Release Notes For GenBank Release 177
GBREL.TXT Genetic Sequence Data Bank
April 15 2010
NCBI-GenBank Flat File Release 177.0
Distribution Release Notes
119112251 loci, 114348888771 bases, from 119112251 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 177.0
1.2 Cutoff Date
1.3 Important Changes in Release 177.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 177.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for GenBank's web-based submission tool (BankIt) :
http://www.ncbi.nlm.nih.gov/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 177.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana, courtesy of the Bio-Mirror project:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:
http://www.bio-mirror.net/
1.2 Cutoff Date
This full release, 177.0, incorporates data available to the collaborating
databases as of April 14, 2010 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 177.0
1.3.1 Organizational changes
The total number of sequence data files increased by 29 with this release:
- the BCT division is now composed of 54 files (+2)
- the CON division is now composed of 136 files (+2)
- the ENV division is now composed of 24 files (+1)
- the EST division is now composed of 413 files (+3)
- the GSS division is now composed of 211 files (+3)
- the INV division is now composed of 21 files (+2)
- the PAT division is now composed of 115 files (+15)
- the PLN division is now composed of 40 files (+1)
1.3.2 New /pseudogene and /non_functional qualifiers : Delayed!
New /pseudogene and /non_functional qualifiers were scheduled to
become legal for the GenBank Feature Table as of this April 2010
GenBank release. The intial plan was to simply rename /pseudo :
"Because the term "pseudo" is often assumed to mean 'pseudogene',
the /pseudo qualifier will be renamed as /non_functional, to
better reflect its actual usage in the sequence databases."
During subsequent discussions among the INSDC members, it was
decided that a more conservative course would be to introduce two
new qualifiers:
/pseudogene
/non_functional
However, implementation of this decision has proved to be complex
for two of the INSDC partners (including GenBank), and the costs of
the proposed change are quite high. So at the very least, implementation
will be further delayed, by at least two months. And the decision to
introduce the new qualifiers will be re-examined at the May 2010
INSDC collaborative meeting, to decide if the implementation costs
really warrant the change.
In the meantime, the /pseudo qualifier will continue to be used, in
all the same contexts as previously.
1.3.3 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.4 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
ninety of the GSS flatfiles in Release 177.0. Consider gbgss122.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
April 15 2010
NCBI-GenBank Flat File Release 177.0
GSS Sequences (Part 1)
87168 loci, 64172121 bases, from 87168 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "122" based on the number of files dumped from the other
system. We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.
1.4 Upcoming Changes
There are no planned format changes for GenBank at the present time.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1398 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut8.idx - Index of the entries according to author name, part 8.
76. gbaut9.idx - Index of the entries according to author name, part 9.
77. gbbct1.seq - Bacterial sequence entries, part 1.
78. gbbct10.seq - Bacterial sequence entries, part 10.
79. gbbct11.seq - Bacterial sequence entries, part 11.
80. gbbct12.seq - Bacterial sequence entries, part 12.
81. gbbct13.seq - Bacterial sequence entries, part 13.
82. gbbct14.seq - Bacterial sequence entries, part 14.
83. gbbct15.seq - Bacterial sequence entries, part 15.
84. gbbct16.seq - Bacterial sequence entries, part 16.
85. gbbct17.seq - Bacterial sequence entries, part 17.
86. gbbct18.seq - Bacterial sequence entries, part 18.
87. gbbct19.seq - Bacterial sequence entries, part 19.
88. gbbct2.seq - Bacterial sequence entries, part 2.
89. gbbct20.seq - Bacterial sequence entries, part 20.
90. gbbct21.seq - Bacterial sequence entries, part 21.
91. gbbct22.seq - Bacterial sequence entries, part 22.
92. gbbct23.seq - Bacterial sequence entries, part 23.
93. gbbct24.seq - Bacterial sequence entries, part 24.
94. gbbct25.seq - Bacterial sequence entries, part 25.
95. gbbct26.seq - Bacterial sequence entries, part 26.
96. gbbct27.seq - Bacterial sequence entries, part 27.
97. gbbct28.seq - Bacterial sequence entries, part 28.
98. gbbct29.seq - Bacterial sequence entries, part 29.
99. gbbct3.seq - Bacterial sequence entries, part 3.
100. gbbct30.seq - Bacterial sequence entries, part 30.
101. gbbct31.seq - Bacterial sequence entries, part 31.
102. gbbct32.seq - Bacterial sequence entries, part 32.
103. gbbct33.seq - Bacterial sequence entries, part 33.
104. gbbct34.seq - Bacterial sequence entries, part 34.
105. gbbct35.seq - Bacterial sequence entries, part 35.
106. gbbct36.seq - Bacterial sequence entries, part 36.
107. gbbct37.seq - Bacterial sequence entries, part 37.
108. gbbct38.seq - Bacterial sequence entries, part 38.
109. gbbct39.seq - Bacterial sequence entries, part 39.
110. gbbct4.seq - Bacterial sequence entries, part 4.
111. gbbct40.seq - Bacterial sequence entries, part 40.
112. gbbct41.seq - Bacterial sequence entries, part 41.
113. gbbct42.seq - Bacterial sequence entries, part 42.
114. gbbct43.seq - Bacterial sequence entries, part 43.
115. gbbct44.seq - Bacterial sequence entries, part 44.
116. gbbct45.seq - Bacterial sequence entries, part 45.
117. gbbct46.seq - Bacterial sequence entries, part 46.
118. gbbct47.seq - Bacterial sequence entries, part 47.
119. gbbct48.seq - Bacterial sequence entries, part 48.
120. gbbct49.seq - Bacterial sequence entries, part 49.
121. gbbct5.seq - Bacterial sequence entries, part 5.
122. gbbct50.seq - Bacterial sequence entries, part 50.
123. gbbct51.seq - Bacterial sequence entries, part 51.
124. gbbct52.seq - Bacterial sequence entries, part 52.
125. gbbct53.seq - Bacterial sequence entries, part 53.
126. gbbct54.seq - Bacterial sequence entries, part 54.
127. gbbct6.seq - Bacterial sequence entries, part 6.
128. gbbct7.seq - Bacterial sequence entries, part 7.
129. gbbct8.seq - Bacterial sequence entries, part 8.
130. gbbct9.seq - Bacterial sequence entries, part 9.
131. gbchg.txt - Accession numbers of entries updated since the previous release.
132. gbcon1.seq - Constructed sequence entries, part 1.
133. gbcon10.seq - Constructed sequence entries, part 10.
134. gbcon100.seq - Constructed sequence entries, part 100.
135. gbcon101.seq - Constructed sequence entries, part 101.
136. gbcon102.seq - Constructed sequence entries, part 102.
137. gbcon103.seq - Constructed sequence entries, part 103.
138. gbcon104.seq - Constructed sequence entries, part 104.
139. gbcon105.seq - Constructed sequence entries, part 105.
140. gbcon106.seq - Constructed sequence entries, part 106.
141. gbcon107.seq - Constructed sequence entries, part 107.
142. gbcon108.seq - Constructed sequence entries, part 108.
143. gbcon109.seq - Constructed sequence entries, part 109.
144. gbcon11.seq - Constructed sequence entries, part 11.
145. gbcon110.seq - Constructed sequence entries, part 110.
146. gbcon111.seq - Constructed sequence entries, part 111.
147. gbcon112.seq - Constructed sequence entries, part 112.
148. gbcon113.seq - Constructed sequence entries, part 113.
149. gbcon114.seq - Constructed sequence entries, part 114.
150. gbcon115.seq - Constructed sequence entries, part 115.
151. gbcon116.seq - Constructed sequence entries, part 116.
152. gbcon117.seq - Constructed sequence entries, part 117.
153. gbcon118.seq - Constructed sequence entries, part 118.
154. gbcon119.seq - Constructed sequence entries, part 119.
155. gbcon12.seq - Constructed sequence entries, part 12.
156. gbcon120.seq - Constructed sequence entries, part 120.
157. gbcon121.seq - Constructed sequence entries, part 121.
158. gbcon122.seq - Constructed sequence entries, part 122.
159. gbcon123.seq - Constructed sequence entries, part 123.
160. gbcon124.seq - Constructed sequence entries, part 124.
161. gbcon125.seq - Constructed sequence entries, part 125.
162. gbcon126.seq - Constructed sequence entries, part 126.
163. gbcon127.seq - Constructed sequence entries, part 127.
164. gbcon128.seq - Constructed sequence entries, part 128.
165. gbcon129.seq - Constructed sequence entries, part 129.
166. gbcon13.seq - Constructed sequence entries, part 13.
167. gbcon130.seq - Constructed sequence entries, part 130.
168. gbcon131.seq - Constructed sequence entries, part 131.
169. gbcon132.seq - Constructed sequence entries, part 132.
170. gbcon133.seq - Constructed sequence entries, part 133.
171. gbcon134.seq - Constructed sequence entries, part 134.
172. gbcon135.seq - Constructed sequence entries, part 135.
173. gbcon136.seq - Constructed sequence entries, part 136.
174. gbcon14.seq - Constructed sequence entries, part 14.
175. gbcon15.seq - Constructed sequence entries, part 15.
176. gbcon16.seq - Constructed sequence entries, part 16.
177. gbcon17.seq - Constructed sequence entries, part 17.
178. gbcon18.seq - Constructed sequence entries, part 18.
179. gbcon19.seq - Constructed sequence entries, part 19.
180. gbcon2.seq - Constructed sequence entries, part 2.
181. gbcon20.seq - Constructed sequence entries, part 20.
182. gbcon21.seq - Constructed sequence entries, part 21.
183. gbcon22.seq - Constructed sequence entries, part 22.
184. gbcon23.seq - Constructed sequence entries, part 23.
185. gbcon24.seq - Constructed sequence entries, part 24.
186. gbcon25.seq - Constructed sequence entries, part 25.
187. gbcon26.seq - Constructed sequence entries, part 26.
188. gbcon27.seq - Constructed sequence entries, part 27.
189. gbcon28.seq - Constructed sequence entries, part 28.
190. gbcon29.seq - Constructed sequence entries, part 29.
191. gbcon3.seq - Constructed sequence entries, part 3.
192. gbcon30.seq - Constructed sequence entries, part 30.
193. gbcon31.seq - Constructed sequence entries, part 31.
194. gbcon32.seq - Constructed sequence entries, part 32.
195. gbcon33.seq - Constructed sequence entries, part 33.
196. gbcon34.seq - Constructed sequence entries, part 34.
197. gbcon35.seq - Constructed sequence entries, part 35.
198. gbcon36.seq - Constructed sequence entries, part 36.
199. gbcon37.seq - Constructed sequence entries, part 37.
200. gbcon38.seq - Constructed sequence entries, part 38.
201. gbcon39.seq - Constructed sequence entries, part 39.
202. gbcon4.seq - Constructed sequence entries, part 4.
203. gbcon40.seq - Constructed sequence entries, part 40.
204. gbcon41.seq - Constructed sequence entries, part 41.
205. gbcon42.seq - Constructed sequence entries, part 42.
206. gbcon43.seq - Constructed sequence entries, part 43.
207. gbcon44.seq - Constructed sequence entries, part 44.
208. gbcon45.seq - Constructed sequence entries, part 45.
209. gbcon46.seq - Constructed sequence entries, part 46.
210. gbcon47.seq - Constructed sequence entries, part 47.
211. gbcon48.seq - Constructed sequence entries, part 48.
212. gbcon49.seq - Constructed sequence entries, part 49.
213. gbcon5.seq - Constructed sequence entries, part 5.
214. gbcon50.seq - Constructed sequence entries, part 50.
215. gbcon51.seq - Constructed sequence entries, part 51.
216. gbcon52.seq - Constructed sequence entries, part 52.
217. gbcon53.seq - Constructed sequence entries, part 53.
218. gbcon54.seq - Constructed sequence entries, part 54.
219. gbcon55.seq - Constructed sequence entries, part 55.
220. gbcon56.seq - Constructed sequence entries, part 56.
221. gbcon57.seq - Constructed sequence entries, part 57.
222. gbcon58.seq - Constructed sequence entries, part 58.
223. gbcon59.seq - Constructed sequence entries, part 59.
224. gbcon6.seq - Constructed sequence entries, part 6.
225. gbcon60.seq - Constructed sequence entries, part 60.
226. gbcon61.seq - Constructed sequence entries, part 61.
227. gbcon62.seq - Constructed sequence entries, part 62.
228. gbcon63.seq - Constructed sequence entries, part 63.
229. gbcon64.seq - Constructed sequence entries, part 64.
230. gbcon65.seq - Constructed sequence entries, part 65.
231. gbcon66.seq - Constructed sequence entries, part 66.
232. gbcon67.seq - Constructed sequence entries, part 67.
233. gbcon68.seq - Constructed sequence entries, part 68.
234. gbcon69.seq - Constructed sequence entries, part 69.
235. gbcon7.seq - Constructed sequence entries, part 7.
236. gbcon70.seq - Constructed sequence entries, part 70.
237. gbcon71.seq - Constructed sequence entries, part 71.
238. gbcon72.seq - Constructed sequence entries, part 72.
239. gbcon73.seq - Constructed sequence entries, part 73.
240. gbcon74.seq - Constructed sequence entries, part 74.
241. gbcon75.seq - Constructed sequence entries, part 75.
242. gbcon76.seq - Constructed sequence entries, part 76.
243. gbcon77.seq - Constructed sequence entries, part 77.
244. gbcon78.seq - Constructed sequence entries, part 78.
245. gbcon79.seq - Constructed sequence entries, part 79.
246. gbcon8.seq - Constructed sequence entries, part 8.
247. gbcon80.seq - Constructed sequence entries, part 80.
248. gbcon81.seq - Constructed sequence entries, part 81.
249. gbcon82.seq - Constructed sequence entries, part 82.
250. gbcon83.seq - Constructed sequence entries, part 83.
251. gbcon84.seq - Constructed sequence entries, part 84.
252. gbcon85.seq - Constructed sequence entries, part 85.
253. gbcon86.seq - Constructed sequence entries, part 86.
254. gbcon87.seq - Constructed sequence entries, part 87.
255. gbcon88.seq - Constructed sequence entries, part 88.
256. gbcon89.seq - Constructed sequence entries, part 89.
257. gbcon9.seq - Constructed sequence entries, part 9.
258. gbcon90.seq - Constructed sequence entries, part 90.
259. gbcon91.seq - Constructed sequence entries, part 91.
260. gbcon92.seq - Constructed sequence entries, part 92.
261. gbcon93.seq - Constructed sequence entries, part 93.
262. gbcon94.seq - Constructed sequence entries, part 94.
263. gbcon95.seq - Constructed sequence entries, part 95.
264. gbcon96.seq - Constructed sequence entries, part 96.
265. gbcon97.seq - Constructed sequence entries, part 97.
266. gbcon98.seq - Constructed sequence entries, part 98.
267. gbcon99.seq - Constructed sequence entries, part 99.
268. gbdel.txt - Accession numbers of entries deleted since the previous release.
