrod24.seq - Rodent sequence entries, part 24.
1745. gbrod25.seq - Rodent sequence entries, part 25.
1746. gbrod26.seq - Rodent sequence entries, part 26.
1747. gbrod27.seq - Rodent sequence entries, part 27.
1748. gbrod28.seq - Rodent sequence entries, part 28.
1749. gbrod3.seq - Rodent sequence entries, part 3.
1750. gbrod4.seq - Rodent sequence entries, part 4.
1751. gbrod5.seq - Rodent sequence entries, part 5.
1752. gbrod6.seq - Rodent sequence entries, part 6.
1753. gbrod7.seq - Rodent sequence entries, part 7.
1754. gbrod8.seq - Rodent sequence entries, part 8.
1755. gbrod9.seq - Rodent sequence entries, part 9.
1756. gbsdr1.txt - Short directory of the data bank, part 1.
1757. gbsdr2.txt - Short directory of the data bank, part 2.
1758. gbsdr3.txt - Short directory of the data bank, part 3.
1759. gbsec.idx - Index of the entries according to secondary accession number.
1760. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1761. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1762. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1763. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1764. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1765. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1766. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1767. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1768. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1769. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1770. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1771. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1772. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1773. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1774. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1775. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1776. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1777. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1778. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1779. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1780. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1781. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1782. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1783. gbuna1.seq - Unannotated sequence entries, part 1.
1784. gbvrl1.seq - Viral sequence entries, part 1.
1785. gbvrl10.seq - Viral sequence entries, part 10.
1786. gbvrl11.seq - Viral sequence entries, part 11.
1787. gbvrl2.seq - Viral sequence entries, part 2.
1788. gbvrl3.seq - Viral sequence entries, part 3.
1789. gbvrl4.seq - Viral sequence entries, part 4.
1790. gbvrl5.seq - Viral sequence entries, part 5.
1791. gbvrl6.seq - Viral sequence entries, part 6.
1792. gbvrl7.seq - Viral sequence entries, part 7.
1793. gbvrl8.seq - Viral sequence entries, part 8.
1794. gbvrl9.seq - Viral sequence entries, part 9.
1795. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1796. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1797. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1798. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1799. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1800. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1801. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1802. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1803. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1804. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1805. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1806. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1807. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1808. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1809. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1810. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1811. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1812. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 170.0 flatfiles require roughly 390 GB (sequence
files only) or 417 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
941698825 gbacc1.idx
1984149099 gbacc2.idx
641398698 gbacc3.idx
184417836 gbaut1.idx
184033012 gbaut10.idx
185240739 gbaut11.idx
191893062 gbaut12.idx
201444781 gbaut13.idx
214439857 gbaut14.idx
186270129 gbaut15.idx
187901211 gbaut16.idx
185421139 gbaut17.idx
184479744 gbaut18.idx
185360492 gbaut19.idx
190872745 gbaut2.idx
183975289 gbaut20.idx
183884745 gbaut21.idx
210509435 gbaut22.idx
185600360 gbaut23.idx
185255390 gbaut24.idx
190284348 gbaut25.idx
192431938 gbaut26.idx
200356673 gbaut27.idx
186041334 gbaut28.idx
186286366 gbaut29.idx
184031400 gbaut3.idx
187872580 gbaut30.idx
212373590 gbaut31.idx
223186992 gbaut32.idx
193778816 gbaut33.idx
184385536 gbaut34.idx
228218989 gbaut35.idx
184807005 gbaut36.idx
190909364 gbaut37.idx
191722518 gbaut38.idx
190528538 gbaut39.idx
186578242 gbaut4.idx
186153073 gbaut40.idx
183650168 gbaut41.idx
183656698 gbaut42.idx
184987961 gbaut43.idx
188346167 gbaut44.idx
184894314 gbaut45.idx
183826013 gbaut46.idx
192797869 gbaut47.idx
184064973 gbaut48.idx
184767994 gbaut49.idx
186537885 gbaut5.idx
184047231 gbaut50.idx
216464283 gbaut51.idx
231408338 gbaut52.idx
254024543 gbaut53.idx
183839860 gbaut54.idx
183964962 gbaut55.idx
184229957 gbaut56.idx
225217510 gbaut57.idx
199316131 gbaut58.idx
183679553 gbaut59.idx
187890993 gbaut6.idx
240030965 gbaut60.idx
253678875 gbaut61.idx
208238385 gbaut62.idx
183867601 gbaut63.idx
215481465 gbaut64.idx
16310775 gbaut65.idx
185993196 gbaut7.idx
225642090 gbaut8.idx
211023658 gbaut9.idx
249759750 gbbct1.seq
212608769 gbbct10.seq
241463337 gbbct11.seq
244308326 gbbct12.seq
244185740 gbbct13.seq
248585632 gbbct14.seq
242982902 gbbct15.seq
242184272 gbbct16.seq
237744191 gbbct17.seq
239640300 gbbct18.seq
217727648 gbbct19.seq
249271814 gbbct2.seq
242657586 gbbct20.seq
239948148 gbbct21.seq
248569286 gbbct22.seq
247733377 gbbct23.seq
249347128 gbbct24.seq
245887416 gbbct25.seq
246402491 gbbct26.seq
249850794 gbbct27.seq
246300589 gbbct28.seq
249436500 gbbct29.seq
246344480 gbbct3.seq
243271235 gbbct30.seq
244548575 gbbct31.seq
246289648 gbbct32.seq
165735637 gbbct33.seq
86117376 gbbct34.seq
168609042 gbbct35.seq
249998475 gbbct36.seq
250000221 gbbct37.seq
77065038 gbbct38.seq
249999104 gbbct4.seq
103766579 gbbct5.seq
249570729 gbbct6.seq
238149239 gbbct7.seq
244352542 gbbct8.seq
245683759 gbbct9.seq
20565282 gbchg.txt
249980488 gbcon1.seq
249991673 gbcon10.seq
249994369 gbcon100.seq
249994433 gbcon101.seq
157277663 gbcon102.seq
249994644 gbcon103.seq
249998690 gbcon104.seq
249973265 gbcon105.seq
249998706 gbcon106.seq
172119252 gbcon107.seq
249999975 gbcon108.seq
249999369 gbcon109.seq
248844619 gbcon11.seq
249999268 gbcon110.seq
249999428 gbcon111.seq
108281033 gbcon112.seq
249999162 gbcon113.seq
249998964 gbcon114.seq
249998009 gbcon115.seq
247878001 gbcon116.seq
249998642 gbcon117.seq
108430983 gbcon118.seq
249999594 gbcon119.seq
249801494 gbcon12.seq
249999385 gbcon120.seq
249998786 gbcon121.seq
249998646 gbcon122.seq
122840389 gbcon123.seq
249999949 gbcon124.seq
249999554 gbcon125.seq
249999546 gbcon126.seq
249998879 gbcon127.seq
118438535 gbcon128.seq
228205810 gbcon13.seq
250000199 gbcon14.seq
249999542 gbcon15.seq
106822282 gbcon16.seq
249994324 gbcon17.seq
249969288 gbcon18.seq
108377660 gbcon19.seq
249775099 gbcon2.seq
249998391 gbcon20.seq
87602297 gbcon21.seq
249998105 gbcon22.seq
249713516 gbcon23.seq
249999534 gbcon24.seq
249999066 gbcon25.seq
192293216 gbcon26.seq
249999207 gbcon27.seq
249997328 gbcon28.seq
249999631 gbcon29.seq
249960341 gbcon3.seq
249999692 gbcon30.seq
249817371 gbcon31.seq
176767802 gbcon32.seq
249996991 gbcon33.seq
249998196 gbcon34.seq
249995927 gbcon35.seq
249997083 gbcon36.seq
249994783 gbcon37.seq
249995520 gbcon38.seq
62365932 gbcon39.seq
248147847 gbcon4.seq
249995165 gbcon40.seq
249995523 gbcon41.seq
249995997 gbcon42.seq
249998287 gbcon43.seq
249997419 gbcon44.seq
44061479 gbcon45.seq
249994534 gbcon46.seq
249999682 gbcon47.seq
249999450 gbcon48.seq
249996981 gbcon49.seq
249993821 gbcon5.seq
249999819 gbcon50.seq
37366136 gbcon51.seq
249994793 gbcon52.seq
249997146 gbcon53.seq
249999890 gbcon54.seq
249997325 gbcon55.seq
249995987 gbcon56.seq
153729264 gbcon57.seq
249996245 gbcon58.seq
249998868 gbcon59.seq
249998265 gbcon6.seq
249998776 gbcon60.seq
249995315 gbcon61.seq
184751617 gbcon62.seq
249999742 gbcon63.seq
249996805 gbcon64.seq
249996378 gbcon65.seq
249997731 gbcon66.seq
246704194 gbcon67.seq
249996123 gbcon68.seq
249996806 gbcon69.seq
241344788 gbcon7.seq
249994747 gbcon70.seq
249998911 gbcon71.seq
249998433 gbcon72.seq
97827765 gbcon73.seq
249996160 gbcon74.seq
249996456 gbcon75.seq
249999720 gbcon76.seq
249998702 gbcon77.seq
249999534 gbcon78.seq
63726819 gbcon79.seq
249996525 gbcon8.seq
249997709 gbcon80.seq
249996382 gbcon81.seq
249999225 gbcon82.seq
249997118 gbcon83.seq
249998473 gbcon84.seq
22747059 gbcon85.seq
249996051 gbcon86.seq
250000090 gbcon87.seq
249999511 gbcon88.seq
249999267 gbcon89.seq
249992660 gbcon9.seq
198915940 gbcon90.seq
249996015 gbcon91.seq
249994203 gbcon92.seq
250000238 gbcon93.seq
249998171 gbcon94.seq
249993618 gbcon95.seq
134239203 gbcon96.seq
249998824 gbcon97.seq
249999798 gbcon98.seq
249997479 gbcon99.seq
49996 gbdel.txt
245147178 gbenv1.seq
249997921 gbenv10.seq
249999157 gbenv11.seq
224288050 gbenv12.seq
249998661 gbenv2.seq
250000148 gbenv3.seq
249999800 gbenv4.seq
249999725 gbenv5.seq
1271869 gbenv6.seq
249999092 gbenv7.seq
249999172 gbenv8.seq
249998556 gbenv9.seq
230688615 gbest1.seq
230687850 gbest10.seq
230689635 gbest100.seq
230691027 gbest101.seq
230688036 gbest102.seq
230690442 gbest103.seq
230687784 gbest104.seq
230687802 gbest105.seq
230688326 gbest106.seq
230690758 gbest107.seq
230689270 gbest108.seq
230689992 gbest109.seq
230688467 gbest11.seq
230690399 gbest110.seq
230688573 gbest111.seq
230688843 gbest112.seq
230690687 gbest113.seq
230689115 gbest114.seq
230688457 gbest115.seq
230689092 gbest116.seq
230687558 gbest117.seq
230688980 gbest118.seq
230626227 gbest119.seq
230689872 gbest12.seq
230687484 gbest120.seq
230688402 gbest121.seq
230687460 gbest122.seq
230687780 gbest123.seq
230690742 gbest124.seq
230689259 gbest125.seq
230688677 gbest126.seq
230688260 gbest127.seq