269. gbenv1.seq - Environmental sampling sequence entries, part 1.
270. gbenv10.seq - Environmental sampling sequence entries, part 10.
271. gbenv11.seq - Environmental sampling sequence entries, part 11.
272. gbenv12.seq - Environmental sampling sequence entries, part 12.
273. gbenv13.seq - Environmental sampling sequence entries, part 13.
274. gbenv14.seq - Environmental sampling sequence entries, part 14.
275. gbenv15.seq - Environmental sampling sequence entries, part 15.
276. gbenv16.seq - Environmental sampling sequence entries, part 16.
277. gbenv17.seq - Environmental sampling sequence entries, part 17.
278. gbenv18.seq - Environmental sampling sequence entries, part 18.
279. gbenv19.seq - Environmental sampling sequence entries, part 19.
280. gbenv2.seq - Environmental sampling sequence entries, part 2.
281. gbenv20.seq - Environmental sampling sequence entries, part 20.
282. gbenv21.seq - Environmental sampling sequence entries, part 21.
283. gbenv22.seq - Environmental sampling sequence entries, part 22.
284. gbenv23.seq - Environmental sampling sequence entries, part 23.
285. gbenv24.seq - Environmental sampling sequence entries, part 24.
286. gbenv3.seq - Environmental sampling sequence entries, part 3.
287. gbenv4.seq - Environmental sampling sequence entries, part 4.
288. gbenv5.seq - Environmental sampling sequence entries, part 5.
289. gbenv6.seq - Environmental sampling sequence entries, part 6.
290. gbenv7.seq - Environmental sampling sequence entries, part 7.
291. gbenv8.seq - Environmental sampling sequence entries, part 8.
292. gbenv9.seq - Environmental sampling sequence entries, part 9.
293. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
294. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
295. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
296. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
297. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
298. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
299. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
300. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
301. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
302. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
303. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
304. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
305. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
306. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
307. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
308. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
309. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
310. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
311. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
312. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
313. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
314. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
315. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
316. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
317. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
318. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
319. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
320. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
321. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
322. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
323. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
324. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
325. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
326. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
327. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
328. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
329. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
330. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
331. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
332. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
333. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
334. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
335. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
336. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
337. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
338. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
339. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
340. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
341. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
342. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
343. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
344. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
345. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
346. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
347. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
348. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
349. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
350. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
351. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
352. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
353. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
354. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
355. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
356. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
357. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
358. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
359. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
360. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
361. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
362. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
363. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
364. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
365. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
366. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
367. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
368. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
369. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
370. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
371. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
372. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
373. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
374. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
375. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
376. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
377. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
378. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
379. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
380. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
381. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
382. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
383. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
384. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
385. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
386. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
387. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
388. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
389. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
390. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
391. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
392. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
393. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
394. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
395. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
396. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
397. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
398. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
399. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
400. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
401. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
402. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
403. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
404. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
405. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
406. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
407. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
408. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
409. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
410. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
411. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
412. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
413. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
414. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
415. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
416. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
417. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
418. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
419. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
420. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
421. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
422. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
423. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
424. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
425. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
426. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
427. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
428. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
429. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
430. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
431. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
432. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
433. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
434. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
435. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
436. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
437. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
438. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
439. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
440. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
441. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
442. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
443. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
444. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
445. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
446. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
447. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
448. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
449. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
450. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
451. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
452. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
453. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
454. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
455. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
456. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
457. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
458. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
459. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
460. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
461. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
462. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
463. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
464. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
465. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
466. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
467. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
468. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
469. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
470. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
471. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
472. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
473. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
474. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
475. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
476. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
477. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
478. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
479. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
480. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
481. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
482. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
483. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
484. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
485. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
486. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
487. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
488. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
489. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
490. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
491. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
492. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
493. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
494. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
495. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
496. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
497. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
498. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
499. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
500. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
501. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
502. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
503. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
504. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
505. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
506. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
507. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
508. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
509. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
510. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
511. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
512. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
513. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
514. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
515. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
516. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
517. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
518. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
519. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
520. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
521. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
522. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
523. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
524. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
525. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
526. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
527. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
528. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
529. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
530. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
531. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
532. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
533. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
534. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
535. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
536. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
537. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
538. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
539. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
540. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
541. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
542. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
543. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
544. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
545. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
546. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
547. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
548. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
549. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
550. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
551. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
552. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
553. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
554. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
555. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
556. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
557. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
558. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
559. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
560. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
561. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
562. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
563. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
564. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
565. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
566. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
567. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
568. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
569. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
570. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
571. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
572. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
573. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
574. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
575. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
576. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
577. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
578. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
579. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
580. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
581. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
582. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
583. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
584. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
585. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
586. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
587. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
588. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
589. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
590. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
591. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
592. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
593. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
594. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
595. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
596. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
597. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
598. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
599. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
600. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
601. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
602. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
603. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
604. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
605. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
606. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
607. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
608. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
609. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
610. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
611. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
612. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
613. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
614. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
615. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
616. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
617. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
618. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
619. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
620. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
621. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
622. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
623. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
624. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
625. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
626. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
627. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
628. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
629. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
630. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
631. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
632. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
633. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
634. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
635. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
636. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
637. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
638. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
639. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
640. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
641. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
642. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
643. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
644. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
645. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
646. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
647. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
648. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
649. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
650. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
651. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
652. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
653. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
654. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
655. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
656. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
657. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
658. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
659. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
660. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
661. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
662. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
663. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
664. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
665. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
666. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
667. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
668. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
669. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
670. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
671. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
672. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
673. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
674. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
675. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
676. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
677. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
678. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
679. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
680. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
681. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
682. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
683. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
684. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
685. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
686. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
687. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
688. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
689. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
690. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
691. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
692. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
693. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
694. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
695. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
696. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
697. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
698. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
699. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
700. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
701. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
702. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
703. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
704. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
705. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
706. gbgen.idx - Index of the entries according to gene symbols.
707. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
708. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
709. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
710. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
711. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
712. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
713. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
714. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
715. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
716. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
717. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
718. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
719. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
720. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
721. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
722. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
723. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
724. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
725. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
726. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
727. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
728. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
729. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
730. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
731. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
732. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
733. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
734. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
735. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
736. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
737. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
738. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
739. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
740. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
741. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
742. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
743. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
744. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
745. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
746. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
747. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
748. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
749. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
750. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
751. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
752. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
753. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
754. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
755. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
756. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
757. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
758. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
759. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
760. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
761. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
762. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
763. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
764. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
765. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
766. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
767. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
768. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
769. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
770. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
771. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
772. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
773. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
774. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
775. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
776. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
777. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
778. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
779. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
780. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
781. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
782. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
783. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
784. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
785. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
786. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
787. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
788. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
789. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
790. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
791. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
792. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
793. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
794. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
795. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
796. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
797. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
798. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
799. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
800. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
801. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
802. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
803. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
804. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
805. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
806. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
807. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
808. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
809. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
810. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
811. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
812. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
813. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
814. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
815. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
816. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
817. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
818. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
819. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
820. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
821. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
822. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
823. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
824. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
825. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
826. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
827. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
828. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
829. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
830. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
831. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
832. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
833. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
834. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
835. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
836. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
837. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
838. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
839. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
840. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
841. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
842. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
843. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
844. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
845. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
846. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
847. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
848. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
849. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
850. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
851. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
852. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
853. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
854. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
855. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
856. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
857. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
858. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
859. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
860. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
861. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
862. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
863. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
864. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
865. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
866. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
867. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
868. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
869. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
870. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
871. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
872. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
873. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
874. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
875. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
876. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
877. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
878. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
879. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
880. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
881. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
882. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
883. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
884. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
885. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
886. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
887. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
888. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
889. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
890. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
891. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
892. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
893. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
894. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
895. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
896. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
897. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
898. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
899. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
900. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
901. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
902. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
903. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
904. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
905. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
906. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
907. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
908. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
909. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
910. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
911. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
912. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
913. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
914. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
915. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
916. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
917. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
918. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
919. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
920. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
921. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
922. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
923. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
924. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
925. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
926. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
927. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
928. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
929. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
930. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
931. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
932. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
933. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
934. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
935. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
936. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
937. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
938. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
939. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
940. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
941. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
942. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
943. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
944. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
945. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
946. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
947. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
948. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
949. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
950. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
951. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
952. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
953. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
954. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
955. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
956. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
957. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
958. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
959. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
960. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
961. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
962. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
963. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
964. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
965. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
966. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
967. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
968. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
969. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
970. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
971. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
972. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
973. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
974. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
975. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
976. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
977. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
978. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
979. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
980. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
981. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
982. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
983. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
984. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
985. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
986. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
987. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
988. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
989. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
990. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
991. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
992. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
993. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
994. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
995. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
996. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
997. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
998. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
999. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1000. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1001. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1002. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1003. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1004. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1005. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1006. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1007. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1008. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1009. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1010. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1011. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1012. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1013. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1014. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1015. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1016. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1017. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1018. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1019. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1020. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1021. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1022. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1023. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1024. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1025. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1026. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1027. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1028. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1029. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1030. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1031. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1032. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1033. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1034. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1035. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1036. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1037. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1038. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1039. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1040. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1041. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1042. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1043. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1044. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1045. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1046. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1047. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1048. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1049. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1050. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1051. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1052. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1053. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1054. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1055. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1056. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1057. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1058. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1059. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1060. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1061. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1062. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1063. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1064. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1065. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1066. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1067. gbinv1.seq - Invertebrate sequence entries, part 1.
1068. gbinv10.seq - Invertebrate sequence entries, part 10.
1069. gbinv11.seq - Invertebrate sequence entries, part 11.
1070. gbinv12.seq - Invertebrate sequence entries, part 12.
1071. gbinv13.seq - Invertebrate sequence entries, part 13.
1072. gbinv14.seq - Invertebrate sequence entries, part 14.
1073. gbinv15.seq - Invertebrate sequence entries, part 15.
1074. gbinv16.seq - Invertebrate sequence entries, part 16.
1075. gbinv17.seq - Invertebrate sequence entries, part 17.
1076. gbinv18.seq - Invertebrate sequence entries, part 18.
1077. gbinv19.seq - Invertebrate sequence entries, part 19.
1078. gbinv2.seq - Invertebrate sequence entries, part 2.
1079. gbinv20.seq - Invertebrate sequence entries, part 20.
1080. gbinv21.seq - Invertebrate sequence entries, part 21.
1081. gbinv3.seq - Invertebrate sequence entries, part 3.
1082. gbinv4.seq - Invertebrate sequence entries, part 4.
1083. gbinv5.seq - Invertebrate sequence entries, part 5.
1084. gbinv6.seq - Invertebrate sequence entries, part 6.
1085. gbinv7.seq - Invertebrate sequence entries, part 7.
1086. gbinv8.seq - Invertebrate sequence entries, part 8.
1087. gbinv9.seq - Invertebrate sequence entries, part 9.
1088. gbjou1.idx - Index of the entries according to journal citation, part 1.
1089. gbjou2.idx - Index of the entries according to journal citation, part 2.
1090. gbjou3.idx - Index of the entries according to journal citation, part 3.
1091. gbjou4.idx - Index of the entries according to journal citation, part 4.
1092. gbjou5.idx - Index of the entries according to journal citation, part 5.
1093. gbjou6.idx - Index of the entries according to journal citation, part 6.
1094. gbjou7.idx - Index of the entries according to journal citation, part 7.
1095. gbjou8.idx - Index of the entries according to journal citation, part 8.
1096. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1097. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1098. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1099. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1100. gbmam1.seq - Other mammalian sequence entries, part 1.
1101. gbmam2.seq - Other mammalian sequence entries, part 2.
1102. gbmam3.seq - Other mammalian sequence entries, part 3.
1103. gbmam4.seq - Other mammalian sequence entries, part 4.
1104. gbmam5.seq - Other mammalian sequence entries, part 5.
1105. gbmam6.seq - Other mammalian sequence entries, part 6.
1106. gbnew.txt - Accession numbers of entries new since the previous release.
1107. gbpat1.seq - Patent sequence entries, part 1.
1108. gbpat10.seq - Patent sequence entries, part 10.
1109. gbpat100.seq - Patent sequence entries, part 100.
1110. gbpat101.seq - Patent sequence entries, part 101.
1111. gbpat102.seq - Patent sequence entries, part 102.
1112. gbpat103.seq - Patent sequence entries, part 103.
1113. gbpat104.seq - Patent sequence entries, part 104.
1114. gbpat105.seq - Patent sequence entries, part 105.
1115. gbpat106.seq - Patent sequence entries, part 106.
1116. gbpat107.seq - Patent sequence entries, part 107.
1117. gbpat108.seq - Patent sequence entries, part 108.
1118. gbpat109.seq - Patent sequence entries, part 109.
1119. gbpat11.seq - Patent sequence entries, part 11.
1120. gbpat110.seq - Patent sequence entries, part 110.
1121. gbpat111.seq - Patent sequence entries, part 111.
1122. gbpat112.seq - Patent sequence entries, part 112.
1123. gbpat113.seq - Patent sequence entries, part 113.
1124. gbpat114.seq - Patent sequence entries, part 114.
1125. gbpat115.seq - Patent sequence entries, part 115.
1126. gbpat12.seq - Patent sequence entries, part 12.
1127. gbpat13.seq - Patent sequence entries, part 13.
1128. gbpat14.seq - Patent sequence entries, part 14.
1129. gbpat15.seq - Patent sequence entries, part 15.
1130. gbpat16.seq - Patent sequence entries, part 16.
1131. gbpat17.seq - Patent sequence entries, part 17.
1132. gbpat18.seq - Patent sequence entries, part 18.
1133. gbpat19.seq - Patent sequence entries, part 19.
1134. gbpat2.seq - Patent sequence entries, part 2.
1135. gbpat20.seq - Patent sequence entries, part 20.
1136. gbpat21.seq - Patent sequence entries, part 21.
1137. gbpat22.seq - Patent sequence entries, part 22.
1138. gbpat23.seq - Patent sequence entries, part 23.
1139. gbpat24.seq - Patent sequence entries, part 24.
1140. gbpat25.seq - Patent sequence entries, part 25.
1141. gbpat26.seq - Patent sequence entries, part 26.
1142. gbpat27.seq - Patent sequence entries, part 27.
1143. gbpat28.seq - Patent sequence entries, part 28.
1144. gbpat29.seq - Patent sequence entries, part 29.
1145. gbpat3.seq - Patent sequence entries, part 3.
1146. gbpat30.seq - Patent sequence entries, part 30.
1147. gbpat31.seq - Patent sequence entries, part 31.
1148. gbpat32.seq - Patent sequence entries, part 32.
1149. gbpat33.seq - Patent sequence entries, part 33.
1150. gbpat34.seq - Patent sequence entries, part 34.
1151. gbpat35.seq - Patent sequence entries, part 35.
1152. gbpat36.seq - Patent sequence entries, part 36.
1153. gbpat37.seq - Patent sequence entries, part 37.
1154. gbpat38.seq - Patent sequence entries, part 38.
1155. gbpat39.seq - Patent sequence entries, part 39.
1156. gbpat4.seq - Patent sequence entries, part 4.
1157. gbpat40.seq - Patent sequence entries, part 40.
1158. gbpat41.seq - Patent sequence entries, part 41.
1159. gbpat42.seq - Patent sequence entries, part 42.
1160. gbpat43.seq - Patent sequence entries, part 43.
1161. gbpat44.seq - Patent sequence entries, part 44.
1162. gbpat45.seq - Patent sequence entries, part 45.
1163. gbpat46.seq - Patent sequence entries, part 46.
1164. gbpat47.seq - Patent sequence entries, part 47.
1165. gbpat48.seq - Patent sequence entries, part 48.
1166. gbpat49.seq - Patent sequence entries, part 49.
1167. gbpat5.seq - Patent sequence entries, part 5.
1168. gbpat50.seq - Patent sequence entries, part 50.
1169. gbpat51.seq - Patent sequence entries, part 51.
1170. gbpat52.seq - Patent sequence entries, part 52.
1171. gbpat53.seq - Patent sequence entries, part 53.
1172. gbpat54.seq - Patent sequence entries, part 54.
1173. gbpat55.seq - Patent sequence entries, part 55.
1174. gbpat56.seq - Patent sequence entries, part 56.
1175. gbpat57.seq - Patent sequence entries, part 57.
1176. gbpat58.seq - Patent sequence entries, part 58.
1177. gbpat59.seq - Patent sequence entries, part 59.
1178. gbpat6.seq - Patent sequence entries, part 6.
1179. gbpat60.seq - Patent sequence entries, part 60.
1180. gbpat61.seq - Patent sequence entries, part 61.
1181. gbpat62.seq - Patent sequence entries, part 62.
1182. gbpat63.seq - Patent sequence entries, part 63.
1183. gbpat64.seq - Patent sequence entries, part 64.
1184. gbpat65.seq - Patent sequence entries, part 65.
1185. gbpat66.seq - Patent sequence entries, part 66.
1186. gbpat67.seq - Patent sequence entries, part 67.
1187. gbpat68.seq - Patent sequence entries, part 68.
1188. gbpat69.seq - Patent sequence entries, part 69.
1189. gbpat7.seq - Patent sequence entries, part 7.
1190. gbpat70.seq - Patent sequence entries, part 70.
1191. gbpat71.seq - Patent sequence entries, part 71.
1192. gbpat72.seq - Patent sequence entries, part 72.
1193. gbpat73.seq - Patent sequence entries, part 73.
1194. gbpat74.seq - Patent sequence entries, part 74.
1195. gbpat75.seq - Patent sequence entries, part 75.
1196. gbpat76.seq - Patent sequence entries, part 76.
1197. gbpat77.seq - Patent sequence entries, part 77.
1198. gbpat78.seq - Patent sequence entries, part 78.
1199. gbpat79.seq - Patent sequence entries, part 79.
1200. gbpat8.seq - Patent sequence entries, part 8.
1201. gbpat80.seq - Patent sequence entries, part 80.
1202. gbpat81.seq - Patent sequence entries, part 81.
1203. gbpat82.seq - Patent sequence entries, part 82.
1204. gbpat83.seq - Patent sequence entries, part 83.
1205. gbpat84.seq - Patent sequence entries, part 84.
1206. gbpat85.seq - Patent sequence entries, part 85.
1207. gbpat86.seq - Patent sequence entries, part 86.
1208. gbpat87.seq - Patent sequence entries, part 87.
1209. gbpat88.seq - Patent sequence entries, part 88.
1210. gbpat89.seq - Patent sequence entries, part 89.
1211. gbpat9.seq - Patent sequence entries, part 9.
1212. gbpat90.seq - Patent sequence entries, part 90.
1213. gbpat91.seq - Patent sequence entries, part 91.
1214. gbpat92.seq - Patent sequence entries, part 92.
1215. gbpat93.seq - Patent sequence entries, part 93.
1216. gbpat94.seq - Patent sequence entries, part 94.
1217. gbpat95.seq - Patent sequence entries, part 95.
1218. gbpat96.seq - Patent sequence entries, part 96.
1219. gbpat97.seq - Patent sequence entries, part 97.
1220. gbpat98.seq - Patent sequence entries, part 98.
1221. gbpat99.seq - Patent sequence entries, part 99.
1222. gbphg1.seq - Phage sequence entries, part 1.
1223. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1224. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1225. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1226. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1227. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1228. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1229. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1230. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1231. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1232. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1233. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1234. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1235. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1236. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1237. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1238. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1239. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1240. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1241. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1242. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1243. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1244. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1245. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1246. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1247. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1248. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1249. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1250. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1251. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1252. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1253. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1254. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1255. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1256. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1257. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1258. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1259. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1260. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1261. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1262. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1263. gbpri1.seq - Primate sequence entries, part 1.
1264. gbpri10.seq - Primate sequence entries, part 10.
1265. gbpri11.seq - Primate sequence entries, part 11.
1266. gbpri12.seq - Primate sequence entries, part 12.
1267. gbpri13.seq - Primate sequence entries, part 13.
1268. gbpri14.seq - Primate sequence entries, part 14.
1269. gbpri15.seq - Primate sequence entries, part 15.
1270. gbpri16.seq - Primate sequence entries, part 16.
1271. gbpri17.seq - Primate sequence entries, part 17.
1272. gbpri18.seq - Primate sequence entries, part 18.
1273. gbpri19.seq - Primate sequence entries, part 19.
1274. gbpri2.seq - Primate sequence entries, part 2.
1275. gbpri20.seq - Primate sequence entries, part 20.
1276. gbpri21.seq - Primate sequence entries, part 21.
1277. gbpri22.seq - Primate sequence entries, part 22.
1278. gbpri23.seq - Primate sequence entries, part 23.
1279. gbpri24.seq - Primate sequence entries, part 24.
1280. gbpri25.seq - Primate sequence entries, part 25.
1281. gbpri26.seq - Primate sequence entries, part 26.
1282. gbpri27.seq - Primate sequence entries, part 27.
1283. gbpri28.seq - Primate sequence entries, part 28.
1284. gbpri29.seq - Primate sequence entries, part 29.
1285. gbpri3.seq - Primate sequence entries, part 3.
1286. gbpri30.seq - Primate sequence entries, part 30.
1287. gbpri31.seq - Primate sequence entries, part 31.
1288. gbpri32.seq - Primate sequence entries, part 32.
1289. gbpri33.seq - Primate sequence entries, part 33.
1290. gbpri34.seq - Primate sequence entries, part 34.
1291. gbpri35.seq - Primate sequence entries, part 35.
1292. gbpri36.seq - Primate sequence entries, part 36.
1293. gbpri37.seq - Primate sequence entries, part 37.
1294. gbpri38.seq - Primate sequence entries, part 38.
1295. gbpri39.seq - Primate sequence entries, part 39.
1296. gbpri4.seq - Primate sequence entries, part 4.
1297. gbpri40.seq - Primate sequence entries, part 40.
1298. gbpri41.seq - Primate sequence entries, part 41.
1299. gbpri5.seq - Primate sequence entries, part 5.
1300. gbpri6.seq - Primate sequence entries, part 6.
1301. gbpri7.seq - Primate sequence entries, part 7.
1302. gbpri8.seq - Primate sequence entries, part 8.
1303. gbpri9.seq - Primate sequence entries, part 9.
1304. gbrel.txt - Release notes (this document).
1305. gbrod1.seq - Rodent sequence entries, part 1.
1306. gbrod10.seq - Rodent sequence entries, part 10.
1307. gbrod11.seq - Rodent sequence entries, part 11.
1308. gbrod12.seq - Rodent sequence entries, part 12.
1309. gbrod13.seq - Rodent sequence entries, part 13.
1310. gbrod14.seq - Rodent sequence entries, part 14.
1311. gbrod15.seq - Rodent sequence entries, part 15.
1312. gbrod16.seq - Rodent sequence entries, part 16.
1313. gbrod17.seq - Rodent sequence entries, part 17.
1314. gbrod18.seq - Rodent sequence entries, part 18.
1315. gbrod19.seq - Rodent sequence entries, part 19.
1316. gbrod2.seq - Rodent sequence entries, part 2.
1317. gbrod20.seq - Rodent sequence entries, part 20.
1318. gbrod21.seq - Rodent sequence entries, part 21.
1319. gbrod22.seq - Rodent sequence entries, part 22.
1320. gbrod23.seq - Rodent sequence entries, part 23.
1321. gbrod24.seq - Rodent sequence entries, part 24.
1322. gbrod25.seq - Rodent sequence entries, part 25.
1323. gbrod26.seq - Rodent sequence entries, part 26.
1324. gbrod27.seq - Rodent sequence entries, part 27.
1325. gbrod28.seq - Rodent sequence entries, part 28.
1326. gbrod3.seq - Rodent sequence entries, part 3.
1327. gbrod4.seq - Rodent sequence entries, part 4.
1328. gbrod5.seq - Rodent sequence entries, part 5.
1329. gbrod6.seq - Rodent sequence entries, part 6.
1330. gbrod7.seq - Rodent sequence entries, part 7.
1331. gbrod8.seq - Rodent sequence entries, part 8.
1332. gbrod9.seq - Rodent sequence entries, part 9.
1333. gbsdr1.txt - Short directory of the data bank, part 1.
1334. gbsdr2.txt - Short directory of the data bank, part 2.
1335. gbsdr3.txt - Short directory of the data bank, part 3.
1336. gbsec.idx - Index of the entries according to secondary accession number.
1337. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1338. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1339. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1340. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1341. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1342. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1343. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1344. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1345. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1346. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1347. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1348. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1349. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1350. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1351. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1352. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1353. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1354. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1355. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1356. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1357. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1358. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1359. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1360. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1361. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1362. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1363. gbuna1.seq - Unannotated sequence entries, part 1.
1364. gbvrl1.seq - Viral sequence entries, part 1.
1365. gbvrl10.seq - Viral sequence entries, part 10.
1366. gbvrl11.seq - Viral sequence entries, part 11.
1367. gbvrl12.seq - Viral sequence entries, part 12.
1368. gbvrl13.seq - Viral sequence entries, part 13.
1369. gbvrl14.seq - Viral sequence entries, part 14.
1370. gbvrl2.seq - Viral sequence entries, part 2.
1371. gbvrl3.seq - Viral sequence entries, part 3.
1372. gbvrl4.seq - Viral sequence entries, part 4.
1373. gbvrl5.seq - Viral sequence entries, part 5.
1374. gbvrl6.seq - Viral sequence entries, part 6.
1375. gbvrl7.seq - Viral sequence entries, part 7.
1376. gbvrl8.seq - Viral sequence entries, part 8.
1377. gbvrl9.seq - Viral sequence entries, part 9.