230687759 gbest128.seq
230687656 gbest129.seq
230689821 gbest13.seq
230687539 gbest130.seq
230689497 gbest131.seq
230690034 gbest132.seq
230687866 gbest133.seq
230690230 gbest134.seq
230687453 gbest135.seq
230690157 gbest136.seq
230689769 gbest137.seq
230688311 gbest138.seq
230687509 gbest139.seq
230688392 gbest14.seq
230687840 gbest140.seq
230687892 gbest141.seq
230689396 gbest142.seq
230690478 gbest143.seq
230687899 gbest144.seq
230687783 gbest145.seq
230690944 gbest146.seq
230690807 gbest147.seq
230688735 gbest148.seq
230688800 gbest149.seq
230689730 gbest15.seq
230690500 gbest150.seq
230687951 gbest151.seq
230689010 gbest152.seq
230689828 gbest153.seq
230689010 gbest154.seq
230688961 gbest155.seq
230688061 gbest156.seq
230689073 gbest157.seq
230689142 gbest158.seq
230689412 gbest159.seq
230689990 gbest16.seq
230689007 gbest160.seq
230690800 gbest161.seq
230688147 gbest162.seq
230690182 gbest163.seq
230689945 gbest164.seq
230696472 gbest165.seq
230688478 gbest166.seq
230690057 gbest167.seq
230688672 gbest168.seq
230691637 gbest169.seq
230688061 gbest17.seq
230688764 gbest170.seq
230688106 gbest171.seq
230688364 gbest172.seq
230688273 gbest173.seq
230690750 gbest174.seq
230687780 gbest175.seq
230689535 gbest176.seq
230688867 gbest177.seq
230687791 gbest178.seq
230689531 gbest179.seq
230688248 gbest18.seq
230687656 gbest180.seq
230688585 gbest181.seq
230689320 gbest182.seq
230689699 gbest183.seq
230688081 gbest184.seq
230687984 gbest185.seq
230688386 gbest186.seq
230690629 gbest187.seq
230687811 gbest188.seq
229864122 gbest189.seq
230689667 gbest19.seq
230689106 gbest190.seq
230687930 gbest191.seq
230688556 gbest192.seq
230688396 gbest193.seq
230691029 gbest194.seq
230690215 gbest195.seq
230689947 gbest196.seq
230687522 gbest197.seq
230689906 gbest198.seq
230687643 gbest199.seq
230689833 gbest2.seq
230687942 gbest20.seq
230688808 gbest200.seq
230688651 gbest201.seq
230691323 gbest202.seq
230688439 gbest203.seq
230690670 gbest204.seq
230687753 gbest205.seq
230690803 gbest206.seq
230689299 gbest207.seq
230688035 gbest208.seq
230689857 gbest209.seq
230689774 gbest21.seq
230688027 gbest210.seq
230688177 gbest211.seq
230689699 gbest212.seq
230689066 gbest213.seq
230687543 gbest214.seq
230689213 gbest215.seq
230689055 gbest216.seq
230688168 gbest217.seq
230689083 gbest218.seq
230688807 gbest219.seq
230689646 gbest22.seq
230689924 gbest220.seq
230688331 gbest221.seq
230687823 gbest222.seq
230688579 gbest223.seq
230690370 gbest224.seq
230687999 gbest225.seq
230688539 gbest226.seq
230688428 gbest227.seq
230689412 gbest228.seq
230689302 gbest229.seq
230687780 gbest23.seq
230689738 gbest230.seq
205494104 gbest231.seq
161817001 gbest232.seq
161495625 gbest233.seq
169043696 gbest234.seq
167986617 gbest235.seq
164126545 gbest236.seq
164672303 gbest237.seq
163692195 gbest238.seq
163032422 gbest239.seq
230687545 gbest24.seq
163454724 gbest240.seq
163037080 gbest241.seq
163195806 gbest242.seq
162012669 gbest243.seq
166873651 gbest244.seq
162032171 gbest245.seq
161397945 gbest246.seq
165446792 gbest247.seq
167205778 gbest248.seq
164855998 gbest249.seq
230688013 gbest25.seq
164614542 gbest250.seq
164363522 gbest251.seq
164087202 gbest252.seq
163238738 gbest253.seq
163091950 gbest254.seq
163856641 gbest255.seq
163754402 gbest256.seq
178561266 gbest257.seq
172210985 gbest258.seq
179619926 gbest259.seq
230689379 gbest26.seq
230690119 gbest260.seq
230691453 gbest261.seq
230687657 gbest262.seq
230689494 gbest263.seq
230688879 gbest264.seq
230690630 gbest265.seq
230689968 gbest266.seq
230687681 gbest267.seq
230688011 gbest268.seq
230688921 gbest269.seq
230689206 gbest27.seq
230691698 gbest270.seq
230689309 gbest271.seq
230687681 gbest272.seq
230689848 gbest273.seq
230689584 gbest274.seq
230687515 gbest275.seq
230689559 gbest276.seq
230689465 gbest277.seq
230690476 gbest278.seq
230687826 gbest279.seq
230689065 gbest28.seq
230687677 gbest280.seq
230690026 gbest281.seq
230689654 gbest282.seq
230688803 gbest283.seq
230690796 gbest284.seq
230690106 gbest285.seq
230688959 gbest286.seq
230689357 gbest287.seq
230689821 gbest288.seq
230689679 gbest289.seq
230689702 gbest29.seq
230688579 gbest290.seq
221880829 gbest291.seq
207493449 gbest292.seq
230688651 gbest293.seq
230687642 gbest294.seq
230688872 gbest295.seq
230689237 gbest296.seq
230688543 gbest297.seq
230687531 gbest298.seq
230691574 gbest299.seq
230690315 gbest3.seq
230687774 gbest30.seq
230687926 gbest300.seq
230688032 gbest301.seq
230687850 gbest302.seq
230690512 gbest303.seq
230689660 gbest304.seq
230687568 gbest305.seq
230689918 gbest306.seq
230689616 gbest307.seq
230688284 gbest308.seq
230689148 gbest309.seq
230690000 gbest31.seq
230687706 gbest310.seq
230691084 gbest311.seq
230689972 gbest312.seq
230688608 gbest313.seq
230689021 gbest314.seq
230691260 gbest315.seq
230690625 gbest316.seq
230690241 gbest317.seq
230689985 gbest318.seq
230687675 gbest319.seq
230687761 gbest32.seq
230688331 gbest320.seq
230689458 gbest321.seq
230690871 gbest322.seq
230687852 gbest323.seq
230689997 gbest324.seq
230688986 gbest325.seq
230689169 gbest326.seq
230689251 gbest327.seq
230689462 gbest328.seq
230690074 gbest329.seq
230688747 gbest33.seq
230687557 gbest330.seq
230689043 gbest331.seq
230688490 gbest332.seq
230690534 gbest333.seq
230688376 gbest334.seq
230688387 gbest335.seq
230688286 gbest336.seq
230687908 gbest337.seq
230689256 gbest338.seq
230689893 gbest339.seq
230687836 gbest34.seq
230689615 gbest340.seq
230688958 gbest341.seq
230687815 gbest342.seq
207961001 gbest343.seq
230687445 gbest344.seq
230689448 gbest345.seq
230689030 gbest346.seq
230691218 gbest347.seq
230690100 gbest348.seq
230689339 gbest349.seq
230690403 gbest35.seq
157461947 gbest350.seq
164846417 gbest351.seq
230689535 gbest352.seq
230691598 gbest353.seq
230688549 gbest354.seq
230687450 gbest355.seq
230689159 gbest356.seq
230687905 gbest357.seq
230688600 gbest358.seq
230688494 gbest359.seq
230689786 gbest36.seq
230688697 gbest360.seq
230688975 gbest361.seq
230687967 gbest362.seq
230687907 gbest363.seq
230689153 gbest364.seq
230689874 gbest365.seq
230688146 gbest366.seq
230687457 gbest367.seq
230688361 gbest368.seq
230688341 gbest369.seq
230687550 gbest37.seq
230689626 gbest370.seq
230688933 gbest371.seq
230688498 gbest372.seq
230690674 gbest373.seq
230691067 gbest374.seq
230689863 gbest375.seq
230687886 gbest376.seq
230690693 gbest377.seq
230689530 gbest378.seq
230688015 gbest379.seq
230688643 gbest38.seq
230690224 gbest380.seq
230690525 gbest381.seq
230688148 gbest382.seq
230687546 gbest383.seq
230689847 gbest384.seq
230690614 gbest385.seq
230688360 gbest386.seq
230689722 gbest387.seq
230688763 gbest388.seq
230688549 gbest389.seq
230688297 gbest39.seq
230689827 gbest390.seq
230689509 gbest391.seq
230688889 gbest392.seq
191520372 gbest393.seq
178590075 gbest394.seq
230688403 gbest395.seq
229019937 gbest396.seq
221327962 gbest397.seq
206316442 gbest398.seq
196133181 gbest399.seq
230688895 gbest4.seq
230690662 gbest40.seq
230689918 gbest400.seq
230687806 gbest401.seq
230690691 gbest402.seq
230687624 gbest403.seq
230687999 gbest404.seq
222400318 gbest405.seq
230690993 gbest406.seq
230690441 gbest407.seq
230693537 gbest408.seq
230690176 gbest409.seq
230687820 gbest41.seq
230689054 gbest410.seq
230688080 gbest411.seq
230689515 gbest412.seq
230690691 gbest413.seq
230690470 gbest414.seq
230689461 gbest415.seq
230689329 gbest416.seq
230690231 gbest417.seq
230689455 gbest418.seq
230688657 gbest419.seq
230689087 gbest42.seq
230687502 gbest420.seq
230687560 gbest421.seq
230690340 gbest422.seq
230690400 gbest423.seq
230689033 gbest424.seq
230689220 gbest425.seq
230689636 gbest426.seq
230688555 gbest427.seq
230694054 gbest428.seq
230688895 gbest429.seq
230688224 gbest43.seq
218416506 gbest430.seq
208440362 gbest431.seq
208169192 gbest432.seq
208441924 gbest433.seq
208281505 gbest434.seq
208543193 gbest435.seq
208575595 gbest436.seq
210167647 gbest437.seq
209612605 gbest438.seq
209123600 gbest439.seq
230688434 gbest44.seq
212273190 gbest440.seq
209916799 gbest441.seq
208759227 gbest442.seq
208775997 gbest443.seq
208896544 gbest444.seq
208232783 gbest445.seq
208261914 gbest446.seq
208288817 gbest447.seq
208106123 gbest448.seq
207317232 gbest449.seq
230687764 gbest45.seq
230689708 gbest450.seq
230689506 gbest451.seq
230687576 gbest452.seq
230687566 gbest453.seq
230687693 gbest454.seq
230688768 gbest455.seq
230689604 gbest456.seq
230688153 gbest457.seq
230687833 gbest458.seq
230688000 gbest459.seq
230688420 gbest46.seq
230688538 gbest460.seq
230687909 gbest461.seq
230687677 gbest462.seq
230689388 gbest463.seq
230690702 gbest464.seq
230688307 gbest465.seq
230688097 gbest466.seq
230688532 gbest467.seq
230687546 gbest468.seq
230688261 gbest469.seq
189039533 gbest47.seq
230688642 gbest470.seq
230690424 gbest471.seq
230690582 gbest472.seq
230688145 gbest473.seq
230688819 gbest474.seq
230688872 gbest475.seq
230687487 gbest476.seq
230688943 gbest477.seq
230689287 gbest478.seq
230689185 gbest479.seq
188239305 gbest48.seq
230687484 gbest480.seq
230689267 gbest481.seq
230687562 gbest482.seq
230689761 gbest483.seq
230690521 gbest484.seq
230691540 gbest485.seq
230690094 gbest486.seq
230689890 gbest487.seq
230687608 gbest488.seq
230688735 gbest489.seq
204604195 gbest49.seq
230688961 gbest490.seq
230690819 gbest491.seq
230688913 gbest492.seq
230688493 gbest493.seq
230690420 gbest494.seq
230688926 gbest495.seq
230688349 gbest496.seq
230687504 gbest497.seq
230689709 gbest498.seq
230688004 gbest499.seq
164142208 gbest5.seq
215035877 gbest50.seq
230689451 gbest500.seq
230691121 gbest501.seq
230689243 gbest502.seq
230688907 gbest503.seq
230689515 gbest504.seq
230688858 gbest505.seq
230689117 gbest506.seq
230689691 gbest507.seq
230687648 gbest508.seq
230689008 gbest509.seq
214764221 gbest51.seq
230690684 gbest510.seq
230688821 gbest511.seq
230689685 gbest512.seq
230690533 gbest513.seq
230688896 gbest514.seq
230687716 gbest515.seq
230687626 gbest516.seq
230688051 gbest517.seq
230688148 gbest518.seq
230688612 gbest519.seq
215584722 gbest52.seq
230687918 gbest520.seq
230689244 gbest521.seq
230688294 gbest522.seq
230690262 gbest523.seq
230688458 gbest524.seq
230687744 gbest525.seq
230690080 gbest526.seq
230688375 gbest527.seq