1378. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1379. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1380. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1381. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1382. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1383. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1384. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1385. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1386. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1387. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1388. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1389. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1390. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1391. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1392. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1393. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1394. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1395. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1396. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1397. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1398. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 177.0 flatfiles require roughly 439 GB (sequence
files only) or 471 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1285855089 gbacc1.idx
2152062924 gbacc2.idx
685908900 gbacc3.idx
183985207 gbaut1.idx
236476633 gbaut10.idx
185692103 gbaut11.idx
196490869 gbaut12.idx
183824464 gbaut13.idx
223270686 gbaut14.idx
185521434 gbaut15.idx
184392993 gbaut16.idx
183783754 gbaut17.idx
246479703 gbaut18.idx
224420587 gbaut19.idx
185893736 gbaut2.idx
204646741 gbaut20.idx
186147781 gbaut21.idx
244992805 gbaut22.idx
184020411 gbaut23.idx
192967191 gbaut24.idx
183833486 gbaut25.idx
205940381 gbaut26.idx
216907040 gbaut27.idx
238223260 gbaut28.idx
186234950 gbaut29.idx
206379676 gbaut3.idx
184254616 gbaut30.idx
184607361 gbaut31.idx
184981559 gbaut32.idx
187339941 gbaut33.idx
234816893 gbaut34.idx
245793888 gbaut35.idx
183970157 gbaut36.idx
185684418 gbaut37.idx
184104128 gbaut38.idx
185330114 gbaut39.idx
254535930 gbaut4.idx
184007120 gbaut40.idx
188199117 gbaut41.idx
185675210 gbaut42.idx
194806715 gbaut43.idx
193125434 gbaut44.idx
186226800 gbaut45.idx
183773588 gbaut46.idx
183805746 gbaut47.idx
183924026 gbaut48.idx
183790440 gbaut49.idx
186083687 gbaut5.idx
224847964 gbaut50.idx
249259433 gbaut51.idx
185046836 gbaut52.idx
234866120 gbaut53.idx
189815259 gbaut54.idx
190591955 gbaut55.idx
206529227 gbaut56.idx
213110103 gbaut57.idx
185123598 gbaut58.idx
239696891 gbaut59.idx
191779062 gbaut6.idx
184852182 gbaut60.idx
187021202 gbaut61.idx
183838842 gbaut62.idx
186673658 gbaut63.idx
239278463 gbaut64.idx
186586546 gbaut65.idx
190020280 gbaut66.idx
210370438 gbaut67.idx
184654274 gbaut68.idx
184394702 gbaut69.idx
253836212 gbaut7.idx
187079362 gbaut70.idx
189912884 gbaut71.idx
184102167 gbaut72.idx
91753070 gbaut73.idx
184302065 gbaut8.idx
186926469 gbaut9.idx
248865128 gbbct1.seq
248124497 gbbct10.seq
249997951 gbbct11.seq
20205317 gbbct12.seq
242862469 gbbct13.seq
249771855 gbbct14.seq
247998801 gbbct15.seq
242200169 gbbct16.seq
248741947 gbbct17.seq
243881769 gbbct18.seq
245715563 gbbct19.seq
247330279 gbbct2.seq
248477174 gbbct20.seq
191119807 gbbct21.seq
242657640 gbbct22.seq
241399568 gbbct23.seq
248563831 gbbct24.seq
247789533 gbbct25.seq
249347323 gbbct26.seq
244148229 gbbct27.seq
247094874 gbbct28.seq
249959425 gbbct29.seq
244743111 gbbct3.seq
249716833 gbbct30.seq
245195593 gbbct31.seq
242633740 gbbct32.seq
249121115 gbbct33.seq
142294859 gbbct34.seq
245348494 gbbct35.seq
245677504 gbbct36.seq
232990617 gbbct37.seq
235482027 gbbct38.seq
239203911 gbbct39.seq
249970710 gbbct4.seq
238642577 gbbct40.seq
248351902 gbbct41.seq
192991103 gbbct42.seq
6879048 gbbct43.seq
14079971 gbbct44.seq
23147485 gbbct45.seq
45019135 gbbct46.seq
87547666 gbbct47.seq
169894745 gbbct48.seq
249998165 gbbct49.seq
139069910 gbbct5.seq
237268978 gbbct50.seq
249539193 gbbct51.seq
249786548 gbbct52.seq
249999835 gbbct53.seq
241093867 gbbct54.seq
249657716 gbbct6.seq
249998997 gbbct7.seq
249898690 gbbct8.seq
243667617 gbbct9.seq
71511662 gbchg.txt
249999729 gbcon1.seq
249996809 gbcon10.seq
249999100 gbcon100.seq
249999520 gbcon101.seq
249998411 gbcon102.seq
249997075 gbcon103.seq
155891156 gbcon104.seq
249996638 gbcon105.seq
249996958 gbcon106.seq
249972536 gbcon107.seq
249997665 gbcon108.seq
171931188 gbcon109.seq
249999912 gbcon11.seq
249997691 gbcon110.seq
249998297 gbcon111.seq
233590876 gbcon112.seq
249999612 gbcon113.seq
249998231 gbcon114.seq
249995786 gbcon115.seq
249887988 gbcon116.seq
161525455 gbcon117.seq
249998097 gbcon118.seq
161457489 gbcon119.seq
249463327 gbcon12.seq
249997137 gbcon120.seq
249999295 gbcon121.seq
249998694 gbcon122.seq
220185739 gbcon123.seq
249999839 gbcon124.seq
249617018 gbcon125.seq
250000201 gbcon126.seq
250000253 gbcon127.seq
249998829 gbcon128.seq
249998988 gbcon129.seq
244478924 gbcon13.seq
249997975 gbcon130.seq
249837920 gbcon131.seq
249995769 gbcon132.seq
249998647 gbcon133.seq
248626814 gbcon134.seq
135413445 gbcon135.seq
21460242 gbcon136.seq
249999320 gbcon14.seq
17601279 gbcon15.seq
248720986 gbcon16.seq
249999916 gbcon17.seq
133107648 gbcon18.seq
249998866 gbcon19.seq
248163547 gbcon2.seq
249866912 gbcon20.seq
105727098 gbcon21.seq
249999877 gbcon22.seq
86926328 gbcon23.seq
249999233 gbcon24.seq
249932630 gbcon25.seq
249998972 gbcon26.seq
249998980 gbcon27.seq
230072762 gbcon28.seq
249999538 gbcon29.seq
249795687 gbcon3.seq
249997411 gbcon30.seq
249997078 gbcon31.seq
249998450 gbcon32.seq
249191772 gbcon33.seq
194550762 gbcon34.seq
249999242 gbcon35.seq
249999877 gbcon36.seq
249996021 gbcon37.seq
249996176 gbcon38.seq
249994385 gbcon39.seq
249995768 gbcon4.seq
249994875 gbcon40.seq
60694182 gbcon41.seq
249994823 gbcon42.seq
249996670 gbcon43.seq
249994771 gbcon44.seq
249997476 gbcon45.seq
249999646 gbcon46.seq
42680484 gbcon47.seq
249996840 gbcon48.seq
249999181 gbcon49.seq
249999515 gbcon5.seq
249998673 gbcon50.seq
249995483 gbcon51.seq
249998214 gbcon52.seq
35989951 gbcon53.seq
249996602 gbcon54.seq
249994877 gbcon55.seq
249998850 gbcon56.seq
249996087 gbcon57.seq
249996119 gbcon58.seq
152231870 gbcon59.seq
249999243 gbcon6.seq
249999222 gbcon60.seq
249997773 gbcon61.seq
249999490 gbcon62.seq
249996614 gbcon63.seq
183250056 gbcon64.seq
249997380 gbcon65.seq
249998571 gbcon66.seq
250000027 gbcon67.seq
249997824 gbcon68.seq
245105048 gbcon69.seq
249997748 gbcon7.seq
249999617 gbcon70.seq
250000161 gbcon71.seq
249996007 gbcon72.seq
249996901 gbcon73.seq
249999372 gbcon74.seq
96213867 gbcon75.seq
249997855 gbcon76.seq
249995058 gbcon77.seq
249998739 gbcon78.seq
249998960 gbcon79.seq
50228775 gbcon8.seq
249999030 gbcon80.seq
62263749 gbcon81.seq
249999554 gbcon82.seq
249999004 gbcon83.seq
249998188 gbcon84.seq
249997952 gbcon85.seq
249996309 gbcon86.seq
21279195 gbcon87.seq
249996512 gbcon88.seq
249998457 gbcon89.seq
249997328 gbcon9.seq
249997420 gbcon90.seq
249998172 gbcon91.seq
197510298 gbcon92.seq
249995742 gbcon93.seq
249996706 gbcon94.seq
249996588 gbcon95.seq
249998180 gbcon96.seq
249997251 gbcon97.seq
132829813 gbcon98.seq
249997306 gbcon99.seq
15787 gbdel.txt
249998765 gbenv1.seq
249999561 gbenv10.seq
51726830 gbenv11.seq
249998378 gbenv12.seq
249999736 gbenv13.seq
249998457 gbenv14.seq
249998699 gbenv15.seq
249998422 gbenv16.seq
161053294 gbenv17.seq
249998945 gbenv18.seq
249998901 gbenv19.seq
249997838 gbenv2.seq
249998390 gbenv20.seq
250000081 gbenv21.seq
249998452 gbenv22.seq
250000034 gbenv23.seq
220589344 gbenv24.seq
249997455 gbenv3.seq
249999713 gbenv4.seq
249997860 gbenv5.seq
109788555 gbenv6.seq
249998823 gbenv7.seq
249998293 gbenv8.seq
249998846 gbenv9.seq
524290686 gbest1.seq
524290650 gbest10.seq
524290893 gbest100.seq
524289142 gbest101.seq
524289570 gbest102.seq
524291771 gbest103.seq
204127273 gbest104.seq
524289448 gbest105.seq
524289661 gbest106.seq
473045552 gbest107.seq
386135689 gbest108.seq
385846016 gbest109.seq
524293065 gbest11.seq
380621886 gbest110.seq
381151495 gbest111.seq
382130138 gbest112.seq
378549267 gbest113.seq
389932522 gbest114.seq
385773263 gbest115.seq
382306370 gbest116.seq
381827588 gbest117.seq
411810662 gbest118.seq
524290668 gbest119.seq
524289295 gbest12.seq
524289882 gbest120.seq
524290540 gbest121.seq
524290807 gbest122.seq
524291156 gbest123.seq
372456547 gbest124.seq
524288861 gbest125.seq
524290169 gbest126.seq
524290082 gbest127.seq
524289975 gbest128.seq
524290481 gbest129.seq
56225 gbest13.seq
524289583 gbest130.seq
524289547 gbest131.seq
524290350 gbest132.seq
524288817 gbest133.seq
524291820 gbest134.seq
524289596 gbest135.seq
524289264 gbest136.seq
103065317 gbest137.seq
524288838 gbest138.seq
524290372 gbest139.seq
524288940 gbest14.seq
524289155 gbest140.seq
524290241 gbest141.seq
524290279 gbest142.seq
524290134 gbest143.seq
524292191 gbest144.seq
524291511 gbest145.seq
524292108 gbest146.seq
524289079 gbest147.seq
524290774 gbest148.seq
524290296 gbest149.seq
524290149 gbest15.seq
524292615 gbest150.seq
333484251 gbest151.seq
524289059 gbest152.seq
524289957 gbest153.seq
524289231 gbest154.seq
524289860 gbest155.seq
524292935 gbest156.seq
524291502 gbest157.seq
524290480 gbest158.seq
524289481 gbest159.seq
524288908 gbest16.seq
460676680 gbest160.seq
524291622 gbest161.seq
524290157 gbest162.seq
524289668 gbest163.seq
131228071 gbest164.seq
524289916 gbest165.seq
524288842 gbest166.seq
524288983 gbest167.seq
524290000 gbest168.seq
524289782 gbest169.seq
524291352 gbest17.seq
524291079 gbest170.seq
524289626 gbest171.seq
524289199 gbest172.seq
524288820 gbest173.seq
524289941 gbest174.seq
524290715 gbest175.seq
524291154 gbest176.seq
479863449 gbest177.seq
524291130 gbest178.seq
524290011 gbest179.seq
524289621 gbest18.seq
524290924 gbest180.seq
524289457 gbest181.seq
524289899 gbest182.seq
524291667 gbest183.seq
524290656 gbest184.seq
524289093 gbest185.seq
524290241 gbest186.seq
524290621 gbest187.seq
524288882 gbest188.seq
524289366 gbest189.seq
524289572 gbest19.seq
315044344 gbest190.seq
524289367 gbest191.seq
524289359 gbest192.seq
524294261 gbest193.seq
524288983 gbest194.seq
524289965 gbest195.seq
524289089 gbest196.seq
524288748 gbest197.seq
524289435 gbest198.seq
524291172 gbest199.seq
524290019 gbest2.seq
524291777 gbest20.seq
524289338 gbest200.seq
524290741 gbest201.seq
524289661 gbest202.seq
486702515 gbest203.seq
524291017 gbest204.seq
524290293 gbest205.seq
524290351 gbest206.seq
524290700 gbest207.seq
524290022 gbest208.seq
524289347 gbest209.seq
524290117 gbest21.seq
524290129 gbest210.seq
524289873 gbest211.seq
524289534 gbest212.seq
524289373 gbest213.seq
309831226 gbest214.seq
524290178 gbest215.seq
524290667 gbest216.seq
524289219 gbest217.seq
524292990 gbest218.seq
524289448 gbest219.seq
458599452 gbest22.seq
524290028 gbest220.seq
524291957 gbest221.seq
524289569 gbest222.seq
524291989 gbest223.seq
524289935 gbest224.seq
524289600 gbest225.seq
524290547 gbest226.seq
524291091 gbest227.seq
274396296 gbest228.seq
524290280 gbest229.seq
508906925 gbest23.seq
524290985 gbest230.seq
524290430 gbest231.seq
524290850 gbest232.seq
524290566 gbest233.seq
524289195 gbest234.seq
524291799 gbest235.seq
524289917 gbest236.seq
524288903 gbest237.seq
524290306 gbest238.seq
524290820 gbest239.seq
524289915 gbest24.seq
524288832 gbest240.seq
524291343 gbest241.seq
357896548 gbest242.seq
524289030 gbest243.seq
524292496 gbest244.seq
524290561 gbest245.seq
524289595 gbest246.seq
523854481 gbest247.seq
524289349 gbest248.seq
524288945 gbest249.seq
172517366 gbest25.seq
524289841 gbest250.seq
524290302 gbest251.seq
524289948 gbest252.seq
524291182 gbest253.seq
39244433 gbest254.seq
524291254 gbest255.seq
524289676 gbest256.seq
524288880 gbest257.seq
524288797 gbest258.seq
524290443 gbest259.seq
524288821 gbest26.seq
524290638 gbest260.seq
524289028 gbest261.seq
524289017 gbest262.seq
524289409 gbest263.seq
524288897 gbest264.seq
210350276 gbest265.seq
524291560 gbest266.seq
524289790 gbest267.seq
524291858 gbest268.seq
524290547 gbest269.seq
524289577 gbest27.seq
524290985 gbest270.seq
524292150 gbest271.seq
524289886 gbest272.seq
524288837 gbest273.seq
524291214 gbest274.seq
524290298 gbest275.seq
524291910 gbest276.seq
209686180 gbest277.seq
524289189 gbest278.seq
524289597 gbest279.seq
524290645 gbest28.seq
524290512 gbest280.seq
524289454 gbest281.seq
524290747 gbest282.seq
524291228 gbest283.seq
524290645 gbest284.seq
524289265 gbest285.seq
524289125 gbest286.seq
524289145 gbest287.seq
396634545 gbest288.seq
524291015 gbest289.seq
524288867 gbest29.seq
524290595 gbest290.seq
524291304 gbest291.seq
524291528 gbest292.seq
524289174 gbest293.seq
524290605 gbest294.seq
524289150 gbest295.seq
474273327 gbest296.seq
481449220 gbest297.seq
482937693 gbest298.seq
480466696 gbest299.seq
513067569 gbest3.seq
524289513 gbest30.seq
229980943 gbest300.seq
524290363 gbest301.seq
524290600 gbest302.seq
524289720 gbest303.seq
524292178 gbest304.seq
524291462 gbest305.seq
524289031 gbest306.seq
524290201 gbest307.seq
524291256 gbest308.seq
524290573 gbest309.seq
524291856 gbest31.seq
524290878 gbest310.seq
524290182 gbest311.seq
524290674 gbest312.seq
368507322 gbest313.seq
524288891 gbest314.seq
524291173 gbest315.seq
524289562 gbest316.seq
524289575 gbest317.seq
524289050 gbest318.seq
524292342 gbest319.seq
524290120 gbest32.seq
524290016 gbest320.seq
524291017 gbest321.seq
524291956 gbest322.seq
522637383 gbest323.seq
524290731 gbest324.seq
524291364 gbest325.seq
524290142 gbest326.seq
252372076 gbest327.seq
524289640 gbest328.seq
524290912 gbest329.seq
524291597 gbest33.seq
524291926 gbest330.seq
524291703 gbest331.seq
524289387 gbest332.seq
524291523 gbest333.seq
524289982 gbest334.seq
524289384 gbest335.seq
524289800 gbest336.seq
524289142 gbest337.seq
524291268 gbest338.seq
524291843 gbest339.seq
489394608 gbest34.seq
524291962 gbest340.seq
75375614 gbest341.seq
524289190 gbest342.seq
524292252 gbest343.seq
524289796 gbest344.seq
524291147 gbest345.seq
524290519 gbest346.seq
524293677 gbest347.seq
524290480 gbest348.seq
524290144 gbest349.seq
490149894 gbest35.seq
524289431 gbest350.seq
524290710 gbest351.seq
524290791 gbest352.seq
524290925 gbest353.seq
524289584 gbest354.seq
89600616 gbest355.seq
524289634 gbest356.seq
524289517 gbest357.seq
524290413 gbest358.seq
524289281 gbest359.seq
492360969 gbest36.seq
524290692 gbest360.seq
524290469 gbest361.seq
524288954 gbest362.seq
524289881 gbest363.seq
524291685 gbest364.seq
524290155 gbest365.seq
497466050 gbest366.seq
524289197 gbest367.seq
524292289 gbest368.seq
524288766 gbest369.seq
491776019 gbest37.seq
524291172 gbest370.seq
524290099 gbest371.seq
524291718 gbest372.seq
524291649 gbest373.seq
524289579 gbest374.seq
524288748 gbest375.seq
524289956 gbest376.seq
524289157 gbest377.seq
524289745 gbest378.seq
19877855 gbest379.seq
484490584 gbest38.seq
524289401 gbest380.seq
524289925 gbest381.seq
524290700 gbest382.seq
524290621 gbest383.seq
524289057 gbest384.seq
524288733 gbest385.seq
524288946 gbest386.seq
524291417 gbest387.seq
524289980 gbest388.seq
524289854 gbest389.seq
498679010 gbest39.seq
524290275 gbest390.seq
524289296 gbest391.seq
344443255 gbest392.seq
524291597 gbest393.seq
524289022 gbest394.seq
524288841 gbest395.seq
524290440 gbest396.seq
524289423 gbest397.seq
524289724 gbest398.seq
524288870 gbest399.seq
524289064 gbest4.seq
15063784 gbest40.seq
524289070 gbest400.seq
524294366 gbest401.seq
524291012 gbest402.seq
524289700 gbest403.seq
524289689 gbest404.seq
524290097 gbest405.seq
524291586 gbest406.seq
195939757 gbest407.seq
524289911 gbest408.seq
524289884 gbest409.seq
524290014 gbest41.seq
524291305 gbest410.seq
524288985 gbest411.seq
524290486 gbest412.seq
203758508 gbest413.seq
524288799 gbest42.seq
524289575 gbest43.seq
524289524 gbest44.seq
524291246 gbest45.seq
524288744 gbest46.seq
524291831 gbest47.seq
524290554 gbest48.seq
524288941 gbest49.seq
524290662 gbest5.seq
524290812 gbest50.seq
524291079 gbest51.seq
524290983 gbest52.seq
524289428 gbest53.seq
106797246 gbest54.seq
524290260 gbest55.seq
524291456 gbest56.seq
524289287 gbest57.seq
524291616 gbest58.seq
524288936 gbest59.seq
524291318 gbest6.seq
524289926 gbest60.seq
524290645 gbest61.seq
524289481 gbest62.seq
524289037 gbest63.seq
524289333 gbest64.seq
524289660 gbest65.seq
524290844 gbest66.seq
308977274 gbest67.seq
524290906 gbest68.seq
524290472 gbest69.seq
524288918 gbest7.seq
524290109 gbest70.seq
524291910 gbest71.seq
524289185 gbest72.seq
524289852 gbest73.seq
524290847 gbest74.seq
524290951 gbest75.seq
524290006 gbest76.seq
524289433 gbest77.seq
524289491 gbest78.seq
524288780 gbest79.seq
524289759 gbest8.seq
57004226 gbest80.seq
524289492 gbest81.seq
524290008 gbest82.seq
524288759 gbest83.seq
524290719 gbest84.seq
524289975 gbest85.seq
524292452 gbest86.seq
524291856 gbest87.seq
524290882 gbest88.seq
524289111 gbest89.seq
524289382 gbest9.seq
524290850 gbest90.seq
524288803 gbest91.seq
294827207 gbest92.seq
524291495 gbest93.seq
524292247 gbest94.seq
524291430 gbest95.seq
524289855 gbest96.seq
524291117 gbest97.seq
524289209 gbest98.seq
524290380 gbest99.seq
121469417 gbgen.idx
524289330 gbgss1.seq
524289721 gbgss10.seq
232522219 gbgss100.seq
524289895 gbgss101.seq
524290012 gbgss102.seq
524289230 gbgss103.seq
524289162 gbgss104.seq
524289997 gbgss105.seq
524290846 gbgss106.seq
524289815 gbgss107.seq
524290520 gbgss108.seq
524289737 gbgss109.seq
524291447 gbgss11.seq
524291037 gbgss110.seq
454179838 gbgss111.seq
524289883 gbgss112.seq
524291068 gbgss113.seq
524291490 gbgss114.seq
524291165 gbgss115.seq
524289161 gbgss116.seq
524290824 gbgss117.seq
524291189 gbgss118.seq
524289968 gbgss119.seq
524291952 gbgss12.seq
524289473 gbgss120.seq
166544742 gbgss121.seq
249998507 gbgss122.seq
249999553 gbgss123.seq
249999067 gbgss124.seq
249998499 gbgss125.seq
27267309 gbgss126.seq
249999305 gbgss127.seq
249998059 gbgss128.seq
249997528 gbgss129.seq
524291338 gbgss13.seq
249999266 gbgss130.seq
223609630 gbgss131.seq
249998415 gbgss132.seq
249998761 gbgss133.seq
249998880 gbgss134.seq
249998174 gbgss135.seq
171449403 gbgss136.seq
249997088 gbgss137.seq
249998903 gbgss138.seq
249999973 gbgss139.seq
524291554 gbgss14.seq
249999609 gbgss140.seq
249996921 gbgss141.seq
76888892 gbgss142.seq
250000188 gbgss143.seq
2879209 gbgss144.seq
79504033 gbgss145.seq
249999490 gbgss146.seq
249999462 gbgss147.seq
78034667 gbgss148.seq
249998484 gbgss149.seq
524289002 gbgss15.seq
249999450 gbgss150.seq
249997767 gbgss151.seq
114935056 gbgss152.seq
249999232 gbgss153.seq
249999334 gbgss154.seq
249999609 gbgss155.seq
246354232 gbgss156.seq
249999268 gbgss157.seq
249997406 gbgss158.seq
249999513 gbgss159.seq
524290847 gbgss16.seq
243477113 gbgss160.seq
249999336 gbgss161.seq
249997687 gbgss162.seq
249997948 gbgss163.seq
249998567 gbgss164.seq
116382755 gbgss165.seq
249998013 gbgss166.seq
250000031 gbgss167.seq
249999974 gbgss168.seq
249998152 gbgss169.seq
524290352 gbgss17.seq
94058788 gbgss170.seq
249998892 gbgss171.seq
249999850 gbgss172.seq
249998239 gbgss173.seq
249999582 gbgss174.seq
162386018 gbgss175.seq
249999236 gbgss176.seq
249997993 gbgss177.seq
249998006 gbgss178.seq
249999353 gbgss179.seq
524289873 gbgss18.seq
95926739 gbgss180.seq
249999461 gbgss181.seq
249999350 gbgss182.seq
249998406 gbgss183.seq
249998619 gbgss184.seq
249999397 gbgss185.seq
249999238 gbgss186.seq
17978792 gbgss187.seq
249999853 gbgss188.seq
249998411 gbgss189.seq
150844342 gbgss19.seq
249998272 gbgss190.seq
42310440 gbgss191.seq
52091543 gbgss192.seq
249998242 gbgss193.seq
249999494 gbgss194.seq
249997995 gbgss195.seq
249997330 gbgss196.seq
249997758 gbgss197.seq
102524929 gbgss198.seq
249998520 gbgss199.seq
524289346 gbgss2.seq
524291095 gbgss20.seq
249998861 gbgss200.seq
250000017 gbgss201.seq
249998774 gbgss202.seq
249999522 gbgss203.seq
249998473 gbgss204.seq
106445059 gbgss205.seq
249999561 gbgss206.seq
249998751 gbgss207.seq
249999599 gbgss208.seq
249999028 gbgss209.seq
524290032 gbgss21.seq
249999713 gbgss210.seq
16550600 gbgss211.seq
524290163 gbgss22.seq
524288857 gbgss23.seq
524291258 gbgss24.seq
524289556 gbgss25.seq
524289145 gbgss26.seq
524289442 gbgss27.seq
524291007 gbgss28.seq
524288897 gbgss29.seq
524288877 gbgss3.seq
427929738 gbgss30.seq
524290679 gbgss31.seq
524289719 gbgss32.seq
524290073 gbgss33.seq
524290035 gbgss34.seq
524290617 gbgss35.seq
524290519 gbgss36.seq
524291111 gbgss37.seq
468913984 gbgss38.seq
524291421 gbgss39.seq
524291607 gbgss4.seq
524291349 gbgss40.seq
452559682 gbgss41.seq
524289132 gbgss42.seq
524289643 gbgss43.seq
524290214 gbgss44.seq
524289007 gbgss45.seq
156689949 gbgss46.seq
524291699 gbgss47.seq
524289024 gbgss48.seq
524290162 gbgss49.seq
115085286 gbgss5.seq
524289623 gbgss50.seq
524289431 gbgss51.seq
524290305 gbgss52.seq
524289879 gbgss53.seq
524291966 gbgss54.seq
524289348 gbgss55.seq
524291038 gbgss56.seq
403180078 gbgss57.seq
524288884 gbgss58.seq
524288774 gbgss59.seq
524289571 gbgss6.seq
524290996 gbgss60.seq
415173955 gbgss61.seq
524289090 gbgss62.seq
524290854 gbgss63.seq
524290971 gbgss64.seq
524289258 gbgss65.seq
524289520 gbgss66.seq
524290636 gbgss67.seq
524290798 gbgss68.seq
524289043 gbgss69.seq
524290750 gbgss7.seq
524290787 gbgss70.seq
524290505 gbgss71.seq
524290605 gbgss72.seq
411230934 gbgss73.seq
524290382 gbgss74.seq
524289713 gbgss75.seq
524289948 gbgss76.seq
524289654 gbgss77.seq
524289210 gbgss78.seq
524288753 gbgss79.seq
524290111 gbgss8.seq
524289236 gbgss80.seq
524291317 gbgss81.seq
524291578 gbgss82.seq
524290104 gbgss83.seq
524289027 gbgss84.seq
228405899 gbgss85.seq
524291900 gbgss86.seq
524289498 gbgss87.seq
524290597 gbgss88.seq
524290444 gbgss89.seq
524289011 gbgss9.seq
524291387 gbgss90.seq
524291827 gbgss91.seq
524291391 gbgss92.seq
524292075 gbgss93.seq
524290593 gbgss94.seq
524290404 gbgss95.seq
524290950 gbgss96.seq
524291640 gbgss97.seq
524290861 gbgss98.seq
524291109 gbgss99.seq
249987886 gbhtc1.seq
249999727 gbhtc10.seq
249999097 gbhtc11.seq
75176100 gbhtc12.seq
249998738 gbhtc13.seq
249999844 gbhtc14.seq
45798779 gbhtc15.seq
250000065 gbhtc2.seq
249994635 gbhtc3.seq
249991467 gbhtc4.seq
249991812 gbhtc5.seq
249986737 gbhtc6.seq
249998746 gbhtc7.seq
71970158 gbhtc8.seq
249998534 gbhtc9.seq
249955003 gbhtg1.seq
249805779 gbhtg10.seq
249822300 gbhtg100.seq
249887250 gbhtg101.seq
249708148 gbhtg102.seq
249898004 gbhtg103.seq
7826932 gbhtg104.seq
249818046 gbhtg105.seq
249890826 gbhtg106.seq
249924913 gbhtg107.seq
249897241 gbhtg108.seq
249984653 gbhtg109.seq
1643239 gbhtg11.seq
249957396 gbhtg110.seq
249983204 gbhtg111.seq
249830541 gbhtg112.seq
82639517 gbhtg113.seq
249953360 gbhtg114.seq
249480560 gbhtg115.seq
249849257 gbhtg116.seq
249989516 gbhtg117.seq
249861691 gbhtg118.seq
113455506 gbhtg119.seq
249672647 gbhtg12.seq
249866266 gbhtg120.seq
249833256 gbhtg121.seq
249814425 gbhtg122.seq
249788655 gbhtg123.seq
249806707 gbhtg124.seq
174608871 gbhtg125.seq
249944097 gbhtg126.seq
249887825 gbhtg127.seq
249946433 gbhtg128.seq
249770962 gbhtg129.seq
249753445 gbhtg13.seq
249966502 gbhtg130.seq
249842714 gbhtg131.seq
249878800 gbhtg132.seq
249971012 gbhtg133.seq
201187100 gbhtg134.seq
249685830 gbhtg14.seq
249720998 gbhtg15.seq
249934857 gbhtg16.seq
249879927 gbhtg17.seq
249793902 gbhtg18.seq
249764956 gbhtg19.seq
249980815 gbhtg2.seq
249735439 gbhtg20.seq
241647563 gbhtg21.seq
249838998 gbhtg22.seq
249836453 gbhtg23.seq
249749127 gbhtg24.seq
249910586 gbhtg25.seq
249739337 gbhtg26.seq
249392126 gbhtg27.seq
249866732 gbhtg28.seq
249885300 gbhtg29.seq
249996540 gbhtg3.seq
249764504 gbhtg30.seq
227619985 gbhtg31.seq
249986198 gbhtg32.seq
249968838 gbhtg33.seq
249950759 gbhtg34.seq
249801122 gbhtg35.seq
249835927 gbhtg36.seq
249900460 gbhtg37.seq
249903285 gbhtg38.seq
249946990 gbhtg39.seq
249931374 gbhtg4.seq
249885296 gbhtg40.seq
227773364 gbhtg41.seq
249817417 gbhtg42.seq
249819585 gbhtg43.seq
249813007 gbhtg44.seq
249573697 gbhtg45.seq
249929616 gbhtg46.seq
249935875 gbhtg47.seq
249947747 gbhtg48.seq
249737339 gbhtg49.seq
249988734 gbhtg5.seq