224684537 gbest528.seq
230688516 gbest529.seq
228569087 gbest53.seq
230690484 gbest530.seq
230689816 gbest531.seq
230688754 gbest532.seq
230687942 gbest533.seq
230687659 gbest534.seq
230689060 gbest535.seq
230687808 gbest536.seq
230688200 gbest537.seq
230691901 gbest538.seq
230687998 gbest539.seq
230688190 gbest54.seq
230689287 gbest540.seq
230689089 gbest541.seq
230688071 gbest542.seq
211781528 gbest543.seq
196104690 gbest544.seq
230688126 gbest545.seq
230689201 gbest546.seq
230688501 gbest547.seq
230689576 gbest548.seq
230688014 gbest549.seq
230689693 gbest55.seq
230690120 gbest550.seq
230689959 gbest551.seq
230688759 gbest552.seq
230689287 gbest553.seq
230688448 gbest554.seq
230689689 gbest555.seq
230689455 gbest556.seq
230687750 gbest557.seq
221936068 gbest558.seq
228751361 gbest559.seq
230687887 gbest56.seq
230689856 gbest560.seq
230689270 gbest561.seq
230690010 gbest562.seq
230690637 gbest563.seq
230687833 gbest564.seq
230687539 gbest565.seq
219836801 gbest566.seq
221890279 gbest567.seq
230688145 gbest568.seq
230690619 gbest569.seq
223995399 gbest57.seq
230687790 gbest570.seq
230689362 gbest571.seq
230688051 gbest572.seq
230688909 gbest573.seq
230687906 gbest574.seq
230691165 gbest575.seq
230688697 gbest576.seq
230690287 gbest577.seq
230687500 gbest578.seq
230689085 gbest579.seq
230688857 gbest58.seq
230688668 gbest580.seq
230691263 gbest581.seq
224175322 gbest582.seq
230689224 gbest583.seq
230689069 gbest584.seq
230690295 gbest585.seq
230689932 gbest586.seq
230688666 gbest587.seq
230688639 gbest588.seq
230688994 gbest589.seq
230688510 gbest59.seq
230689428 gbest590.seq
230688460 gbest591.seq
230688377 gbest592.seq
230687592 gbest593.seq
230688922 gbest594.seq
230688202 gbest595.seq
230690885 gbest596.seq
230689187 gbest597.seq
230689492 gbest598.seq
230688287 gbest599.seq
177420861 gbest6.seq
230688514 gbest60.seq
230687691 gbest600.seq
230688598 gbest601.seq
230690157 gbest602.seq
230687575 gbest603.seq
230687946 gbest604.seq
230689240 gbest605.seq
230689585 gbest606.seq
230690785 gbest607.seq
230687850 gbest608.seq
230688412 gbest609.seq
230688842 gbest61.seq
230688341 gbest610.seq
230690721 gbest611.seq
230688472 gbest612.seq
230688375 gbest613.seq
230689260 gbest614.seq
230689220 gbest615.seq
230687824 gbest616.seq
230688091 gbest617.seq
230687472 gbest618.seq
230687902 gbest619.seq
230691258 gbest62.seq
230690403 gbest620.seq
230687657 gbest621.seq
230690491 gbest622.seq
230689321 gbest623.seq
230690349 gbest624.seq
230688446 gbest625.seq
230687754 gbest626.seq
230688585 gbest627.seq
230688732 gbest628.seq
230689501 gbest629.seq
230689321 gbest63.seq
230688402 gbest630.seq
230688240 gbest631.seq
230688082 gbest632.seq
230687540 gbest633.seq
230688050 gbest634.seq
230689551 gbest635.seq
230688278 gbest636.seq
230687964 gbest637.seq
230687871 gbest638.seq
230687461 gbest639.seq
230688651 gbest64.seq
230690059 gbest640.seq
230689693 gbest641.seq
218378084 gbest642.seq
230688834 gbest643.seq
230689627 gbest644.seq
230689203 gbest645.seq
217358608 gbest646.seq
228143810 gbest647.seq
230687891 gbest648.seq
198361072 gbest649.seq
230687696 gbest65.seq
191409194 gbest650.seq
190606082 gbest651.seq
194209443 gbest652.seq
190936326 gbest653.seq
192360264 gbest654.seq
191273783 gbest655.seq
193286667 gbest656.seq
191829849 gbest657.seq
191013769 gbest658.seq
195788155 gbest659.seq
230689920 gbest66.seq
230687958 gbest660.seq
230688633 gbest661.seq
230689882 gbest662.seq
230688660 gbest663.seq
230690570 gbest664.seq
230691017 gbest665.seq
230687579 gbest666.seq
175153573 gbest667.seq
186700778 gbest668.seq
230687972 gbest669.seq
230690115 gbest67.seq
230690631 gbest670.seq
230688108 gbest671.seq
230690406 gbest672.seq
230690015 gbest673.seq
230687649 gbest674.seq
230690470 gbest675.seq
230688148 gbest676.seq
230689430 gbest677.seq
230687637 gbest678.seq
230687679 gbest679.seq
230688576 gbest68.seq
230689921 gbest680.seq
230687636 gbest681.seq
230688064 gbest682.seq
230688908 gbest683.seq
230689777 gbest684.seq
230690102 gbest685.seq
230687627 gbest686.seq
230688635 gbest687.seq
230689085 gbest688.seq
230689552 gbest689.seq
230689464 gbest69.seq
230690438 gbest690.seq
230688751 gbest691.seq
230689618 gbest692.seq
230688096 gbest693.seq
230688301 gbest694.seq
230689997 gbest695.seq
230690602 gbest696.seq
230688005 gbest697.seq
230688594 gbest698.seq
230689655 gbest699.seq
230687843 gbest7.seq
230687943 gbest70.seq
230691029 gbest700.seq
230690828 gbest701.seq
230688831 gbest702.seq
230687624 gbest703.seq
230687749 gbest704.seq
230688380 gbest705.seq
230689516 gbest706.seq
216391737 gbest707.seq
216709712 gbest708.seq
218358158 gbest709.seq
229836978 gbest71.seq
216526092 gbest710.seq
215896564 gbest711.seq
230687924 gbest712.seq
230688693 gbest713.seq
230690920 gbest714.seq
230689176 gbest715.seq
230688505 gbest716.seq
230688673 gbest717.seq
230687552 gbest718.seq
230689194 gbest719.seq
230688215 gbest72.seq
230690335 gbest720.seq
230689519 gbest721.seq
230687952 gbest722.seq
230689511 gbest723.seq
230689380 gbest724.seq
230692005 gbest725.seq
230689417 gbest726.seq
230688160 gbest727.seq
230689810 gbest728.seq
230687986 gbest729.seq
209824547 gbest73.seq
230689194 gbest730.seq
230688322 gbest731.seq
230691811 gbest732.seq
230691009 gbest733.seq
230689471 gbest734.seq
230688822 gbest735.seq
230688396 gbest736.seq
230687942 gbest737.seq
204288675 gbest738.seq
230689901 gbest739.seq
208186115 gbest74.seq
230689724 gbest740.seq
230688948 gbest741.seq
230689335 gbest742.seq
230687920 gbest743.seq
230691002 gbest744.seq
230690748 gbest745.seq
230687633 gbest746.seq
230688000 gbest747.seq
230689521 gbest748.seq
230689343 gbest749.seq
207525203 gbest75.seq
230687717 gbest750.seq
230689801 gbest751.seq
230688764 gbest752.seq
230687895 gbest753.seq
230688639 gbest754.seq
208127856 gbest755.seq
199729341 gbest756.seq
230690124 gbest757.seq
230687442 gbest758.seq
230690411 gbest759.seq
207839886 gbest76.seq
230693084 gbest760.seq
230694573 gbest761.seq
230689561 gbest762.seq
230687900 gbest763.seq
230687551 gbest764.seq
230688433 gbest765.seq
230689544 gbest766.seq
230688275 gbest767.seq
230688795 gbest768.seq
230688482 gbest769.seq
208353100 gbest77.seq
230690579 gbest770.seq
230688333 gbest771.seq
230690462 gbest772.seq
230689921 gbest773.seq
230689619 gbest774.seq
230689600 gbest775.seq
230688237 gbest776.seq
230689204 gbest777.seq
230688114 gbest778.seq
230688819 gbest779.seq
209299571 gbest78.seq
230689066 gbest780.seq
230688491 gbest781.seq
230689194 gbest782.seq
230689785 gbest783.seq
230689477 gbest784.seq
230687542 gbest785.seq
230690187 gbest786.seq
230688993 gbest787.seq
230690045 gbest788.seq
230687668 gbest789.seq
208466832 gbest79.seq
230689385 gbest790.seq
230688996 gbest791.seq
230688565 gbest792.seq
230691253 gbest793.seq
230687489 gbest794.seq
230689520 gbest795.seq
230688209 gbest796.seq
230689366 gbest797.seq
230690078 gbest798.seq
230690704 gbest799.seq
230688355 gbest8.seq
207079218 gbest80.seq
230689110 gbest800.seq
230689635 gbest801.seq
230687725 gbest802.seq
230688879 gbest803.seq
230689321 gbest804.seq
230688255 gbest805.seq
230689574 gbest806.seq
230688479 gbest807.seq
230690814 gbest808.seq
230690035 gbest809.seq
209000787 gbest81.seq
230690006 gbest810.seq
230690955 gbest811.seq
230688621 gbest812.seq
230687814 gbest813.seq
230689969 gbest814.seq
230690259 gbest815.seq
230690831 gbest816.seq
230691322 gbest817.seq
230690271 gbest818.seq
230688214 gbest819.seq
207206132 gbest82.seq
230690633 gbest820.seq
230687526 gbest821.seq
230689768 gbest822.seq
230689096 gbest823.seq
230690281 gbest824.seq
230691307 gbest825.seq
230688187 gbest826.seq
230689036 gbest827.seq
230687456 gbest828.seq
230688104 gbest829.seq
204099078 gbest83.seq
230687917 gbest830.seq
230688181 gbest831.seq
230690012 gbest832.seq
230689445 gbest833.seq
230690274 gbest834.seq
230100653 gbest835.seq
230690496 gbest836.seq
230690243 gbest837.seq
73097006 gbest838.seq
207238114 gbest84.seq
206863656 gbest85.seq
210427721 gbest86.seq
226200480 gbest87.seq
230691230 gbest88.seq
230688404 gbest89.seq
230689534 gbest9.seq
217600919 gbest90.seq
213208523 gbest91.seq
214395926 gbest92.seq
230688220 gbest93.seq
230690517 gbest94.seq
230689300 gbest95.seq
230689724 gbest96.seq
230689279 gbest97.seq
230688897 gbest98.seq
230689555 gbest99.seq
99040819 gbgen.idx
230688621 gbgss1.seq
230690079 gbgss10.seq
230690035 gbgss100.seq
227521086 gbgss101.seq
228875559 gbgss102.seq
228596267 gbgss103.seq
228615888 gbgss104.seq
227686814 gbgss105.seq
228555325 gbgss106.seq
230689745 gbgss107.seq
230687739 gbgss108.seq
230689049 gbgss109.seq
230689764 gbgss11.seq
230689255 gbgss110.seq
230689922 gbgss111.seq
230689753 gbgss112.seq
230688058 gbgss113.seq
230688819 gbgss114.seq
230688198 gbgss115.seq
230689674 gbgss116.seq
230688532 gbgss117.seq
230688707 gbgss118.seq
230689716 gbgss119.seq
230687679 gbgss12.seq
230688555 gbgss120.seq
230687697 gbgss121.seq
230688733 gbgss122.seq
230689158 gbgss123.seq
230689913 gbgss124.seq
230690468 gbgss125.seq
230689846 gbgss126.seq
230689628 gbgss127.seq
230688826 gbgss128.seq
230688210 gbgss129.seq
230690347 gbgss13.seq
230688232 gbgss130.seq
230689462 gbgss131.seq
230689523 gbgss132.seq
230688603 gbgss133.seq
230689065 gbgss134.seq
230689484 gbgss135.seq
230689746 gbgss136.seq
230689358 gbgss137.seq
230688487 gbgss138.seq
230687703 gbgss139.seq
230689893 gbgss14.seq
230688675 gbgss140.seq
230688985 gbgss141.seq
230689543 gbgss142.seq
230689924 gbgss143.seq
230689064 gbgss144.seq
226612794 gbgss145.seq
229946274 gbgss146.seq
230690042 gbgss147.seq
209811233 gbgss148.seq
230687924 gbgss149.seq
230689648 gbgss15.seq
230689347 gbgss150.seq
230690516 gbgss151.seq
230689865 gbgss152.seq
230689892 gbgss153.seq
230687733 gbgss154.seq
230688909 gbgss155.seq
230689972 gbgss156.seq
230688489 gbgss157.seq
230688291 gbgss158.seq
230690235 gbgss159.seq
230689778 gbgss16.seq
230688265 gbgss160.seq
230688101 gbgss161.seq
230687975 gbgss162.seq
230690557 gbgss163.seq
230688427 gbgss164.seq
230689812 gbgss165.seq
230688375 gbgss166.seq
230688147 gbgss167.seq
230687586 gbgss168.seq
230689373 gbgss169.seq
230688655 gbgss17.seq
230690260 gbgss170.seq
230687784 gbgss171.seq