249966049 gbhtg50.seq
236200775 gbhtg51.seq
249784639 gbhtg52.seq
249801601 gbhtg53.seq
249806440 gbhtg54.seq
249951273 gbhtg55.seq
249914368 gbhtg56.seq
20717242 gbhtg57.seq
249812041 gbhtg58.seq
249750579 gbhtg59.seq
249769696 gbhtg6.seq
249991093 gbhtg60.seq
249987024 gbhtg61.seq
228558339 gbhtg62.seq
249927422 gbhtg63.seq
249986487 gbhtg64.seq
249927786 gbhtg65.seq
249881682 gbhtg66.seq
249966605 gbhtg67.seq
16805116 gbhtg68.seq
249960711 gbhtg69.seq
249851846 gbhtg7.seq
249973586 gbhtg70.seq
249953795 gbhtg71.seq
249939761 gbhtg72.seq
227959115 gbhtg73.seq
249814172 gbhtg74.seq
249990980 gbhtg75.seq
249827607 gbhtg76.seq
249987899 gbhtg77.seq
247385213 gbhtg78.seq
249883648 gbhtg79.seq
249791419 gbhtg8.seq
249970880 gbhtg80.seq
249999871 gbhtg81.seq
249862407 gbhtg82.seq
218174964 gbhtg83.seq
249912343 gbhtg84.seq
249928605 gbhtg85.seq
249990828 gbhtg86.seq
249894444 gbhtg87.seq
226464449 gbhtg88.seq
249813946 gbhtg89.seq
249971598 gbhtg9.seq
249864322 gbhtg90.seq
249957463 gbhtg91.seq
249993852 gbhtg92.seq
223554720 gbhtg93.seq
249817178 gbhtg94.seq
249963340 gbhtg95.seq
249889381 gbhtg96.seq
249819562 gbhtg97.seq
173520668 gbhtg98.seq
249786185 gbhtg99.seq
249998495 gbinv1.seq
249995794 gbinv10.seq
249998186 gbinv11.seq
156450256 gbinv12.seq
249998392 gbinv13.seq
249999010 gbinv14.seq
250000188 gbinv15.seq
248633826 gbinv16.seq
249569909 gbinv17.seq
249994425 gbinv18.seq
249997431 gbinv19.seq
249964147 gbinv2.seq
249851786 gbinv20.seq
145653378 gbinv21.seq
240796917 gbinv3.seq
250000185 gbinv4.seq
249999041 gbinv5.seq
248502226 gbinv6.seq
249998323 gbinv7.seq
153638 gbinv8.seq
249999683 gbinv9.seq
140524297 gbjou1.idx
192038170 gbjou2.idx
199508125 gbjou3.idx
287648571 gbjou4.idx
272101671 gbjou5.idx
302025422 gbjou6.idx
277753404 gbjou7.idx
218670864 gbjou8.idx
244202457 gbkey1.idx
178837524 gbkey2.idx
274964630 gbkey3.idx
94007370 gbkey4.idx
249974318 gbmam1.seq
249997974 gbmam2.seq
249970594 gbmam3.seq
249999625 gbmam4.seq
249997059 gbmam5.seq
61219255 gbmam6.seq
40910640 gbnew.txt
249999713 gbpat1.seq
249997396 gbpat10.seq
249999845 gbpat100.seq
249999888 gbpat101.seq
249999095 gbpat102.seq
144511006 gbpat103.seq
249999734 gbpat104.seq
250000165 gbpat105.seq
250000007 gbpat106.seq
89171821 gbpat107.seq
250000238 gbpat108.seq
249981040 gbpat109.seq
178911340 gbpat11.seq
250000262 gbpat110.seq
249997195 gbpat111.seq
250000052 gbpat112.seq
249999907 gbpat113.seq
249999975 gbpat114.seq
160369247 gbpat115.seq
249996511 gbpat12.seq
249996014 gbpat13.seq
249998711 gbpat14.seq
249998913 gbpat15.seq
249999567 gbpat16.seq
65978988 gbpat17.seq
249999229 gbpat18.seq
249999331 gbpat19.seq
249999577 gbpat2.seq
249999934 gbpat20.seq
249998311 gbpat21.seq
185118206 gbpat22.seq
249999616 gbpat23.seq
249793166 gbpat24.seq
249999560 gbpat25.seq
249999436 gbpat26.seq
71195417 gbpat27.seq
249998762 gbpat28.seq
249998690 gbpat29.seq
249999257 gbpat3.seq
249999381 gbpat30.seq
250000050 gbpat31.seq
249996217 gbpat32.seq
180151273 gbpat33.seq
249999915 gbpat34.seq
249998958 gbpat35.seq
249998503 gbpat36.seq
249998563 gbpat37.seq
133703958 gbpat38.seq
249997390 gbpat39.seq
249998049 gbpat4.seq
249979161 gbpat40.seq
250000221 gbpat41.seq
249997473 gbpat42.seq
249999303 gbpat43.seq
249999084 gbpat44.seq
249998901 gbpat45.seq
250000061 gbpat46.seq
174216750 gbpat47.seq
249999224 gbpat48.seq
249998527 gbpat49.seq
71794649 gbpat5.seq
249999531 gbpat50.seq
250000197 gbpat51.seq
222934467 gbpat52.seq
249999057 gbpat53.seq
249999815 gbpat54.seq
249999501 gbpat55.seq
164408589 gbpat56.seq
249999825 gbpat57.seq
249998551 gbpat58.seq
249999563 gbpat59.seq
249999527 gbpat6.seq
249999727 gbpat60.seq
134334132 gbpat61.seq
249996346 gbpat62.seq
249999978 gbpat63.seq
249999690 gbpat64.seq
249998210 gbpat65.seq
249999753 gbpat66.seq
249999584 gbpat67.seq
147170840 gbpat68.seq
250000111 gbpat69.seq
249999452 gbpat7.seq
249999587 gbpat70.seq
249998992 gbpat71.seq
245249311 gbpat72.seq
248968678 gbpat73.seq
244459261 gbpat74.seq
247875799 gbpat75.seq
249999019 gbpat76.seq
160626113 gbpat77.seq
250000121 gbpat78.seq
249999657 gbpat79.seq
249990633 gbpat8.seq
249999470 gbpat80.seq
249999644 gbpat81.seq
137484636 gbpat82.seq
249999879 gbpat83.seq
249999564 gbpat84.seq
249929730 gbpat85.seq
249824878 gbpat86.seq
249998855 gbpat87.seq
192932837 gbpat88.seq
249999635 gbpat89.seq
249996586 gbpat9.seq
249999632 gbpat90.seq
249996198 gbpat91.seq
80124350 gbpat92.seq
250000135 gbpat93.seq
249999051 gbpat94.seq
250000244 gbpat95.seq
250000101 gbpat96.seq
249868821 gbpat97.seq
66835451 gbpat98.seq
249999440 gbpat99.seq
103479583 gbphg1.seq
249999721 gbpln1.seq
249910181 gbpln10.seq
249752438 gbpln11.seq
87020126 gbpln12.seq
249997942 gbpln13.seq
249991131 gbpln14.seq
249997558 gbpln15.seq
247910480 gbpln16.seq
249919786 gbpln17.seq
249333075 gbpln18.seq
249998314 gbpln19.seq
249977250 gbpln2.seq
23772976 gbpln20.seq
249996438 gbpln21.seq
95039095 gbpln22.seq
249999558 gbpln23.seq
249995913 gbpln24.seq
249997930 gbpln25.seq
249998638 gbpln26.seq
249997222 gbpln27.seq
249965485 gbpln28.seq
249999521 gbpln29.seq
249983818 gbpln3.seq
123190838 gbpln30.seq
249998036 gbpln31.seq
249999818 gbpln32.seq
249997981 gbpln33.seq
249998446 gbpln34.seq
249999399 gbpln35.seq
249999394 gbpln36.seq
249998975 gbpln37.seq
249998527 gbpln38.seq
249998381 gbpln39.seq
249994351 gbpln4.seq
54441108 gbpln40.seq
249941139 gbpln5.seq
250000070 gbpln6.seq
231315205 gbpln7.seq
249969148 gbpln8.seq
249994882 gbpln9.seq
148929195 gbpri1.seq
249994319 gbpri10.seq
122946096 gbpri11.seq
249966221 gbpri12.seq
249900325 gbpri13.seq
249891160 gbpri14.seq
249940560 gbpri15.seq
249904525 gbpri16.seq
249861869 gbpri17.seq
249987640 gbpri18.seq
249915302 gbpri19.seq
249818196 gbpri2.seq
249751583 gbpri20.seq
249688407 gbpri21.seq
66383830 gbpri22.seq
180120655 gbpri23.seq
249991251 gbpri24.seq
204692644 gbpri25.seq
249899000 gbpri26.seq
249845736 gbpri27.seq
249826325 gbpri28.seq
249868667 gbpri29.seq
249852613 gbpri3.seq
249834770 gbpri30.seq
249970403 gbpri31.seq
249810577 gbpri32.seq
249986615 gbpri33.seq
84902877 gbpri34.seq
249995363 gbpri35.seq
249998838 gbpri36.seq
249909217 gbpri37.seq
250000215 gbpri38.seq
249711216 gbpri39.seq
249890189 gbpri4.seq
249999798 gbpri40.seq
129561799 gbpri41.seq
249900736 gbpri5.seq
249880682 gbpri6.seq
249947465 gbpri7.seq
249891490 gbpri8.seq
249820663 gbpri9.seq
269659 gbrel.txt
249996161 gbrod1.seq
249880010 gbrod10.seq
50280305 gbrod11.seq
249873649 gbrod12.seq
249783094 gbrod13.seq
249993481 gbrod14.seq
249649437 gbrod15.seq
249790806 gbrod16.seq
249888394 gbrod17.seq
249741353 gbrod18.seq
83693175 gbrod19.seq
249996663 gbrod2.seq
249961616 gbrod20.seq
249896347 gbrod21.seq
226408925 gbrod22.seq
249995572 gbrod23.seq
249992752 gbrod24.seq
249855238 gbrod25.seq
249920451 gbrod26.seq
249999814 gbrod27.seq
239022734 gbrod28.seq
249704281 gbrod3.seq
249975532 gbrod4.seq
249741473 gbrod5.seq
249951262 gbrod6.seq
249910021 gbrod7.seq
249971935 gbrod8.seq
249926262 gbrod9.seq
2554280849 gbsdr1.txt
5227187344 gbsdr2.txt
2234833970 gbsdr3.txt
140007450 gbsec.idx
249997806 gbsts1.seq
249997362 gbsts10.seq
212226966 gbsts11.seq
249996524 gbsts12.seq
249998941 gbsts13.seq
249998954 gbsts14.seq
249998821 gbsts15.seq
26930533 gbsts16.seq
249999803 gbsts17.seq
249997202 gbsts18.seq
249999013 gbsts19.seq
249998377 gbsts2.seq
137390683 gbsts20.seq
249998527 gbsts3.seq
249999545 gbsts4.seq
35366609 gbsts5.seq
249997222 gbsts6.seq
249997899 gbsts7.seq
249998458 gbsts8.seq
249997717 gbsts9.seq
249999315 gbsyn1.seq
240588380 gbsyn2.seq
249999256 gbtsa1.seq
249999101 gbtsa2.seq
249999529 gbtsa3.seq
77752144 gbtsa4.seq
28401272 gbuna1.seq
249993483 gbvrl1.seq
249996755 gbvrl10.seq
249999522 gbvrl11.seq
249997553 gbvrl12.seq
249999503 gbvrl13.seq
100533346 gbvrl14.seq
249998931 gbvrl2.seq
250000181 gbvrl3.seq
249997028 gbvrl4.seq
135038418 gbvrl5.seq
249999145 gbvrl6.seq
249974112 gbvrl7.seq
249996807 gbvrl8.seq
249998454 gbvrl9.seq
249915424 gbvrt1.seq
249950356 gbvrt10.seq
249971878 gbvrt11.seq
176867905 gbvrt12.seq
249996787 gbvrt13.seq
249970943 gbvrt14.seq
249958668 gbvrt15.seq
249998636 gbvrt16.seq
249990117 gbvrt17.seq
249999604 gbvrt18.seq
249995535 gbvrt19.seq
249998552 gbvrt2.seq
249997884 gbvrt20.seq
62482805 gbvrt21.seq
249985776 gbvrt3.seq
250000007 gbvrt4.seq
37487020 gbvrt5.seq
249998304 gbvrt6.seq
249995062 gbvrt7.seq
249873083 gbvrt8.seq
249935581 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 50129 93138553
BCT10 63 117808727
BCT11 10867 111827474
BCT12 5336 6694787
BCT13 53947 85356673
BCT14 94 110535707
BCT15 151 96466604
BCT16 60 109557523
BCT17 52 112042350
BCT18 46 111873353
BCT19 57 113989395
BCT2 66 110398637
BCT20 67 112830215
BCT21 33 84321683
BCT22 40 106881287
BCT23 58 105533856
BCT24 74 111675186
BCT25 55 110045255
BCT26 63 106845562
BCT27 55 109391288
BCT28 52 108559385
BCT29 46 110496749
BCT3 52 110815671
BCT30 95 109522868
BCT31 60 108182995
BCT32 65 108501758
BCT33 124 109249408
BCT34 34 61811577
BCT35 203 110079847
BCT36 47 108478600
BCT37 40 100489375
BCT38 54 101898771
BCT39 43 103472223
BCT4 6962 107528604
BCT40 60 101917645
BCT41 235 103592404
BCT42 414 78596941
BCT43 1589 2511823
BCT44 3176 5212972
BCT45 6347 7901820
BCT46 12648 15076174
BCT47 25630 27749063
BCT48 50581 54060737
BCT49 76745 77530927
BCT5 31495 51118317
BCT50 68828 73586760
BCT51 7412 102760767
BCT52 2934 119120454
BCT53 70144 82154763
BCT54 51828 85025268
BCT6 39037 86805303
BCT7 6534 98478828
BCT8 14338 93303228
BCT9 5237 103118303
ENV1 94097 71883020
ENV10 83384 87140519
ENV11 18666 16386312
ENV12 85262 81220898
ENV13 121275 42860328
ENV14 90832 78386397
ENV15 98864 69942502
ENV16 77852 81260324
ENV17 41563 56104803
ENV18 71602 83915596
ENV19 103353 67229955
ENV2 89388 69715553
ENV20 134926 32333997
ENV21 134253 31654740
ENV22 128977 46304465
ENV23 113035 63371884
ENV24 127445 43859292
ENV3 83583 82111361
ENV4 88686 79363910
ENV5 90163 83474204
ENV6 51330 21467237
ENV7 131838 31328278
ENV8 87002 71079961
ENV9 94189 73592635
EST1 162720 63095245
EST10 171889 70588600
EST100 232936 143233682
EST101 220764 113977162
EST102 209234 102675905
EST103 159199 103542972
EST104 61123 52084246
EST105 169151 111429873
EST106 170796 113795010
EST107 109420 61173835
EST108 64275 23526851
EST109 64370 22877416
EST11 168410 73439072
EST110 64753 23938909
EST111 64658 27037842
EST112 64808 22296366
EST113 66147 26264546
EST114 64107 27879258
EST115 64719 26699547
EST116 64901 26780068
EST117 64712 25492289
EST118 61286 40301250
EST119 181960 87492228
EST12 196380 87635223
EST120 174471 83396645
EST121 155602 95802549
EST122 149845 94745025
EST123 158934 99785928
EST124 101085 55813762
EST125 208519 103370007
EST126 155574 79220494
EST127 162866 86222013
EST128 162039 92541754
EST129 159421 85140752
EST13 20 7590
EST130 179322 108504815
EST131 213511 115095802
EST132 168383 101581766
EST133 172643 77898905
EST134 149505 84306342
EST135 153316 92636649
EST136 161429 94379674
EST137 33346 16978277
EST138 194364 110939564
EST139 234804 103443886
EST14 223625 113055637
EST140 155571 91938284
EST141 172900 95672207
EST142 149697 86741116
EST143 137558 88808763
EST144 155889 92039947
EST145 150161 77228519
EST146 125342 65473974
EST147 124892 63621170
EST148 130482 55772298
EST149 130013 51510072
EST15 169700 108254425
EST150 131525 51650716
EST151 86796 34231351
EST152 176493 87014818
EST153 185616 86774851
EST154 161026 112271053
EST155 221075 132247277
EST156 217634 123308274
EST157 170098 92018499
EST158 144039 113984989
EST159 147554 91898287
EST16 187977 112302258
EST160 145742 82560383
EST161 146160 77505571
EST162 158840 94735227
EST163 164728 92366663
EST164 40964 24377291
EST165 160332 98864724
EST166 188323 105784858
EST167 154078 86591075
EST168 130942 68417810
EST169 181365 99804533
EST17 196187 121481232
EST170 173501 103578453
EST171 151560 91621838
EST172 172696 88022550
EST173 133863 86064205
EST174 193627 111483418
EST175 156176 90068645
EST176 116575 70164388
EST177 166905 95662177
EST178 172764 104573457
EST179 183344 131897693