230687576 gbgss172.seq
230690394 gbgss173.seq
215439556 gbgss174.seq
207680840 gbgss175.seq
209736325 gbgss176.seq
210658743 gbgss177.seq
209802884 gbgss178.seq
209435656 gbgss179.seq
230688580 gbgss18.seq
207666214 gbgss180.seq
207220227 gbgss181.seq
207815197 gbgss182.seq
208975385 gbgss183.seq
209311592 gbgss184.seq
209108278 gbgss185.seq
205918837 gbgss186.seq
205546367 gbgss187.seq
205324571 gbgss188.seq
205574857 gbgss189.seq
230688247 gbgss19.seq
205196483 gbgss190.seq
205854927 gbgss191.seq
207598151 gbgss192.seq
208351027 gbgss193.seq
207922875 gbgss194.seq
207970893 gbgss195.seq
208698449 gbgss196.seq
208829644 gbgss197.seq
208901745 gbgss198.seq
206067497 gbgss199.seq
230688628 gbgss2.seq
230689216 gbgss20.seq
206186488 gbgss200.seq
206463244 gbgss201.seq
205613538 gbgss202.seq
205712778 gbgss203.seq
207390282 gbgss204.seq
207096037 gbgss205.seq
207100931 gbgss206.seq
207252162 gbgss207.seq
207142034 gbgss208.seq
207087884 gbgss209.seq
230687808 gbgss21.seq
206875895 gbgss210.seq
206974647 gbgss211.seq
206714783 gbgss212.seq
207731296 gbgss213.seq
207861032 gbgss214.seq
209179398 gbgss215.seq
210105431 gbgss216.seq
209229062 gbgss217.seq
210271181 gbgss218.seq
217142955 gbgss219.seq
230691288 gbgss22.seq
218861813 gbgss220.seq
230689586 gbgss221.seq
230689807 gbgss222.seq
230689583 gbgss223.seq
230689436 gbgss224.seq
230687487 gbgss225.seq
230689309 gbgss226.seq
217905847 gbgss227.seq
217931093 gbgss228.seq
230688850 gbgss229.seq
230690275 gbgss23.seq
230689300 gbgss230.seq
230688185 gbgss231.seq
230689401 gbgss232.seq
230688322 gbgss233.seq
230688006 gbgss234.seq
230687731 gbgss235.seq
230687923 gbgss236.seq
230687481 gbgss237.seq
230689430 gbgss238.seq
230687486 gbgss239.seq
230687584 gbgss24.seq
230689295 gbgss240.seq
230688846 gbgss241.seq
230689271 gbgss242.seq
230689619 gbgss243.seq
230689540 gbgss244.seq
230687641 gbgss245.seq
230688879 gbgss246.seq
230687816 gbgss247.seq
230691087 gbgss248.seq
230688024 gbgss249.seq
230688860 gbgss25.seq
230689729 gbgss250.seq
230687916 gbgss251.seq
230689301 gbgss252.seq
32304218 gbgss253.seq
249999071 gbgss254.seq
249999202 gbgss255.seq
249997657 gbgss256.seq
249997031 gbgss257.seq
27149251 gbgss258.seq
249999305 gbgss259.seq
230689933 gbgss26.seq
249998059 gbgss260.seq
249997528 gbgss261.seq
249999261 gbgss262.seq
223609630 gbgss263.seq
249998415 gbgss264.seq
249998761 gbgss265.seq
249998880 gbgss266.seq
249999296 gbgss267.seq
173665419 gbgss268.seq
249996883 gbgss269.seq
230687500 gbgss27.seq
249998407 gbgss270.seq
249998682 gbgss271.seq
249999133 gbgss272.seq
249997900 gbgss273.seq
77373170 gbgss274.seq
249998863 gbgss275.seq
3042312 gbgss276.seq
79503481 gbgss277.seq
249999793 gbgss278.seq
249999574 gbgss279.seq
230691150 gbgss28.seq
80246184 gbgss280.seq
249998484 gbgss281.seq
249999450 gbgss282.seq
249999932 gbgss283.seq
106015837 gbgss284.seq
249999531 gbgss285.seq
249999540 gbgss286.seq
249999193 gbgss287.seq
245561962 gbgss288.seq
249997836 gbgss289.seq
230689347 gbgss29.seq
249999279 gbgss290.seq
249999994 gbgss291.seq
242660422 gbgss292.seq
249999336 gbgss293.seq
249999456 gbgss294.seq
249998293 gbgss295.seq
249999491 gbgss296.seq
114414437 gbgss297.seq
249998009 gbgss298.seq
250000031 gbgss299.seq
230689286 gbgss3.seq
230689385 gbgss30.seq
249998209 gbgss300.seq
249999909 gbgss301.seq
94193676 gbgss302.seq
249998892 gbgss303.seq
249999850 gbgss304.seq
250000016 gbgss305.seq
203677706 gbgss306.seq
249999236 gbgss307.seq
249997993 gbgss308.seq
249998006 gbgss309.seq
230690225 gbgss31.seq
249999353 gbgss310.seq
95926739 gbgss311.seq
249999461 gbgss312.seq
249999350 gbgss313.seq
249998406 gbgss314.seq
249998619 gbgss315.seq
104014105 gbgss316.seq
249999853 gbgss317.seq
249998411 gbgss318.seq
249998272 gbgss319.seq
230688976 gbgss32.seq
42310440 gbgss320.seq
52138985 gbgss321.seq
90500177 gbgss322.seq
230688128 gbgss33.seq
230690193 gbgss34.seq
230688810 gbgss35.seq
230689089 gbgss36.seq
230689278 gbgss37.seq
230688359 gbgss38.seq
230689487 gbgss39.seq
230688064 gbgss4.seq
230688189 gbgss40.seq
230687914 gbgss41.seq
230689468 gbgss42.seq
230689860 gbgss43.seq
230688625 gbgss44.seq
230688829 gbgss45.seq
230690346 gbgss46.seq
230688963 gbgss47.seq
230687625 gbgss48.seq
230688321 gbgss49.seq
230688342 gbgss5.seq
230688467 gbgss50.seq
230688749 gbgss51.seq
230689377 gbgss52.seq
230689505 gbgss53.seq
230690049 gbgss54.seq
230688759 gbgss55.seq
230687592 gbgss56.seq
230688956 gbgss57.seq
230690150 gbgss58.seq
230688240 gbgss59.seq
230689182 gbgss6.seq
230689458 gbgss60.seq
228978887 gbgss61.seq
230688786 gbgss62.seq
230688562 gbgss63.seq
230688493 gbgss64.seq
230688511 gbgss65.seq
230688084 gbgss66.seq
230688090 gbgss67.seq
230687948 gbgss68.seq
230687896 gbgss69.seq
230687458 gbgss7.seq
230689872 gbgss70.seq
230689371 gbgss71.seq
230689612 gbgss72.seq
230689793 gbgss73.seq
230688465 gbgss74.seq
230687944 gbgss75.seq
230688682 gbgss76.seq
230688590 gbgss77.seq
230688102 gbgss78.seq
230688694 gbgss79.seq
230690430 gbgss8.seq
230688922 gbgss80.seq
225707360 gbgss81.seq
194162099 gbgss82.seq
194321118 gbgss83.seq
230691378 gbgss84.seq
230689444 gbgss85.seq
230688634 gbgss86.seq
230689771 gbgss87.seq
230688430 gbgss88.seq
230689328 gbgss89.seq
230689298 gbgss9.seq
230689609 gbgss90.seq
230689497 gbgss91.seq
230687463 gbgss92.seq
230688240 gbgss93.seq
230688298 gbgss94.seq
230689356 gbgss95.seq
230690100 gbgss96.seq
230689349 gbgss97.seq
230689178 gbgss98.seq
230689772 gbgss99.seq
249998256 gbhtc1.seq
249999575 gbhtc10.seq
189556049 gbhtc11.seq
249998738 gbhtc12.seq
249999560 gbhtc13.seq
38916288 gbhtc14.seq
249993961 gbhtc2.seq
249987935 gbhtc3.seq
249988571 gbhtc4.seq
249999714 gbhtc5.seq
249988093 gbhtc6.seq
249999558 gbhtc7.seq
71734126 gbhtc8.seq
249998991 gbhtc9.seq
249927410 gbhtg1.seq
249805795 gbhtg10.seq
249708241 gbhtg100.seq
249864146 gbhtg101.seq
194375936 gbhtg102.seq
249745841 gbhtg103.seq
249971713 gbhtg104.seq
249906882 gbhtg105.seq
249860611 gbhtg106.seq
249825436 gbhtg107.seq
19643434 gbhtg108.seq
249821890 gbhtg109.seq
1643239 gbhtg11.seq
249909099 gbhtg110.seq
249906787 gbhtg111.seq
249979392 gbhtg112.seq
249998308 gbhtg113.seq
248428469 gbhtg114.seq
249627030 gbhtg115.seq
249749695 gbhtg116.seq
249766503 gbhtg117.seq
249805284 gbhtg118.seq
249912994 gbhtg119.seq
249672637 gbhtg12.seq
107216300 gbhtg120.seq
249833745 gbhtg121.seq
249813647 gbhtg122.seq
249980030 gbhtg123.seq
249679355 gbhtg124.seq
249914933 gbhtg125.seq
204659559 gbhtg126.seq
249822544 gbhtg127.seq
249934033 gbhtg128.seq
249833638 gbhtg129.seq
249786112 gbhtg13.seq
249984150 gbhtg130.seq
249876826 gbhtg131.seq
249909331 gbhtg132.seq
226166960 gbhtg133.seq
249841524 gbhtg14.seq
249728138 gbhtg15.seq
249897905 gbhtg16.seq
249916268 gbhtg17.seq
249948859 gbhtg18.seq
249980721 gbhtg19.seq
249995175 gbhtg2.seq
249981917 gbhtg20.seq
249962697 gbhtg21.seq
1969518 gbhtg22.seq
249684160 gbhtg23.seq
249675351 gbhtg24.seq
249717424 gbhtg25.seq
249979217 gbhtg26.seq
249920268 gbhtg27.seq
249844470 gbhtg28.seq
249953949 gbhtg29.seq
249928345 gbhtg3.seq
249972102 gbhtg30.seq
249918589 gbhtg31.seq
249755381 gbhtg32.seq
2656099 gbhtg33.seq
249676597 gbhtg34.seq
249895536 gbhtg35.seq
249952321 gbhtg36.seq
249811813 gbhtg37.seq
249900983 gbhtg38.seq
249968137 gbhtg39.seq
249925673 gbhtg4.seq
249858540 gbhtg40.seq
249815821 gbhtg41.seq
249860663 gbhtg42.seq
249738799 gbhtg43.seq
582834 gbhtg44.seq
249971929 gbhtg45.seq
249834661 gbhtg46.seq
249956774 gbhtg47.seq
249839082 gbhtg48.seq
249963460 gbhtg49.seq
249980040 gbhtg5.seq
249787520 gbhtg50.seq
249619294 gbhtg51.seq
249946111 gbhtg52.seq
249738475 gbhtg53.seq
249135690 gbhtg54.seq
249884138 gbhtg55.seq
249829274 gbhtg56.seq
249950134 gbhtg57.seq
249761648 gbhtg58.seq
249987019 gbhtg59.seq
249974518 gbhtg6.seq
21324925 gbhtg60.seq
249812692 gbhtg61.seq
249738037 gbhtg62.seq
249846387 gbhtg63.seq
249905223 gbhtg64.seq
229373446 gbhtg65.seq
249867547 gbhtg66.seq
249821147 gbhtg67.seq
249748908 gbhtg68.seq
249959468 gbhtg69.seq
249851850 gbhtg7.seq
249833907 gbhtg70.seq
19193487 gbhtg71.seq
249955271 gbhtg72.seq
249973586 gbhtg73.seq
249953795 gbhtg74.seq
249872746 gbhtg75.seq
229540315 gbhtg76.seq
249664812 gbhtg77.seq
249995310 gbhtg78.seq
249881017 gbhtg79.seq
249791419 gbhtg8.seq
249754570 gbhtg80.seq
249829940 gbhtg81.seq
5765707 gbhtg82.seq
249974957 gbhtg83.seq
249922868 gbhtg84.seq
249780224 gbhtg85.seq
249998563 gbhtg86.seq
227110095 gbhtg87.seq
249861904 gbhtg88.seq
249863061 gbhtg89.seq
249971606 gbhtg9.seq
249942480 gbhtg90.seq
249984043 gbhtg91.seq
240485988 gbhtg92.seq
249831953 gbhtg93.seq
249959162 gbhtg94.seq
249892088 gbhtg95.seq
249857275 gbhtg96.seq
248690383 gbhtg97.seq
249731895 gbhtg98.seq
249952475 gbhtg99.seq
249921031 gbinv1.seq
249962451 gbinv10.seq
120398195 gbinv11.seq
249997893 gbinv12.seq
249999717 gbinv13.seq
248734464 gbinv14.seq
249852565 gbinv2.seq
232421314 gbinv3.seq
249999406 gbinv4.seq
250000089 gbinv5.seq
248112027 gbinv6.seq
197465683 gbinv7.seq
249998746 gbinv8.seq
249998974 gbinv9.seq
141107173 gbjou1.idx
161437109 gbjou2.idx
204378563 gbjou3.idx
294415360 gbjou4.idx
293054019 gbjou5.idx
166299091 gbjou6.idx
187074631 gbkey1.idx
293838214 gbkey2.idx
64553095 gbkey3.idx
249747504 gbmam1.seq
249999646 gbmam2.seq
249999033 gbmam3.seq
249501241 gbmam4.seq
46102565 gbnew.txt
250000004 gbpat1.seq
250000192 gbpat10.seq
178569709 gbpat11.seq
249999647 gbpat12.seq
249999861 gbpat13.seq
249999054 gbpat14.seq
249998799 gbpat15.seq
249999870 gbpat16.seq
66708391 gbpat17.seq
250000049 gbpat18.seq
250000127 gbpat19.seq
249999480 gbpat2.seq
249999084 gbpat20.seq
249993011 gbpat21.seq
183857133 gbpat22.seq
249999876 gbpat23.seq
249901146 gbpat24.seq
249999869 gbpat25.seq
249999703 gbpat26.seq
70930226 gbpat27.seq
250000240 gbpat28.seq
249997829 gbpat29.seq
249999446 gbpat3.seq
249997798 gbpat30.seq
249998976 gbpat31.seq
249998814 gbpat32.seq
179933903 gbpat33.seq
249997542 gbpat34.seq
249999765 gbpat35.seq
249996681 gbpat36.seq
250000262 gbpat37.seq
249999284 gbpat38.seq
249998765 gbpat39.seq
249999110 gbpat4.seq
249999600 gbpat40.seq
249999794 gbpat41.seq
157220891 gbpat42.seq
249998738 gbpat43.seq
249999246 gbpat44.seq
249999730 gbpat45.seq
249999601 gbpat46.seq
222932013 gbpat47.seq
249999057 gbpat48.seq
249999815 gbpat49.seq
71756414 gbpat5.seq
249999501 gbpat50.seq
249992729 gbpat51.seq
249999960 gbpat52.seq
249999355 gbpat53.seq
42217044 gbpat54.seq
249999879 gbpat55.seq
249999564 gbpat56.seq
249929730 gbpat57.seq
249824878 gbpat58.seq
249998855 gbpat59.seq
249999527 gbpat6.seq
185893732 gbpat60.seq
249999715 gbpat61.seq
249999409 gbpat62.seq
249998956 gbpat63.seq
249953338 gbpat64.seq
211161346 gbpat65.seq
250000211 gbpat7.seq
249994223 gbpat8.seq
250000215 gbpat9.seq
81979637 gbphg1.seq
249998823 gbpln1.seq
249767179 gbpln10.seq
249963112 gbpln11.seq
82670729 gbpln12.seq
249993089 gbpln13.seq
249982135 gbpln14.seq
249998087 gbpln15.seq
242468843 gbpln16.seq
249896648 gbpln17.seq
249792294 gbpln18.seq
216657212 gbpln19.seq
249989098 gbpln2.seq
249163495 gbpln20.seq
249976308 gbpln21.seq
111943415 gbpln22.seq
249996354 gbpln23.seq
94013211 gbpln24.seq
249997754 gbpln25.seq
249117234 gbpln26.seq
249999490 gbpln27.seq
249998748 gbpln28.seq
249995191 gbpln29.seq
249857407 gbpln3.seq
249999236 gbpln30.seq
122053853 gbpln31.seq
249998123 gbpln32.seq
249997056 gbpln33.seq
249996079 gbpln34.seq
249999288 gbpln35.seq
249999607 gbpln36.seq
173984978 gbpln37.seq
249905010 gbpln4.seq
249998417 gbpln5.seq
249998386 gbpln6.seq
26499877 gbpln7.seq
249998422 gbpln8.seq
249992357 gbpln9.seq
148885906 gbpri1.seq
249820729 gbpri10.seq
112694681 gbpri11.seq
249966221 gbpri12.seq
249900325 gbpri13.seq
249891160 gbpri14.seq
249940560 gbpri15.seq
249944401 gbpri16.seq
249922829 gbpri17.seq
249967453 gbpri18.seq
249953793 gbpri19.seq
249919874 gbpri2.seq
249971074 gbpri20.seq
179773910 gbpri21.seq
180000565 gbpri22.seq
249998908 gbpri23.seq
204578310 gbpri24.seq
249924449 gbpri25.seq
249970558 gbpri26.seq
249996315 gbpri27.seq
249906892 gbpri28.seq
249922017 gbpri29.seq
249924474 gbpri3.seq
249918212 gbpri30.seq
249943855 gbpri31.seq
249974179 gbpri32.seq
81914661 gbpri33.seq
249997287 gbpri34.seq
249996575 gbpri35.seq
249613821 gbpri36.seq
249999043 gbpri37.seq
249999821 gbpri38.seq
193329681 gbpri39.seq
249877079 gbpri4.seq
249919524 gbpri5.seq
249989029 gbpri6.seq
249996238 gbpri7.seq
249844007 gbpri8.seq
249863095 gbpri9.seq
333324 gbrel.txt
249925422 gbrod1.seq
249939561 gbrod10.seq
7472079 gbrod11.seq
249932781 gbrod12.seq
249847967 gbrod13.seq
249977548 gbrod14.seq
249846993 gbrod15.seq
249802987 gbrod16.seq
249809664 gbrod17.seq
249999351 gbrod18.seq
39940612 gbrod19.seq
249834637 gbrod2.seq
249937396 gbrod20.seq
249896181 gbrod21.seq
226408693 gbrod22.seq
249999402 gbrod23.seq
249993988 gbrod24.seq
249980894 gbrod25.seq
249988948 gbrod26.seq
249999858 gbrod27.seq
209201751 gbrod28.seq
249713477 gbrod3.seq
249866174 gbrod4.seq
249953902 gbrod5.seq
249851887 gbrod6.seq
249822746 gbrod7.seq
249918516 gbrod8.seq
249980747 gbrod9.seq
1857786054 gbsdr1.txt
4820151102 gbsdr2.txt
1989107330 gbsdr3.txt
150965483 gbsec.idx
249999671 gbsts1.seq
249997362 gbsts10.seq
212226966 gbsts11.seq
249996524 gbsts12.seq
249999267 gbsts13.seq
250000110 gbsts14.seq
249998866 gbsts15.seq
26459034 gbsts16.seq
249998905 gbsts17.seq
249997604 gbsts18.seq
249997948 gbsts19.seq
249999935 gbsts2.seq
108842414 gbsts20.seq
249998948 gbsts3.seq
249996077 gbsts4.seq
28213075 gbsts5.seq
249997222 gbsts6.seq
249997899 gbsts7.seq
249998458 gbsts8.seq
249996448 gbsts9.seq
249997863 gbsyn1.seq
194876599 gbsyn2.seq
108188499 gbtsa1.seq
437307 gbuna1.seq
249996234 gbvrl1.seq
249998874 gbvrl10.seq
85301169 gbvrl11.seq
249998380 gbvrl2.seq
249999661 gbvrl3.seq
249999002 gbvrl4.seq
105236566 gbvrl5.seq
250000082 gbvrl6.seq
249999653 gbvrl7.seq
249997336 gbvrl8.seq
249987109 gbvrl9.seq
249727943 gbvrt1.seq
249767797 gbvrt10.seq
137461875 gbvrt11.seq
249998367 gbvrt12.seq
249889221 gbvrt13.seq
249971115 gbvrt14.seq
249998472 gbvrt15.seq
249998024 gbvrt16.seq
249998337 gbvrt17.seq
75920101 gbvrt18.seq
249997677 gbvrt2.seq
249975226 gbvrt3.seq
219087832 gbvrt4.seq
249996560 gbvrt5.seq
249993774 gbvrt6.seq
249807557 gbvrt7.seq
249890467 gbvrt8.seq
249915029 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 39619 98445667
BCT10 16138 92175540
BCT11 53627 85123823
BCT12 98 108531102
BCT13 151 93984019
BCT14 61 112455059
BCT15 51 108348224
BCT16 46 110993195
BCT17 56 110572060
BCT18 66 108817610
BCT19 36 96325907
BCT2 3251 108309512
BCT20 40 106881287
BCT21 58 105533856
BCT22 74 111675191
BCT23 55 110045255
BCT24 63 106845562
BCT25 57 109770611
BCT26 49 107411541
BCT27 81 110997546
BCT28 64 108238469
BCT29 60 109975664
BCT3 52 109691243
BCT30 134 107904348
BCT31 82 102604697
BCT32 269 102355126
BCT33 24075 60952140
BCT34 25162 27507508
BCT35 50336 53718090
BCT36 77849 79699553
BCT37 33136 98692714
BCT38 12791 28250080
BCT4 14518 106332014
BCT5 23938 37979413
BCT6 39049 87464069
BCT7 6953 91057722
BCT8 13958 92278174
BCT9 4468 107283435
ENV1 92595 69422277
ENV10 85263 88578060
ENV11 82904 86652271
ENV12 82673 69131968
ENV2 90908 71375713
ENV3 85144 80693045
ENV4 89411 85593405
ENV5 102075 65857511
ENV6 743 76725
ENV7 131948 31465558
ENV8 87108 71221691
ENV9 94091 74557776
EST1 68125 26289403
EST10 76524 29834002
EST100 75273 34948115
EST101 75184 43117694
EST102 71174 36578285
EST103 74322 36857144
EST104 73052 40333045
EST105 74352 39471182
EST106 70487 39793131
EST107 68675 36743699
EST108 73289 36590895
EST109 72191 45397348
EST11 75175 28789926
EST110 72195 45800070
EST111 69902 43213450
EST112 72902 33141582
EST113 69576 29413518
EST114 67248 37623231
EST115 68221 36554764
EST116 68480 41661199
EST117 72364 37028375
EST118 75097 34618365
EST119 74539 27230927
EST12 77544 30745583
EST120 73737 34214463
EST121 73873 36004981
EST122 64816 36658625
EST123 80434 44893985
EST124 78196 43234401
EST125 68632 48209410
EST126 67539 39476257
EST127 74495 51032702
EST128 69118 41611327
EST129 74291 44796964
EST13 76983 29267115
EST130 74053 45644494
EST131 71406 49220051
EST132 72736 47905752
EST133 79062 44669739
EST134 75052 31066365
EST135 78151 33867462
EST136 79242 46003472
EST137 74716 42935440
EST138 64510 34827353
EST139 70836 36467326
EST14 78878 31975922
EST140 67720 36970068
EST141 65848 36684622
EST142 71472 43613201
EST143 72624 45487776
EST144 67792 39297423
EST145 68465 39568950
EST146 74672 45407663
EST147 67726 39854882
EST148 62204 35426094
EST149 99517 54171105
EST15 74545 31495394
EST150 79571 45530902
EST151 84388 43920295
EST152 103823 54910787
EST153 104966 57129899
EST154 99161 56458094
EST155 73896 44445532
EST156 94074 55845808
EST157 98855 59177887
EST158 93094 55203696
EST159 78954 44939103
EST16 75885 33356445
EST160 68758 38130661
EST161 66261 30209871
EST162 60449 27744227
EST163 56214 27470384
EST164 65018 31375319
EST165 54461 27400431
EST166 78871 51988236
EST167 67663 37827891
EST168 72068 52279838
EST169 73078 41669353
EST17 82059 33785895
EST170 60185 30298659
EST171 63753 36519872
EST172 65282 34169708
EST173 63705 45567225
EST174 62830 36263926
EST175 106943 47537621
EST176 86699 51300241
EST177 103583 59990166
EST178 107537 59440356
EST179 96736 52224094
EST18 80674 32398580
EST180 82676 38463327
EST181 96496 44601788
EST182 97749 48385453
EST183 93222 37364172
EST184 90646 43215276
EST185 63827 44603596
EST186 70680 37409915
EST187 57507 33424796
EST188 71154 43814598
EST189 72795 27090098
EST19 78687 31698202
EST190 76038 45267797
EST191 72872 36916614
EST192 68464 34910927
EST193 68367 39530297
EST194 69639 51932708
EST195 68628 39698861
EST196 67785 33927325
EST197 69054 52541447
EST198 68146 46611649
EST199 72312 37061770
EST2 74644 28643983
EST20 74622 30764662
EST200 68040 45610826
EST201 70213 58479910
EST202 63810 47397260
EST203 63446 46605031
EST204 63732 46116953
EST205 64785 45816226
EST206 67013 50632948
EST207 61635 40020780
EST208 61849 35780282
EST209 66456 37730884
EST21 74081 34372835
EST210 67975 38255216
EST211 90698 51568315
EST212 72236 50514468
EST213 87767 51742146
EST214 113126 69960062
EST215 115263 68359500
EST216 103715 62404193
EST217 98497 64052138
EST218 118980 56343613
EST219 87102 45531840
EST22 74869 29982206
EST220 85745 52541073
EST221 92540 41985338
EST222 89670 44967950
EST223 73327 48487702
EST224 66750 41022911
EST225 68733 57682118
EST226 68706 59138564
EST227 77769 42849349
EST228 81565 43797510
EST229 73474 52843234
EST23 77388 32710695
EST230 70644 50849688
EST231 51152 29900273
EST232 27984 10641902
EST233 27995 10367295
EST234 26710 9925050
EST235 26943 9190034
EST236 27612 9551933
EST237 27311 10254640
EST238 27387 9800327
EST239 27509 10284213
EST24 74746 32777581
EST240 27339 12085284
EST241 27421 11352863
EST242 27489 10349882
EST243 27801 9431872
EST244 27083 9204750
EST245 27977 11290676
EST246 28029 10868407
EST247 27343 11399098
EST248 26788 11997450
EST249 27268 11485436
EST25 74123 32011033
EST250 27262 10955058
EST251 27221 11609155
EST252 27341 11640052
EST253 27475 11250453
EST254 27476 10902927
EST255 27394 10643004
EST256 27408 10883577
EST257 24797 17419571
EST258 25827 17215412
EST259 41618 19362127
EST26 75149 30992919
EST260 87776 40233729
EST261 76559 44098474
EST262 58902 30635990
EST263 101211 41539281
EST264 70772 42266609
EST265 68773 44584273
EST266 69410 44341491
EST267 69709 43863146
EST268 68983 40488732
EST269 69671 40218555
EST27 74442 32424560
EST270 64868 49380528
EST271 63690 31164073
EST272 85693 42201295
EST273 98283 45945214
EST274 71791 40964276
EST275 64670 32686764
EST276 69708 33602333
EST277 69693 42682617
EST278 74827 34706292
EST279 70801 36542545
EST28 107843 51021980
EST280 71864 46608085
EST281 64264 35549074
EST282 67851 35776062
EST283 84468 45105316
EST284 72581 40144411
EST285 81522 54893027
EST286 82369 53074790
EST287 110354 49043630
EST288 77851 42502155
EST289 73745 45564726
EST29 97114 45861756
EST290 72926 40450372
EST291 70112 34481896
EST292 70139 27306706
EST293 67851 41137202
EST294 62345 35117141
EST295 64622 41472669
EST296 70444 40498589
EST297 64746 44498116
EST298 62938 32277665
EST299 80832 42840000
EST3 73730 29915710
EST30 98652 53904126
EST300 83238 44136905
EST301 81277 50107869
EST302 108569 54260836
EST303 117488 48204024
EST304 72699 35300837
EST305 67342 36447410
EST306 70518 46087317
EST307 81397 40401923
EST308 69888 41663660
EST309 71360 41466664