EST18 194465 119197740
EST180 160609 114768648
EST181 190852 90875961
EST182 153011 117053010
EST183 150957 90657563
EST184 149451 78339745
EST185 174007 80889800
EST186 152461 84408005
EST187 160448 101959283
EST188 151969 91038930
EST189 163220 102383696
EST19 171010 115179366
EST190 118805 67772389
EST191 134085 90867803
EST192 135051 90287396
EST193 146442 90480587
EST194 134810 90482024
EST195 122871 86698965
EST196 186492 97659411
EST197 177646 98057796
EST198 177175 98301610
EST199 174402 97828412
EST2 164868 62098212
EST20 208065 108120487
EST200 172101 96114692
EST201 176279 98440283
EST202 177586 96644086
EST203 165053 90673179
EST204 196157 105674257
EST205 209868 113543876
EST206 181303 107564926
EST207 194026 111480917
EST208 199618 122167274
EST209 194817 119207195
EST21 226464 109689583
EST210 190997 119272773
EST211 186617 117639198
EST212 226276 143507949
EST213 235602 115194673
EST214 77556 54816361
EST215 149218 95374131
EST216 192462 105240564
EST217 185968 121357152
EST218 107123 90526151
EST219 139413 115238413
EST22 171452 47211244
EST220 166179 96094590
EST221 149257 107744688
EST222 223424 105203469
EST223 144813 103433225
EST224 140321 99209623
EST225 140995 100318865
EST226 123944 88750173
EST227 147250 92355200
EST228 69623 46288694
EST229 135152 98725025
EST23 126926 36588319
EST230 140456 100243262
EST231 125755 85946387
EST232 134504 88129116
EST233 161409 118915808
EST234 144069 119905240
EST235 136911 112667962
EST236 162984 99640900
EST237 179948 113899924
EST238 151889 100555459
EST239 182274 121373449
EST24 132465 44183201
EST240 163045 111586137
EST241 143492 107977982
EST242 117464 70882095
EST243 227802 96804211
EST244 171389 117782880
EST245 168957 77185664
EST246 225305 44641647
EST247 218291 84042971
EST248 174753 132773457
EST249 170098 103555526
EST25 71644 29884775
EST250 173595 111073998
EST251 167544 113942551
EST252 174177 118325263
EST253 193402 102848630
EST254 14682 6903060
EST255 183405 105336722
EST256 168763 122463795
EST257 216937 105444008
EST258 281364 123180772
EST259 213018 123732101
EST26 220617 102545514
EST260 186859 37336066
EST261 261749 125952060
EST262 163908 95480429
EST263 164821 107238201
EST264 165156 108524598
EST265 74019 50097851
EST266 202147 106101136
EST267 164556 110871405
EST268 195400 114141276
EST269 206951 44263911
EST27 225224 112772382
EST270 202072 53123186
EST271 189402 108024710
EST272 181955 120130248
EST273 178360 116849323
EST274 182583 104769715
EST275 144736 97881546
EST276 184113 82108188
EST277 47202 29248807
EST278 137757 88809635
EST279 166293 97314122
EST28 187120 84904086
EST280 275100 28789318
EST281 258932 38718206
EST282 153834 107491485
EST283 166571 116126647
EST284 161617 100092844
EST285 201789 74107181
EST286 240342 59032526
EST287 164912 109022394
EST288 151296 86959457
EST289 150578 85275372
EST29 161847 70575638
EST290 183944 124572068
EST291 194858 113128055
EST292 155043 113582873
EST293 196766 111255963
EST294 181268 102250900
EST295 182521 109188860
EST296 192022 64994504
EST297 190475 70630250
EST298 190593 72695952
EST299 192076 72879211
EST3 163313 58400939
EST30 176115 70911432
EST300 81169 44762178
EST301 185825 127796178
EST302 165094 97695184
EST303 159743 93080402
EST304 129482 101233744
EST305 152104 101020945
EST306 175255 101398068
EST307 163679 97150322
EST308 174947 103034152
EST309 159380 106337965
EST31 157661 67454576
EST310 148353 103405982
EST311 168866 108692844
EST312 165978 124224316
EST313 130925 111162071
EST314 177670 115139583
EST315 146305 80804151
EST316 144715 98638040
EST317 145649 99027049
EST318 136909 91428676
EST319 152227 102913553
EST32 170966 74871492
EST320 153621 103621807
EST321 182519 108928990
EST322 152656 88661907
EST323 154376 87894808
EST324 156996 113243669
EST325 161890 96768133
EST326 147947 92896359
EST327 66520 44314541
EST328 160474 99856199
EST329 206399 108617237
EST33 182062 75137808
EST330 128022 70270392
EST331 126718 83351798
EST332 137285 87582535
EST333 136667 86760301
EST334 146980 84089740
EST335 225136 89873916
EST336 181512 85932780
EST337 169928 104692338
EST338 170376 102788324
EST339 133468 86264670
EST34 97740 27684654
EST340 136803 91543847
EST341 19496 12900786
EST342 157756 98879982
EST343 181809 122248613
EST344 167119 87031798
EST345 186090 111589757
EST346 159769 118494352
EST347 74080 44313477
EST348 114224 62562309
EST349 137321 81735564
EST35 98478 30011160
EST350 142368 73373873
EST351 161699 33117751
EST352 161675 33111390
EST353 171492 80569132
EST354 218998 126553678
EST355 44002 20529587
EST356 259042 118284796
EST357 215407 108669024
EST358 150799 97168656
EST359 138274 88921273
EST36 98727 31262839
EST360 147179 88177726
EST361 188027 115770432
EST362 239126 81196175
EST363 198658 112093113
EST364 144644 68787195
EST365 205709 124091462
EST366 189168 101897996
EST367 204767 127352398
EST368 176864 117840003
EST369 191994 106291697
EST37 97557 29687403
EST370 174614 45521836
EST371 167027 13545688
EST372 159169 21081790
EST373 161463 33612096
EST374 162059 32212162
EST375 156504 64591797
EST376 166432 95015405
EST377 180087 122322802
EST378 172490 102877404
EST379 6530 3646275
EST38 99962 30242672
EST380 161370 111831796
EST381 142741 99344026
EST382 148277 103018329
EST383 166040 108015920
EST384 153947 110370333
EST385 168164 101086055
EST386 175920 38913044
EST387 170799 60939989
EST388 159256 112456500
EST389 172065 107363558
EST39 102684 30680944
EST390 153931 97089742
EST391 185426 100229187
EST392 120433 87008101
EST393 147100 100606315
EST394 135339 92677048
EST395 155822 96963452
EST396 163260 95304164
EST397 184201 98945270
EST398 140103 88983549
EST399 179671 109971161
EST4 174466 68803450
EST40 3240 852831
EST400 157530 94863555
EST401 100034 71816257
EST402 91454 64239249
EST403 114136 72316240
EST404 127512 77047329
EST405 137883 91991572
EST406 144265 85015091
EST407 54388 36336971
EST408 177509 99901687
EST409 178535 107058788
EST41 101463 54475577
EST410 131411 61002258
EST411 167350 61234169
EST412 170924 63102995
EST413 66396 24857962
EST42 124278 52814770
EST43 168982 87927117
EST44 171186 69830396
EST45 173311 94231221
EST46 174242 89775593
EST47 165744 82099436
EST48 167058 95685655
EST49 160139 88018762
EST5 172021 67416527
EST50 164161 95867512
EST51 163832 90877753
EST52 154656 75079001
EST53 156296 94313445
EST54 34652 13920234
EST55 171474 68769432
EST56 160403 78091222
EST57 176325 102558649
EST58 158202 98331032
EST59 162879 105529729
EST6 180188 70822323
EST60 168571 102649600
EST61 167708 108675988
EST62 177963 78078366
EST63 173738 101365450
EST64 151704 79450859
EST65 155780 89030606
EST66 159374 95541771
EST67 95878 56371365
EST68 148862 88192007
EST69 195744 108381462
EST7 170983 73716740
EST70 214857 113173201
EST71 201939 115387077
EST72 211260 125002820
EST73 195007 113276936
EST74 153897 78406471
EST75 138107 64992304
EST76 147499 78413307
EST77 159349 108709268
EST78 150263 79645816
EST79 147921 84720354
EST8 183701 73248793
EST80 15280 16563956
EST81 191113 95525702
EST82 219724 128955252
EST83 211874 112016056
EST84 221822 104263389
EST85 202545 89637342
EST86 151972 92674374
EST87 153409 80867080
EST88 170045 90539702
EST89 155649 87210871
EST9 171025 74510496
EST90 156383 97621611
EST91 155569 106977311
EST92 89842 46811253
EST93 156003 119441307
EST94 144315 106421584
EST95 149560 108870750
EST96 142350 85537982
EST97 165445 93219455
EST98 179712 113491113
EST99 259359 157485572
GSS1 205737 90151884
GSS10 136885 66983898
GSS100 85200 43047350
GSS101 195380 123718914
GSS102 171366 114185986
GSS103 201450 118372853
GSS104 207406 136080212
GSS105 215150 141912857
GSS106 213762 143292018
GSS107 209587 148457787
GSS108 210968 146704567
GSS109 209200 149200160
GSS11 139072 74912075
GSS110 206541 150947967
GSS111 157135 116819470
GSS112 135282 85652801
GSS113 173615 81342799
GSS114 192454 86848535
GSS115 176129 150276324
GSS116 183067 128451320
GSS117 188350 152129646
GSS118 193551 131415435
GSS119 192460 134681160
GSS12 150162 71374253
GSS120 199519 111211673
GSS121 60002 21963097
GSS122 87168 64172121
GSS123 83557 62796554
GSS124 103733 48637516
GSS125 68569 58501441
GSS126 7289 6739945
GSS127 68689 57997997
GSS128 69318 56731875
GSS129 69558 56262131
GSS13 147467 72169409
GSS130 71310 56073507
GSS131 68163 51560938
GSS132 75915 58209304
GSS133 87237 74898207
GSS134 81830 44609896
GSS135 93312 45112248
GSS136 56352 44173694
GSS137 77438 61353715
GSS138 69655 58699702
GSS139 67711 62707076
GSS14 180923 90785082
GSS140 61743 53255060
GSS141 95658 42987107
GSS142 21258 4959164
GSS143 112672 70634090
GSS144 1088 802743
GSS145 23226 28867035
GSS146 106621 69122590
GSS147 85469 35209982
GSS148 37301 23210969
GSS149 120690 73137800
GSS15 165652 96400095
GSS150 118608 75280747
GSS151 105255 63705478
GSS152 47447 23060733
GSS153 83102 54651503
GSS154 95630 61300959
GSS155 107319 78552403
GSS156 106422 76714273
GSS157 106058 79947480
GSS158 103996 80016519
GSS159 76376 51040365
GSS16 174865 93148028
GSS160 104570 63290945
GSS161 109868 66415305
GSS162 106323 59388992
GSS163 68303 37395892
GSS164 70149 39050322
GSS165 36527 17435683
GSS166 85481 46023427
GSS167 97119 55907586
GSS168 94982 49597190
GSS169 96286 55922591
GSS17 196831 125921881
GSS170 42132 23615490
GSS171 114638 43642267
GSS172 117085 39368203
GSS173 108676 55514545
GSS174 101471 78372335
GSS175 64751 40741499
GSS176 95891 36542252
GSS177 95417 37268709
GSS178 96671 35161518
GSS179 94285 39167432
GSS18 194793 105974188
GSS180 37736 17626556
GSS181 103939 66277823
GSS182 94551 61190929
GSS183 95128 60357048
GSS184 94773 60868501
GSS185 75555 69903129
GSS186 75044 74144986
GSS187 4666 7426594
GSS188 83875 28283031
GSS189 84362 27389237
GSS19 58045 24853934
GSS190 85085 25924821
GSS191 14410 4314220
GSS192 16547 7508221
GSS193 92719 59684106
GSS194 89364 47776813
GSS195 91531 63450540
GSS196 91165 63958093
GSS197 90953 64327876
GSS198 37422 26092587
GSS199 89852 65233772
GSS2 186321 94757946
GSS20 186922 105326832
GSS200 88611 68592611
GSS201 83719 79618297
GSS202 84139 79031087
GSS203 91421 77104504
GSS204 93222 68656408
GSS205 40615 24002560
GSS206 94787 57200301
GSS207 93517 59081345
GSS208 93900 58510429
GSS209 94714 57307691
GSS21 169127 115836885
GSS210 94279 58016121
GSS211 6701 3333254
GSS22 174106 99568504
GSS23 192369 138527305
GSS24 201031 123494695
GSS25 175471 104277105
GSS26 197043 119487367
GSS27 167868 161574100
GSS28 190632 134457391
GSS29 167162 120551392
GSS3 178459 89335065
GSS30 158800 105369328
GSS31 201674 130043762
GSS32 222403 119401032
GSS33 224622 116464431
GSS34 225847 114839942
GSS35 216729 131101779
GSS36 202761 159857212
GSS37 199140 148663094
GSS38 188814 55216002
GSS39 186264 106276103
GSS4 169841 86595170
GSS40 191287 139003904
GSS41 150450 135112743
GSS42 187635 102192144
GSS43 178163 125538896
GSS44 189664 127763305
GSS45 194848 125935160
GSS46 53378 50176471
GSS47 175399 104013141
GSS48 170991 105338684
GSS49 171834 105224139
GSS5 37544 23513994
GSS50 186393 124599840
GSS51 190585 117318295
GSS52 190213 125115988
GSS53 189040 119447668
GSS54 189613 132326833
GSS55 193162 112115566
GSS56 194513 124513982
GSS57 139563 107277239
GSS58 176476 141454714
GSS59 164986 113500649
GSS6 165210 86460572
GSS60 164779 113943857
GSS61 148738 100740798
GSS62 160467 131405540
GSS63 173051 144906739
GSS64 187621 121769674
GSS65 207366 129089154
GSS66 196666 113307434
GSS67 251746 131206722
GSS68 157529 105633959
GSS69 165273 126099008
GSS7 168976 80580102
GSS70 165920 126998742
GSS71 168035 126901189
GSS72 184858 114659346
GSS73 154009 113586890
GSS74 204050 129689291
GSS75 174727 115109534
GSS76 204933 135093898
GSS77 228102 77375903
GSS78 187368 115295212
GSS79 125986 93231840
GSS8 169076 90832874
GSS80 148425 119507303
GSS81 143035 118701477
GSS82 146611 118593717
GSS83 146502 121757582
GSS84 147311 120547377
GSS85 66440 55012182
GSS86 153116 125189617
GSS87 151211 119797798
GSS88 147162 116207624
GSS89 146029 118503255
GSS9 138817 67702797