EST31 86670 50577575
EST310 60146 34155023
EST311 53482 32527316
EST312 66648 42024838
EST313 69748 45844842
EST314 66297 41109545
EST315 69756 40303090
EST316 73732 37512618
EST317 60668 31698835
EST318 55697 28543561
EST319 54622 29113502
EST32 65504 40981489
EST320 54882 29283337
EST321 53735 28858927
EST322 56946 25993861
EST323 58053 25538809
EST324 56909 23579687
EST325 56936 23157938
EST326 57458 21956779
EST327 57918 23609322
EST328 57570 22482322
EST329 57853 21733654
EST33 71114 57761125
EST330 58838 21744728
EST331 74771 44099226
EST332 77280 34815615
EST333 79023 32040686
EST334 76169 32673939
EST335 85672 49441630
EST336 67386 50516494
EST337 70065 47017674
EST338 95918 59365814
EST339 96797 58470659
EST34 84882 48610976
EST340 101663 57328861
EST341 99948 54709493
EST342 77071 41338407
EST343 70466 39659953
EST344 76912 43262091
EST345 62773 55291922
EST346 63895 46107363
EST347 63565 40931791
EST348 61411 34425321
EST349 72492 51361902
EST35 85770 42934909
EST350 50699 27980999
EST351 52778 26185217
EST352 70664 38324983
EST353 60569 32773682
EST354 62503 31411049
EST355 64447 41487696
EST356 84652 43296305
EST357 70244 41779239
EST358 68203 43726779
EST359 67443 37360508
EST36 90243 48682086
EST360 63295 41708150
EST361 86759 50186216
EST362 84354 50004875
EST363 78512 42708325
EST364 63759 37332891
EST365 66155 34198953
EST366 73743 40446935
EST367 46772 24285782
EST368 67304 38003635
EST369 69121 42363373
EST37 86879 61548320
EST370 98797 45756651
EST371 74970 45078984
EST372 71512 47253035
EST373 71572 46031365
EST374 62759 35813561
EST375 74890 36523788
EST376 82518 37877038
EST377 58051 41146062
EST378 53671 38058336
EST379 64349 37273061
EST38 76923 50430091
EST380 85852 51784450
EST381 87979 47968793
EST382 68054 42401681
EST383 78003 41455201
EST384 55185 36015886
EST385 43608 22190035
EST386 62640 39361189
EST387 82104 43245949
EST388 77691 46322989
EST389 72611 44970164
EST39 95533 56124198
EST390 79275 47034898
EST391 76763 49214748
EST392 88893 62606794
EST393 49770 47488840
EST394 43203 36962684
EST395 89855 53414907
EST396 84271 40165878
EST397 79011 38260109
EST398 55636 38224649
EST399 55032 43284327
EST4 74560 28391201
EST40 63824 49141951
EST400 72478 45958503
EST401 63039 40606190
EST402 67963 38918296
EST403 62934 36882023
EST404 65933 32383565
EST405 79622 25589456
EST406 74512 40091922
EST407 67405 39935658
EST408 65136 32564773
EST409 74623 46137603
EST41 78040 55105480
EST410 71308 47165566
EST411 65721 40957069
EST412 68187 43363309
EST413 62134 34654160
EST414 69611 42122817
EST415 73413 45921084
EST416 80436 49131716
EST417 84945 47751130
EST418 61043 39348544
EST419 55982 40804563
EST42 101375 48387599
EST420 56802 39975741
EST421 58940 40226651
EST422 78465 48158380
EST423 55191 32235271
EST424 53181 35115386
EST425 65030 41187610
EST426 58184 41095994
EST427 60147 41857381
EST428 50936 36148444
EST429 63492 40476328
EST43 75537 45740396
EST430 88110 39938115
EST431 70492 38934675
EST432 70678 38581527
EST433 70464 39345629
EST434 70552 38737345
EST435 70307 39408494
EST436 70164 38910970
EST437 69797 38879728
EST438 69658 39428663
EST439 69850 39130508
EST44 105089 44842203
EST440 67966 38478113
EST441 69873 38268686
EST442 70266 39722426
EST443 70263 38993305
EST444 70251 38195229
EST445 70692 38736778
EST446 70638 38879090
EST447 70538 38786881
EST448 70774 38460185
EST449 71960 37544730
EST45 92386 51423354
EST450 92314 53816285
EST451 82661 37001972
EST452 99152 55994293
EST453 87991 49537835
EST454 74391 44738032
EST455 83996 50761782
EST456 76660 39775828
EST457 91053 56044894
EST458 98612 60427898
EST459 79722 46640645
EST46 103502 45865997
EST460 88705 48739151
EST461 88638 51430451
EST462 76948 57324929
EST463 91768 53734934
EST464 78134 48914660
EST465 65690 43539824
EST466 101742 63585962
EST467 96554 65997606
EST468 100161 63994481
EST469 111952 44941621
EST47 70160 19062003
EST470 97788 48745651
EST471 58265 40562762
EST472 51389 40232173
EST473 74519 44780633
EST474 59373 36072073
EST475 75343 44876215
EST476 115475 57813226
EST477 76006 46349146
EST478 82188 59172241
EST479 49420 27397460
EST48 70453 18746054
EST480 46707 45450683
EST481 46404 58893125
EST482 75564 55025518
EST483 63028 37582335
EST484 72103 43367439
EST485 71791 41165044
EST486 67635 44110529
EST487 64272 48897188
EST488 76193 45801076
EST489 109188 47935845
EST49 73004 21781880
EST490 87491 51339989
EST491 62940 43078243
EST492 56665 41261414
EST493 56220 38032524
EST494 65796 47557093
EST495 64903 45672220
EST496 62819 46151101
EST497 52185 37074951
EST498 51823 38200022
EST499 59691 42542794
EST5 48193 15292118
EST50 44094 12165142
EST500 61835 35507653
EST501 71299 45018107
EST502 57381 38200093
EST503 57181 39688358
EST504 62428 46452008
EST505 60144 46255599
EST506 70513 45886667
EST507 49826 39782726
EST508 58117 39404706
EST509 53125 34816741
EST51 44040 12204029
EST510 58056 40085811
EST511 57542 36629575
EST512 73945 44614048
EST513 69105 58471823
EST514 68780 49894054
EST515 74429 51306835
EST516 46163 58583809
EST517 56869 49546830
EST518 67191 46589450
EST519 61671 40694818
EST52 43820 11896636
EST520 77481 44919333
EST521 83054 53439745
EST522 82859 52431015
EST523 69514 41617569
EST524 63374 39165950
EST525 71586 49817578
EST526 80643 49929572
EST527 77755 60596768
EST528 69226 47417504
EST529 71872 49817674
EST53 63753 24263518
EST530 67157 46986236
EST531 60366 48379561
EST532 62711 45582513
EST533 79918 44490589
EST534 71840 42101616
EST535 113672 46008076
EST536 113365 49969588
EST537 76271 49257729
EST538 50574 49868991
EST539 62927 46276139
EST54 96695 39152593
EST540 97721 13854655
EST541 99743 10984440
EST542 99131 22917276
EST543 89155 38124597
EST544 86879 31661720
EST545 80791 42783653
EST546 65139 60583514
EST547 91124 55890959
EST548 80999 44612310
EST549 67443 43767041
EST55 96996 42467616
EST550 72091 47279320
EST551 74707 49555461
EST552 86052 50947884
EST553 72701 53039637
EST554 67917 47818584
EST555 71237 54373563
EST556 84665 51601976
EST557 84587 45528532
EST558 82782 45455999
EST559 84597 39933246
EST56 97643 47025744
EST560 81958 44609534
EST561 77208 52193364
EST562 72734 55563565
EST563 73971 51554353
EST564 79880 44675682
EST565 102623 47834721
EST566 111614 48217104
EST567 118652 49732115
EST568 130659 59335542
EST569 96223 53809089
EST57 92597 46566573
EST570 79657 53702643
EST571 80000 25094995
EST572 84289 8750603
EST573 100083 38627665
EST574 117048 57763649
EST575 106685 52204516
EST576 66260 44349063
EST577 70580 41361245
EST578 72719 50678088
EST579 74023 44252219
EST58 103243 50952553
EST580 74969 45866818
EST581 70604 47665702
EST582 70325 52063805
EST583 96948 54770008
EST584 92806 46194636
EST585 65701 39166453
EST586 63813 45244719
EST587 89356 55862956
EST588 94888 55975118
EST589 75444 43630655
EST59 106796 54846583
EST590 80762 34713436
EST591 96836 10350479
EST592 96863 10301352
EST593 95533 16812938
EST594 69564 44787200
EST595 93327 46664348
EST596 77131 49274450
EST597 76221 52533015
EST598 84761 53805372
EST599 78756 50671600
EST6 54905 17436848
EST60 76034 33349096
EST600 77719 51848627
EST601 77909 45427657
EST602 87224 52909047
EST603 74619 43324122
EST604 69123 49158527
EST605 55844 35651817
EST606 107321 32902747
EST607 62425 40041626
EST608 51070 32385155
EST609 51308 33233478
EST61 66766 28459023
EST610 52702 36830264
EST611 76249 49201626
EST612 65582 46914125
EST613 96048 29009953
EST614 122590 11127797
EST615 118236 14517641
EST616 122483 11289449
EST617 120693 12522113
EST618 65767 47093426
EST619 63842 49698871
EST62 72615 32629523
EST620 74513 48704904
EST621 78800 50420762
EST622 67882 49054899
EST623 76497 44850311
EST624 62718 41751659
EST625 68138 41064893
EST626 103339 27712741
EST627 127260 11747791
EST628 99365 26050437
EST629 79824 48248270
EST63 70606 29950663
EST630 69518 51908686
EST631 79491 46089003
EST632 85861 47670365
EST633 82688 53722962
EST634 58650 30699056
EST635 73767 42962286
EST636 71166 59579532
EST637 88341 48172270
EST638 107458 50972060
EST639 69127 49380517
EST64 79585 32613333
EST640 61157 48491489
EST641 68840 55451422
EST642 74247 34918595
EST643 84752 52047258
EST644 88631 52506803
EST645 83729 37566209
EST646 71374 47280540
EST647 71885 50338193
EST648 81924 51796075
EST649 77950 29177639
EST65 77468 30384948
EST650 76924 26006146
EST651 77538 25575440
EST652 74933 29983050
EST653 77145 25660501
EST654 75737 30705563
EST655 76474 28760892
EST656 75608 28091210
EST657 76402 28703033
EST658 76621 29278616
EST659 76279 31236018
EST66 70312 28257710
EST660 78888 46337041
EST661 81616 57635722
EST662 81937 59834927
EST663 83855 53547011
EST664 62191 32380406
EST665 59884 40279061
EST666 79034 45081404
EST667 47931 26295798
EST668 43604 35543260
EST669 58856 44804883
EST67 64547 29563459
EST670 58387 45008540
EST671 68434 46912822
EST672 80004 39267474
EST673 65110 41546403
EST674 91792 49088858
EST675 72495 42922113
EST676 65036 42964874
EST677 79276 51181420
EST678 77592 41586773
EST679 62707 38317663
EST68 73116 32558178
EST680 71940 50238239
EST681 72264 46178749
EST682 61191 42883289
EST683 70733 52231309
EST684 72127 46942662
EST685 74219 46057302
EST686 68529 48757386
EST687 71397 54099049
EST688 81507 70006229
EST689 82258 69026905
EST69 79304 35581806
EST690 79327 61306740
EST691 77328 39017904
EST692 71295 32347108
EST693 54248 32032483
EST694 67214 47727359
EST695 63605 40445648
EST696 66252 48872245
EST697 67835 45174471
EST698 58590 39171851
EST699 55151 37975286
EST7 74531 29353676
EST70 73577 29310685
EST700 63765 42604009
EST701 69032 44334635
EST702 65456 44748029
EST703 65768 46206224
EST704 66137 44963394
EST705 70638 45827407
EST706 76772 55423120
EST707 68096 39512271
EST708 68224 35953220
EST709 66766 39754593
EST71 73713 25115873
EST710 68172 38035850
EST711 68351 40680657
EST712 71230 58131043
EST713 71425 46813633
EST714 62253 37261008
EST715 78793 46449525
EST716 66782 42218810
EST717 63503 44437039
EST718 65445 36754378
EST719 61701 39143716
EST72 86938 42129352
EST720 64697 40550467
EST721 78991 49694252
EST722 100634 51881394
EST723 87966 43529905
EST724 61668 36882025
EST725 54168 27941954
EST726 51069 32252482
EST727 56093 36040358
EST728 58519 40728574
EST729 60072 38269326
EST73 44226 12876694
EST730 61353 37835545
EST731 65537 41684301
EST732 55958 35023190
EST733 52472 32897119
EST734 66977 40760949
EST735 85334 38586131
EST736 117275 37288887
EST737 80616 39411957
EST738 74465 28658101
EST739 76929 42483114
EST74 40872 11252491
EST740 63959 42932802
EST741 82439 47313835
EST742 77858 48303109
EST743 67892 44031062
EST744 78199 43341066
EST745 57374 38696734
EST746 57868 37478595
EST747 60774 41711916
EST748 59759 39271335
EST749 60117 38389180
EST75 40856 12507750
EST750 62778 42255354
EST751 82131 49179475
EST752 90726 62899211
EST753 68757 44701998
EST754 77432 43741619
EST755 64831 29855319
EST756 58717 32141042
EST757 86611 50323697
EST758 80393 58888849
EST759 77519 59122199
EST76 41226 12732698
EST760 48191 31503498
EST761 32398 19844649
EST762 32682 19344021
EST763 32557 19311085
EST764 63685 32316429
EST765 64592 38225218
EST766 58781 35109337
EST767 58673 35378329
EST768 59197 34067766
EST769 68217 24783804
EST77 41264 12320742
EST770 70976 14773146
EST771 71193 14215071
EST772 70819 15091826
EST773 71351 13846569
EST774 70750 15253912
EST775 73708 42190491
EST776 89827 51854401
EST777 88405 55687804
EST778 113047 52962823
EST779 113745 52138390
EST78 41248 13354376
EST780 113960 51879081
EST781 113865 52012115
EST782 94072 49736457
EST783 67185 42674410
EST784 66946 43932004
EST785 60249 39818113
EST786 60771 38370599
EST787 62062 39747749
EST788 62198 36836944
EST789 69347 40778746
EST79 41022 12967436
EST790 82998 51010586
EST791 80881 53146626
EST792 78810 33904478
EST793 63208 33154880
EST794 83885 43539680
EST795 77554 35891845
EST796 75269 6046673
EST797 75789 5815795
EST798 73758 5878371
EST799 69052 6237655
EST8 75810 30584188
EST80 41022 12322631
EST800 69430 6904763
EST801 71093 14449744
EST802 70820 15089240
EST803 71155 14306699
EST804 71322 13913528
EST805 70838 15045801
EST806 71332 13889815
EST807 68829 27337847
EST808 65691 43702747
EST809 66021 40058997
EST81 40608 12104694
EST810 86656 47313600
EST811 86451 57468648
EST812 70375 49232354
EST813 72833 51012595
EST814 79333 43559026
EST815 73006 47961032
EST816 73517 52919880
EST817 66796 43524932
EST818 61135 42077826
EST819 63573 44673819
EST82 41346 12916581
EST820 63586 45661543
EST821 67723 46165749
EST822 64904 39508157
EST823 76044 57787910
EST824 77646 60455654
EST825 55912 34961530
EST826 71231 46715146
EST827 81972 25498763
EST828 75372 11941159
EST829 75367 11966439
EST83 41916 11971789
EST830 73504 21907426
EST831 73574 36795180
EST832 71524 25485226
EST833 73258 27068191
EST834 72340 26361889
EST835 79566 26982670
EST836 72646 26786032
EST837 68233 29224954
EST838 28175 9130534
EST84 41490 13239091
EST85 41352 13044415
EST86 42926 13114405
EST87 46638 17100691
EST88 43388 27249112
EST89 43017 19651560
EST9 77564 29870697
EST90 49364 20229316
EST91 51545 22273469
EST92 51055 22002262
EST93 84065 49711390
EST94 79577 38931267
EST95 72593 27524688
EST96 74461 29287843
EST97 74649 40733023
EST98 77348 40801996
EST99 76814 44069819
GSS1 90430 38662943
GSS10 74787 43607320
GSS100 77153 52288992
GSS101 74876 41893586
GSS102 73303 45860059
GSS103 73626 45046922
GSS104 73386 45471300
GSS105 73314 44699409
GSS106 73806 44750095
GSS107 80850 53979987
GSS108 83478 55583770
GSS109 80253 53368574
GSS11 70802 35983221
GSS110 83781 51161543
GSS111 84007 52414770
GSS112 79866 63704216
GSS113 89195 45918585
GSS114 91176 54695576
GSS115 75591 50163283
GSS116 87581 62417839
GSS117 82482 61296217
GSS118 75435 37731405
GSS119 82014 54981508
GSS12 73150 38495437
GSS120 95150 53302967
GSS121 84690 54604955
GSS122 85147 54475757
GSS123 82785 54168349
GSS124 76244 69444443
GSS125 76017 67352011
GSS126 79740 57032690
GSS127 72569 50207340
GSS128 72525 50053427
GSS129 73052 49179493
GSS13 76795 38906116
GSS130 72272 50532205
GSS131 72848 49448235
GSS132 84207 59798338
GSS133 81570 58237005
GSS134 71173 56818093
GSS135 69370 54502841
GSS136 76003 67405067
GSS137 75134 64191881
GSS138 77791 52240612
GSS139 84472 53328934
GSS14 71379 32114760
GSS140 94540 58273302
GSS141 93479 59663600
GSS142 81864 54441668
GSS143 91438 49403668
GSS144 71185 61013112
GSS145 113859 58721017
GSS146 111951 58051213
GSS147 81541 58660340
GSS148 60027 37043223
GSS149 65339 44847525
GSS15 70493 35055254
GSS150 72889 55870580
GSS151 72986 55913938
GSS152 72999 55891267
GSS153 73006 55877910
GSS154 72975 55929930
GSS155 72985 55914569
GSS156 76440 59395042
GSS157 81600 37612301
GSS158 87572 59564765
GSS159 88978 63190315
GSS16 78213 46093569
GSS160 85589 61840087
GSS161 93855 58724369
GSS162 82377 55631866
GSS163 77475 51622751
GSS164 73873 46942305
GSS165 92616 58648790
GSS166 90981 59801751
GSS167 84523 61269321
GSS168 99194 31082870
GSS169 106848 22488181
GSS17 70895 33315071
GSS170 78156 49289740
GSS171 83017 53560139
GSS172 55866 40586380
GSS173 50318 37750629
GSS174 62623 52397689
GSS175 59011 45514213
GSS176 57910 48087980
GSS177 57498 48764488
GSS178 58104 46864850
GSS179 58370 46067120
GSS18 58792 27918452
GSS180 58895 47573893
GSS181 58975 48339200
GSS182 58563 49611947
GSS183 58344 48506122
GSS184 58620 46124420
GSS185 58496 49051108
GSS186 60057 50461791
GSS187 60323 49708240
GSS188 60479 49247627
GSS189 60307 49767491
GSS19 56814 29015258
GSS190 60568 48981460
GSS191 60184 47489580
GSS192 59126 45434141
GSS193 58600 47096146
GSS194 58897 46166124
GSS195 58865 46268926
GSS196 58358 47857263
GSS197 58266 48144906
GSS198 58215 48303023
GSS199 59937 49775241
GSS2 89000 39334171
GSS20 57683 26671178
GSS200 59826 50913546
GSS201 59783 49956125
GSS202 60583 46034177
GSS203 60517 46249292
GSS204 59353 49843249
GSS205 59557 49220109
GSS206 59556 49224490
GSS207 59447 49555268
GSS208 59522 49325581
GSS209 59562 49205274
GSS21 61491 29519987
GSS210 59711 48752502
GSS211 59641 48965443
GSS212 59823 48412044
GSS213 59000 46434084
GSS214 58892 45911683
GSS215 58471 47365644
GSS216 58216 48239868
GSS217 58805 46210446
GSS218 57860 48083779
GSS219 63524 53343149
GSS22 64602 37591837
GSS220 64816 54771086
GSS221 87010 58527418
GSS222 86806 45793287
GSS223 76495 58006741
GSS224 81724 54274501
GSS225 93016 52069871
GSS226 75566 50426548
GSS227 71275 47094648
GSS228 71249 47158889
GSS229 91602 51067125
GSS23 57530 27078431
GSS230 101587 62687079
GSS231 87084 56933507
GSS232 96370 62265483
GSS233 94695 64347896
GSS234 96632 61941218
GSS235 95265 63548800
GSS236 93910 65107785
GSS237 93692 65372477
GSS238 94364 64543522
GSS239 94879 63898172
GSS24 66204 42045465
GSS240 92753 66547982
GSS241 93155 66045163
GSS242 93394 65755004
GSS243 92534 67056989
GSS244 93327 64417292
GSS245 91021 68995136
GSS246 90023 69955200
GSS247 73768 55328268
GSS248 64017 37373751
GSS249 55904 35836532
GSS25 68012 28208036
GSS250 71512 41308624
GSS251 77128 38136179
GSS252 80356 34544297
GSS253 13618 4968578
GSS254 87215 64322450
GSS255 83560 62785662
GSS256 103506 48466292
GSS257 68557 58493942
GSS258 7255 6715675
GSS259 68689 57997997
GSS26 58165 25385995
GSS260 69318 56731875
GSS261 69558 56262131
GSS262 71310 56073507
GSS263 68163 51560938
GSS264 75915 58209304
GSS265 87237 74898207
GSS266 81830 44609896
GSS267 92728 44802864
GSS268 56936 44483078
GSS269 77450 61364360
GSS27 65496 32012382
GSS270 69674 58716476
GSS271 67726 62729803
GSS272 62115 53378890
GSS273 95374 42846906
GSS274 21124 4925389
GSS275 112598 70576666
GSS276 1162 860167
GSS277 23226 28867035
GSS278 106545 69076642
GSS279 84506 34579222
GSS28 65277 32524263
GSS280 38340 23887677
GSS281 120690 73137800
GSS282 118608 75280747
GSS283 107827 64313380
GSS284 44875 22452831
GSS285 83122 54662699
GSS286 95854 61476351
GSS287 107385 78564022
GSS288 106112 76516066
GSS289 106101 79982459
GSS29 77560 39751724
GSS290 104023 80029991
GSS291 76699 51240599
GSS292 104177 63042260
GSS293 109868 66415305
GSS294 106304 59376521
GSS295 68468 37495987
GSS296 70288 39120208
GSS297 36242 16959499
GSS298 85481 46023427
GSS299 97119 55907586
GSS3 87422 41844005
GSS30 82722 39709532
GSS300 94941 49578268
GSS301 96269 55917369
GSS302 42190 23639634
GSS303 114638 43642267
GSS304 117085 39368203
GSS305 103278 77900651
GSS306 81613 53566266
GSS307 95891 36542252
GSS308 95417 37268709
GSS309 96671 35161518
GSS31 74196 40403296
GSS310 94285 39167432
GSS311 37736 17626556
GSS312 103939 66277823
GSS313 94551 61190929
GSS314 95128 60357048
GSS315 94773 60868501
GSS316 33134 33073975
GSS317 83875 28283031
GSS318 84362 27389237
GSS319 85085 25924821
GSS32 70296 48150506
GSS320 14410 4314220
GSS321 16547 7508221
GSS322 32110 14916280
GSS33 79819 37806757
GSS34 75886 40326853
GSS35 74137 39965937
GSS36 87407 56321961
GSS37 87597 58175336
GSS38 85527 44938754
GSS39 86748 50382457
GSS4 79227 41150659
GSS40 86338 39890925
GSS41 83128 32053103
GSS42 81246 56934526
GSS43 80119 58036205
GSS44 72015 47522099
GSS45 72042 47418737
GSS46 77593 45700878
GSS47 77817 38710219
GSS48 83136 57946480
GSS49 86562 64736594
GSS5 78819 40567994
GSS50 81619 54415202
GSS51 93859 59286241
GSS52 88468 58760461
GSS53 76598 42227197
GSS54 72837 40526305
GSS55 86497 47027164
GSS56 88038 58467263
GSS57 76195 63888101
GSS58 70809 77994698
GSS59 85505 69015835
GSS6 78088 38842501
GSS60 89580 60228581
GSS61 63450 44798512
GSS62 66010 45382089
GSS63 89643 67177279
GSS64 84960 58429020
GSS65 86085 52989465
GSS66 85463 55672245
GSS67 93346 57853897
GSS68 97857 52536797
GSS69 97528 52972908
GSS7 77657 39174963
GSS70 98228 52048388
GSS71 99183 50781820
GSS72 99205 50753178
GSS73 99077 50923874
GSS74 99695 50102347
GSS75 97770 52652118
GSS76 91867 64654021
GSS77 89865 70740033
GSS78 88925 70111547
GSS79 87858 69635748
GSS8 75881 38134490
GSS80 87908 63986891
GSS81 88312 44882444
GSS82 78277 23271484
GSS83 78145 23584254
GSS84 84149 48917342
GSS85 77098 45548204
GSS86 88958 56028697
GSS87 84342 58665578
GSS88 75464 75654161
GSS89 78488 73099327
GSS9 72240 37167492
GSS90 83987 46687847
GSS91 85043 49406143
GSS92 73869 40395541
GSS93 80113 56218088
GSS94 76470 56904902
GSS95 82996 52876349
GSS96 82955 59175062
GSS97 85633 57672187
GSS98 86989 52202127
GSS99 82271 66179489
HTC1 25181 27238735
HTC10 77317 71981901
HTC11 48993 67612949
HTC12 66997 61008541
HTC13 68495 69600205