GSS90 148214 123451695
GSS91 151860 123280019
GSS92 150921 121305940
GSS93 149487 124131451
GSS94 149686 123749265
GSS95 150354 122457806
GSS96 147975 115583377
GSS97 145074 117966648
GSS98 148906 124769077
GSS99 184805 128714481
HTC1 25164 27215418
HTC10 64587 67585774
HTC11 74328 76898576
HTC12 20204 29486472
HTC13 66997 61008541
HTC14 68363 69531763
HTC15 16577 11453490
HTC2 16164 36511526
HTC3 16149 36817210
HTC4 16389 35869962
HTC5 16090 40460616
HTC6 16183 37869996
HTC7 55417 33894056
HTC8 28886 15587525
HTC9 63313 78213484
HTG1 1318 188816333
HTG10 1297 186286287
HTG100 989 189369425
HTG101 997 189355232
HTG102 985 189268172
HTG103 1164 190522467
HTG104 41 5945817
HTG105 1100 189743184
HTG106 1047 189726170
HTG107 1401 191444368
HTG108 1318 190907155
HTG109 1616 191177558
HTG11 9 1245953
HTG110 1478 191755007
HTG111 1214 189302520
HTG112 1080 185871131
HTG113 402 62261379
HTG114 1515 182294205
HTG115 988 191960558
HTG116 736 168757680
HTG117 1089 193802729
HTG118 1100 193078380
HTG119 473 87900552
HTG12 1451 183812880
HTG120 1031 189819780
HTG121 1055 192660679
HTG122 1161 192020915
HTG123 1080 192851758
HTG124 1075 192962984
HTG125 770 134777791
HTG126 1123 192703563
HTG127 1091 192430148
HTG128 1081 192496690
HTG129 1092 192304208
HTG13 875 191618536
HTG130 1085 191984219
HTG131 1083 192263613
HTG132 1084 192178977
HTG133 1113 192288180
HTG134 1062 152174513
HTG14 749 191988753
HTG15 744 191907544
HTG16 784 192068000
HTG17 801 191866013
HTG18 770 191975516
HTG19 2068 170719681
HTG2 2464 186026155
HTG20 1089 187382584
HTG21 915 183242503
HTG22 785 191714725
HTG23 928 190117252
HTG24 905 190314657
HTG25 811 191316604
HTG26 783 191762069
HTG27 874 190682406
HTG28 895 190444801
HTG29 939 189986631
HTG3 2515 185243126
HTG30 909 190777789
HTG31 850 173196711
HTG32 875 191225262
HTG33 967 189535281
HTG34 884 191035830
HTG35 865 191204216
HTG36 826 191680479
HTG37 948 189926994
HTG38 949 190452451
HTG39 940 190279791
HTG4 2554 188402426
HTG40 1046 189124250
HTG41 1104 170101894
HTG42 1259 187973591
HTG43 1170 187983878
HTG44 1150 187972384
HTG45 1116 191079408
HTG46 1268 190655764
HTG47 1174 191049552
HTG48 1133 191313318
HTG49 1046 191200841
HTG5 1283 185543864
HTG50 1027 189678812
HTG51 1051 179615774
HTG52 969 190090757
HTG53 1106 190075891
HTG54 1045 190185372
HTG55 1014 189817413
HTG56 968 189149436
HTG57 90 15745571
HTG58 1010 189317741
HTG59 1030 189833096
HTG6 1273 185016781
HTG60 1068 187461057
HTG61 1129 188223655
HTG62 1005 173411735
HTG63 1086 189603916
HTG64 1065 189567157
HTG65 1169 188837961
HTG66 1178 187479908
HTG67 1283 184490539
HTG68 95 12336833
HTG69 1221 185314622
HTG7 1275 185326125
HTG70 1239 184674446
HTG71 1244 184625496
HTG72 1183 187671288
HTG73 1033 172337271
HTG74 1118 188295824
HTG75 1102 190880961
HTG76 1137 190800163
HTG77 1183 190908674
HTG78 1109 188400466
HTG79 1171 190202159
HTG8 1459 184483094
HTG80 1115 190051467
HTG81 1214 190006488
HTG82 1120 189666721
HTG83 965 165766114
HTG84 1228 188383308
HTG85 1255 187809224
HTG86 1143 190042868
HTG87 1147 189737579
HTG88 1003 172171849
HTG89 1178 189850686
HTG9 1200 186953640
HTG90 1110 190156190
HTG91 1145 190208248
HTG92 1101 190542086
HTG93 1034 170659525
HTG94 1056 190753054
HTG95 1156 191024620
HTG96 1041 189192123
HTG97 1069 189534368
HTG98 707 131791203
HTG99 1018 189690522
INV1 93974 48746852
INV10 57896 88428848
INV11 83940 65330144
INV12 52245 41375982
INV13 85741 64852358
INV14 81229 66677137
INV15 78453 68386486
INV16 45927 103569293
INV17 175 155177005
INV18 11038 143367941
INV19 57342 87207410
INV2 4112 181096071
INV20 65755 75149237
INV21 15879 67651827
INV3 969 160465999
INV4 27793 118521251
INV5 79423 70951275
INV6 33054 115167793
INV7 47074 98958440
INV8 76 37255
INV9 80659 71854297
MAM1 13735 164079683
MAM2 30118 141863774
MAM3 48896 100136185
MAM4 44128 133470378
MAM5 72013 88426039
MAM6 18933 18021233
PAT1 222542 70116699
PAT10 124676 102525103
PAT100 150217 108404022
PAT101 356051 11379688
PAT102 257211 57607099
PAT103 104030 47184688
PAT104 202624 47408098
PAT105 275088 9862650
PAT106 220268 46461610
PAT107 110638 2979117
PAT108 268989 21637646
PAT109 187202 59837899
PAT11 98167 63999786
PAT110 108382 107018298
PAT111 117367 73096985
PAT112 77656 96296327
PAT113 118958 85167176
PAT114 163155 74736463
PAT115 132780 42143304
PAT12 142111 62830898
PAT13 105850 59912061
PAT14 103665 50124884
PAT15 121034 53296647
PAT16 113144 61254142
PAT17 39232 16269264
PAT18 146866 52619866
PAT19 153883 78031245
PAT2 194544 84644913
PAT20 105042 118278487
PAT21 133347 95768472
PAT22 84481 78926117
PAT23 123531 103395212
PAT24 119447 105666574
PAT25 145592 86690945
PAT26 174984 64276321
PAT27 71446 1786150
PAT28 102177 77405969
PAT29 93962 87636161
PAT3 171983 95894231
PAT30 119942 61669610
PAT31 96656 78962257
PAT32 128375 55039784
PAT33 92198 51109053
PAT34 111301 78150375
PAT35 137080 29095092
PAT36 158181 23471538
PAT37 114369 49613938
PAT38 46523 54621373
PAT39 95733 83195520
PAT4 153734 106065135
PAT40 100231 70980964
PAT41 135089 39275339
PAT42 144315 33844719
PAT43 123824 64442465
PAT44 104083 81650982
PAT45 92446 75339006
PAT46 113588 66146062
PAT47 66645 55631057
PAT48 135193 108001084
PAT49 167081 97032398
PAT5 57197 23951583
PAT50 116397 127555645
PAT51 196343 76722711
PAT52 80302 127991032
PAT53 27631 180872621
PAT54 185408 93066629
PAT55 274454 6861350
PAT56 129252 31622558
PAT57 161341 77814723
PAT58 92876 89468615
PAT59 106726 74665050
PAT6 170642 91909261
PAT60 122357 64030175
PAT61 67070 30226344
PAT62 70750 109767817
PAT63 87947 82758966
PAT64 92971 78937516
PAT65 93166 72441718
PAT66 93384 75085880
PAT67 115295 60519183
PAT68 103216 9953783
PAT69 175346 10510347
PAT7 154826 88273196
PAT70 171510 10872527
PAT71 171496 10866712
PAT72 100446 86262564
PAT73 99 196466297
PAT74 67 192869889
PAT75 103 195600591
PAT76 1136 196318666
PAT77 97600 5772327
PAT78 151009 9636510
PAT79 151022 9621259
PAT8 131191 97047524
PAT80 151024 9622125
PAT81 151021 9620837
PAT82 113727 5119145
PAT83 342935 8573375
PAT84 188806 88519660
PAT85 111348 132068608
PAT86 3850 194703659
PAT87 131292 110979300
PAT88 158599 54826034
PAT89 224735 34113732
PAT9 129606 101125347
PAT90 250080 15844368
PAT91 180675 63676831
PAT92 51648 26046194
PAT93 114200 110462388
PAT94 137680 83273539
PAT95 164184 99340657
PAT96 158860 103334939
PAT97 137435 114993907
PAT98 42311 27994848
PAT99 193712 81686401
PHG1 5390 41832607
PLN1 59728 93353407
PLN10 37356 72617254
PLN11 14006 137385791
PLN12 7658 36936511
PLN13 17557 144703865
PLN14 17615 146179384
PLN15 17549 146270813
PLN16 24619 128984358
PLN17 5574 151050426
PLN18 1237 170149428
PLN19 16304 151336809
PLN2 18577 141822037
PLN20 4906 5935113
PLN21 67388 69831072
PLN22 28491 30747138
PLN23 76936 76281805
PLN24 65499 81569690
PLN25 41180 116507304
PLN26 16493 138654886
PLN27 19873 131449899
PLN28 77658 74621702
PLN29 94338 62565949
PLN3 1410 182438573
PLN30 40824 32522506
PLN31 80877 71171951
PLN32 77979 76024477
PLN33 80223 70492130
PLN34 81533 76688952
PLN35 114956 48001964
PLN36 79020 72348671
PLN37 55901 87528952
PLN38 78505 77308256
PLN39 66332 84029382
PLN4 1921 188257815
PLN40 9566 21175694
PLN5 1766 194577667
PLN6 28284 133411672
PLN7 70906 71319708
PLN8 73346 76127542
PLN9 37171 49285028
PRI1 23014 59643101
PRI10 1283 179494426
PRI11 733 89130244
PRI12 1278 179183454
PRI13 1451 177770436
PRI14 1589 180081042
PRI15 1591 181937113
PRI16 1285 191720991
PRI17 1137 193649856
PRI18 1099 194306169
PRI19 1166 193657866
PRI2 17028 151143783
PRI20 1800 191773352
PRI21 9411 176690096
PRI22 13147 28853456
PRI23 32483 85336292
PRI24 61487 78326126
PRI25 30556 68508260
PRI26 6602 167012246
PRI27 2120 180826269
PRI28 1603 181698932
PRI29 2030 181862205
PRI3 1435 175609230
PRI30 1976 180732170
PRI31 13056 154652338
PRI32 1294 183076240
PRI33 43859 104099795
PRI34 21440 27298328
PRI35 32191 63614159
PRI36 20231 117529774
PRI37 18693 146994694
PRI38 67429 87026617
PRI39 52063 88846307
PRI4 1287 185839791
PRI40 64604 92991942
PRI41 29009 55786496
PRI5 1316 183718556
PRI6 1182 180327906
PRI7 1252 181246577
PRI8 1216 177974811
PRI9 1358 174624357
ROD1 31197 142545858
ROD10 981 180991520
ROD11 194 36549761
ROD12 1034 185475616
ROD13 940 182704112
ROD14 1040 189324025
ROD15 950 180306408
ROD16 966 181926259
ROD17 991 185797836
ROD18 1189 190286513
ROD19 16120 37301241
ROD2 913 175303522
ROD20 20161 149008856
ROD21 1137 182391172
ROD22 1061 165449321
ROD23 13730 162742399
ROD24 38681 69962970
ROD25 21916 104190590
ROD26 1515 187906430
ROD27 138051 36817479
ROD28 74305 69928171
ROD3 908 173219528
ROD4 901 173974026
ROD5 920 174119067
ROD6 973 178538098
ROD7 966 179381602
ROD8 981 181394215
ROD9 996 182237014
STS1 85098 36489811
STS10 57907 44419978
STS11 49213 37736560
STS12 57924 43637361
STS13 64506 42956287
STS14 93352 34059031
STS15 103301 26255163
STS16 11030 2984843
STS17 102990 27289864
STS18 87042 34346526
STS19 98874 33238633
STS2 84890 49888955
STS20 52052 18820747
STS3 67652 26337165
STS4 75523 36980000
STS5 7625 4474061
STS6 54177 31603126
STS7 54081 31788805
STS8 54235 31906296
STS9 55657 37682948
SYN1 45213 72391348
SYN2 47119 68047422
TSA1 124812 37991374
TSA2 119115 44237710
TSA3 116345 43363672
TSA4 31591 15724373
UNA1 227 13236781
VRL1 71591 66401522
VRL10 57192 73523891
VRL11 58600 73120338
VRL12 60615 70078515
VRL13 60976 75291048
VRL14 28436 27027957
VRL2 72728 64230547
VRL3 70695 63763538
VRL4 70032 68798674
VRL5 32911 37661894
VRL6 48432 77506872
VRL7 62578 73074732
VRL8 69071 66061558
VRL9 63448 71483996
VRT1 31065 141115769
VRT10 1257 189469015
VRT11 8282 178103459
VRT12 3947 130208344
VRT13 13242 170744397
VRT14 5213 183187100
VRT15 3954 186259983
VRT16 39791 131204365
VRT17 80258 68413920
VRT18 78037 67377868
VRT19 78948 65134436
VRT2 17936 167812802
VRT20 64949 94979350
VRT21 19311 18369761
VRT3 55815 102664286
VRT4 26971 144860397
VRT5 11999 10264849
VRT6 73022 66848386
VRT7 31735 63525494
VRT8 30251 116888211
VRT9 1207 190097961
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 177.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:
Entries Bases Species
14661813 14675829480 Homo sapiens
7864719 8850187116 Mus musculus
2000118 6283974613 Rattus norvegicus
2179964 5355764557 Bos taurus
3890820 5034163602 Zea mays
3217695 4778268370 Sus scrofa
1697206 3052524947 Danio rerio
228209 1352880670 Strongylocentrotus purpuratus
1241806 1195864179 Oryza sativa Japonica Group
1753889 1185779622 Nicotiana tabacum
1423873 1146958794 Xenopus (Silurana) tropicalis
1205719 1043367600 Drosophila melanogaster
213748 999755722 Pan troglodytes
2286014 993961755 Arabidopsis thaliana
1435337 932443900 Canis lupus familiaris
655957 911105678 Vitis vinifera
808694 889675519 Gallus gallus
1840687 864995575 Glycine max
79871 816072773 Macaca mulatta
1216189 748184685 Ciona intestinalis
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
April 15 2010
NCBI-GenBank Flat File Release 177.0
Bacterial Sequences (Part 1)
25389 loci, 102437874 bases, from 25389 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
or 2010.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
DBLINK Project:18787
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK Project:100,200,300
DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:
http://www.ncbi.nlm.nih.gov/genomes/static/gprj_help.html#introduction
As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 177.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Michel Eschenbrenner, Irene Fang,
Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
Susan Schafer, Beverly Underwood, Melissa Wright, and Linda Yankie
Data Management and Preparation
Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
Eugene Yaschenko, Sergey Zhdanov
Database Administration
Bob Calahan, Slava Khotomliansky, Igor Lozitskiy, Eugene Semenov, Ben Slade,
Constantin Vasilyev
User Support
Peter Cooper, Wayne Matten, Scott McGinnis, Steve Pechous, Monica Romiti,
Eric Sayers, Tao Tao, Majda Valjavec-Gratian
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