HTC14 14416 9280278
HTC2 16162 36527196
HTC3 16149 36808896
HTC4 16389 35873366
HTC5 16090 40456968
HTC6 16183 37872493
HTC7 55450 33944681
HTC8 28838 15503974
HTC9 65502 65512606
HTG1 1317 188816214
HTG10 1297 186286287
HTG100 1055 189273704
HTG101 1076 189543191
HTG102 789 147606980
HTG103 1021 189695564
HTG104 991 189502567
HTG105 998 189429695
HTG106 986 189362399
HTG107 1199 190615351
HTG108 105 15014740
HTG109 1144 189995079
HTG11 9 1245953
HTG110 1058 189852924
HTG111 1415 191568844
HTG112 1475 190168202
HTG113 1133 190375624
HTG114 1106 185711518
HTG115 1620 188255303
HTG116 966 193130291
HTG117 745 168729335
HTG118 1089 193698917
HTG119 1103 193053665
HTG12 1451 183812880
HTG120 444 83026878
HTG121 1035 189495229
HTG122 1070 192088955
HTG123 1117 192038469
HTG124 1154 192364942
HTG125 1099 192783531
HTG126 922 157840964
HTG127 1150 192449089
HTG128 1127 192151791
HTG129 1141 191775000
HTG13 874 191650584
HTG130 1200 192009828
HTG131 1277 191165376
HTG132 1223 191624269
HTG133 1159 172827905
HTG14 749 192110729
HTG15 743 191921974
HTG16 781 192051526
HTG17 803 191886436
HTG18 767 192108035
HTG19 2063 170975488
HTG2 2450 186032194
HTG20 1068 187807593
HTG21 967 189317203
HTG22 6 1514774
HTG23 783 191603739
HTG24 922 190025834
HTG25 901 190315755
HTG26 809 191385146
HTG27 777 191923142
HTG28 865 191139891
HTG29 882 190698357
HTG3 2521 185182868
HTG30 953 189839684
HTG31 896 190966035
HTG32 928 190131907
HTG33 8 2037633
HTG34 869 191018182
HTG35 965 189483972
HTG36 883 191044824
HTG37 861 191237769
HTG38 823 191727728
HTG39 945 190001392
HTG4 2561 188413286
HTG40 931 190596947
HTG41 935 190210055
HTG42 1040 189130068
HTG43 1205 186629025
HTG44 2 447800
HTG45 1260 188090390
HTG46 1173 187815668
HTG47 1151 187889230
HTG48 1118 191276740
HTG49 1271 190652279
HTG5 1284 185519279
HTG50 1177 190961917
HTG51 1129 191051631
HTG52 1037 191355213
HTG53 1019 189616774
HTG54 1120 189398938
HTG55 970 190169796
HTG56 1107 190096598
HTG57 1046 190300011
HTG58 1014 189664607
HTG59 968 189200544
HTG6 1274 185170203
HTG60 92 16208344
HTG61 1010 189318336
HTG62 1030 189823146
HTG63 1067 187350605
HTG64 1128 188162657
HTG65 1011 174017282
HTG66 1086 189582464
HTG67 1066 189417481
HTG68 1170 188701608
HTG69 1174 187595036
HTG7 1275 185326125
HTG70 1286 184359652
HTG71 105 14120535
HTG72 1221 185311372
HTG73 1239 184674446
HTG74 1244 184625496
HTG75 1183 187627905
HTG76 1040 173550426
HTG77 1118 188186640
HTG78 1101 190905728
HTG79 1137 190873267
HTG8 1459 184483094
HTG80 1186 190765939
HTG81 1120 190308789
HTG82 25 4422338
HTG83 1173 190344907
HTG84 1115 190052368
HTG85 1213 189898674
HTG86 1121 189865798
HTG87 1008 172685536
HTG88 1226 188482018
HTG89 1268 187709582
HTG9 1200 186953640
HTG90 1144 190162722
HTG91 1156 189914940
HTG92 1066 182922925
HTG93 1190 189927414
HTG94 1129 190333692
HTG95 1151 190267505
HTG96 1104 190556399
HTG97 1157 190026122
HTG98 1073 190861453
HTG99 1177 191158041
INV1 88084 59752660
INV10 83100 65971384
INV11 41237 31217200
INV12 85921 65001435
INV13 80256 68366456
INV14 37713 105486567
INV2 1597 184882420
INV3 854 148526675
INV4 35502 110653903
INV5 79413 70799415
INV6 27780 121386121
INV7 40843 73832577
INV8 80860 72007210
INV9 60570 87767590
MAM1 12730 165469799
MAM2 52118 111147462
MAM3 32498 125346833
MAM4 80992 74661115
PAT1 222592 70119231
PAT10 124662 102623629
PAT11 98038 63865682
PAT12 141721 62598360
PAT13 105778 59940133
PAT14 103495 50220603
PAT15 121403 53121635
PAT16 112890 61312711
PAT17 39713 16493824
PAT18 147080 52719692
PAT19 154046 77955924
PAT2 194509 84662483
PAT20 104975 118360610
PAT21 133104 95934759
PAT22 84414 77984688
PAT23 123593 103416980
PAT24 119386 105821309
PAT25 145800 86555404
PAT26 175041 64242009
PAT27 71180 1779500
PAT28 102205 77408400
PAT29 93953 87654524
PAT3 171989 95891307
PAT30 119938 61664315
PAT31 96671 78978369
PAT32 128430 55051342
PAT33 92094 51065481
PAT34 111309 78153687
PAT35 138110 29117720
PAT36 158494 24101055
PAT37 114726 49001210
PAT38 88808 90768098
PAT39 107101 72497480
PAT4 153748 106057898
PAT40 100251 75398789
PAT41 160038 12232851
PAT42 77822 35447972
PAT43 135194 108002157
PAT44 167081 97033001
PAT45 116398 127555097
PAT46 196344 76721733
PAT47 80299 127990882
PAT48 27631 180872621
PAT49 185408 93066629
PAT5 57162 23941642
PAT50 274454 6861350
PAT51 202556 46308329
PAT52 132010 90720657
PAT53 82503 91350321
PAT54 57076 1514274
PAT55 342935 8573375
PAT56 188806 88519660
PAT57 111348 132068608
PAT58 3850 194703659
PAT59 131292 110979300
PAT6 170642 91909261
PAT60 154034 52782819
PAT61 227267 32431180
PAT62 250082 15843586
PAT63 171467 69435253
PAT64 140361 94608497
PAT65 159534 72949823
PAT7 154872 88278449
PAT8 131154 97088564
PAT9 129741 101115498
PHG1 4149 33189649
PLN1 59953 93358288
PLN10 36733 73755943
PLN11 14010 137039375
PLN12 7630 35193369
PLN13 17560 144723042
PLN14 17617 146198585
PLN15 17555 146290364
PLN16 23149 127492566
PLN17 3932 153535845
PLN18 1185 170734189
PLN19 495 134850450
PLN2 5077 159858845
PLN20 5 161804357
PLN21 413 169201588
PLN22 20246 50278464
PLN23 67583 69949776
PLN24 28255 30553064
PLN25 77110 76836896
PLN26 57413 89566182
PLN27 9562 138213537
PLN28 25210 133413988
PLN29 77936 75086103
PLN3 1535 182723274
PLN30 94230 63238162
PLN31 40648 32078329
PLN32 80668 72259584
PLN33 78201 76007703
PLN34 82272 70500628
PLN35 96820 66130384
PLN36 93804 66008115
PLN37 36218 64997028
PLN4 1993 190732752
PLN5 15645 153447236
PLN6 76073 79355247
PLN7 7791 8159033
PLN8 73565 76155641
PLN9 37034 49251982
PRI1 23000 59623243
PRI10 1293 179790591
PRI11 677 81616015
PRI12 1278 179183454
PRI13 1451 177770436
PRI14 1589 180081042
PRI15 1591 181937113
PRI16 1285 191750406
PRI17 1138 193709944
PRI18 1099 194284788
PRI19 1167 193628453
PRI2 14216 155416058
PRI20 1914 191587583
PRI21 21048 101941362
PRI22 32471 85298122
PRI23 61498 78361060
PRI24 30544 68472730
PRI25 6599 166943400
PRI26 2121 180859994
PRI27 1605 181682300
PRI28 2030 181855518
PRI29 1978 180698659
PRI3 1442 176076379
PRI30 13085 154633754
PRI31 1290 182850037
PRI32 44510 103535150
PRI33 20778 26548646
PRI34 32258 63794651
PRI35 20317 117929100
PRI36 19116 145712835
PRI37 67542 87517203
PRI38 61518 84793668
PRI39 43210 80543933
PRI4 1291 186566909
PRI5 1305 182845348
PRI6 1189 180931436
PRI7 1242 180909108
PRI8 1230 177748301
PRI9 1346 174678115
ROD1 29504 144857574
ROD10 975 181268212
ROD11 32 5552055
ROD12 1036 185695241
ROD13 941 182821513
ROD14 1038 189314524
ROD15 950 180262138
ROD16 966 181908034
ROD17 994 185933619
ROD18 8576 177712769
ROD19 8537 16576499
ROD2 912 174961028
ROD20 20161 149007208
ROD21 1137 182391172
ROD22 1061 165449321
ROD23 13731 162805392
ROD24 38619 69912056
ROD25 21748 105133042
ROD26 1503 187964614
ROD27 137627 34576660
ROD28 65201 61855407
ROD3 911 173305253
ROD4 901 173922850
ROD5 929 174094986
ROD6 981 179089083
ROD7 956 179726978
ROD8 994 181886274
ROD9 996 182118913
STS1 84833 36485693
STS10 57907 44419978
STS11 49213 37736560
STS12 57924 43637361
STS13 64551 42980742
STS14 93413 34049365
STS15 103343 26267125
STS16 10841 2934356
STS17 102913 27263965
STS18 86856 34266062
STS19 98933 33239270
STS2 84925 49968955
STS20 43321 14181837
STS3 70538 26667728
STS4 73630 37206308
STS5 6080 3577544
STS6 54177 31603126
STS7 54081 31788805
STS8 54235 31906296
STS9 55657 37682948
SYN1 47896 72188115
SYN2 38737 51722377
TSA1 51641 23426202
UNA1 218 117659
VRL1 71945 66546631
VRL10 65460 74561473
VRL11 23899 23327560
VRL2 71615 64700830
VRL3 72243 63668591
VRL4 69608 69334940
VRL5 24596 29507520
VRL6 57654 73508634
VRL7 62336 72706621
VRL8 68341 67502779
VRL9 55142 74558107
VRT1 25488 151200491
VRT10 8904 177126820
VRT11 3112 101363221
VRT12 13268 170678994
VRT13 5187 183174974
VRT14 4021 185963954
VRT15 55598 105860146
VRT16 79986 69234919
VRT17 78322 67197718
VRT18 22601 24037643
VRT2 38812 136201031
VRT3 34926 133166976
VRT4 37871 105644411
VRT5 73001 66792369
VRT6 31746 63585286
VRT7 20997 133151998
VRT8 1221 189843295
VRT9 1271 189205637
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 170.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:
Entries Bases Species
12356641 13434048990 Homo sapiens
7279663 8413454413 Mus musculus
1761820 6062786202 Rattus norvegicus
2087489 5248593559 Bos taurus
3785081 4959749043 Zea mays
2549469 3917008407 Sus scrofa
1686074 3048930986 Danio rerio
1213939 1545075149 Oryza sativa Japonica Group
228118 1352796133 Strongylocentrotus purpuratus
1423013 1146676820 Xenopus (Silurana) tropicalis
1675719 1144359189 Nicotiana tabacum
1195886 1032101570 Drosophila melanogaster
213067 997314145 Pan troglodytes
2230397 938991402 Arabidopsis thaliana
1433313 927847792 Canis lupus familiaris
651273 906384104 Vitis vinifera
805911 878632145 Gallus gallus
77877 805813840 Macaca mulatta
1216101 748118121 Ciona intestinalis
1780681 720743480 Glycine max
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
February 15 2009
NCBI-GenBank Flat File Release 170.0
Bacterial Sequences (Part 1)
25389 loci, 102437874 bases, from 25389 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
or 2010.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 PROJECT Format
This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
PROJECT GenomeProject:18787
A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second
contains the actual project identifier ("18787").
PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:
http://www.ncbi.nlm.nih.gov/genomes/static/gprj_help.html#introduction
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 170.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
Andrea Gocke, Anjanette Johnston, Mark Landree, Richard McVeigh,
Ilene Mizrachi, DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,
Gert Roosen, Susan Schafer, Melissa Wright, and Linda Yankie
Data Management and Preparation
Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
Eugene Yaschenko, Sergey Zhdanov
Database Administration
Slava Khotomliansky, Igor Lozitskiy, Ben Slade, Constantin Vasilyev
User Support
Medha Bhagwat, Peter Cooper, Wayne Matten, Scott McGinnis, Monica Romiti,
Eric Sayers, Tao Tao, Majda Valjavec-Gratian
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
