Release Notes For GenBank Release 180
GBREL.TXT Genetic Sequence Data Bank
October 15 2010
NCBI-GenBank Flat File Release 180.0
Distribution Release Notes
125764384 loci, 118551641086 bases, from 125764384 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 180.0
1.2 Cutoff Date
1.3 Important Changes in Release 180.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 180.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for GenBank's web-based submission tool (BankIt) :
http://www.ncbi.nlm.nih.gov/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 180.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana, courtesy of the Bio-Mirror project:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:
http://www.bio-mirror.net/
1.2 Cutoff Date
This full release, 180.0, incorporates data available to the collaborating
databases as of October 15, 2010 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 180.0
1.3.1 Organizational changes
The total number of sequence data files increased by 26 with this release:
- the BCT division is now composed of 60 files (+1)
- the CON division is now composed of 142 files (+2)
- the ENV division is now composed of 30 files (+1)
- the EST division is now composed of 422 files (+3)
- the GSS division is now composed of 217 files (+2)
- the HTG division is now composed of 136 files (+1)
- the INV division is now composed of 25 files (+1)
- the PAT division is now composed of 128 files (+7)
- the PLN division is now composed of 43 files (+1)
- the PRI division is now composed of 42 files (+1)
- the SYN division is now composed of 3 files (+1)
- the TSA division is now composed of 12 files (+4)
- the VRT division is now composed of 22 files (+1)
The total number of 'index' files increased by 6 with this release:
- the AUT (author name) index is now composed of 80 files (+5)
- the JOU (journal name) index is now composed of 10 files (+1)
1.3.2 /artificial_location is now a controlled-value qualifier
The /artificial_location is now a controlled-vocabulary qualifier,
with values of "heterogenous population sequenced" or "low-quality
sequence region", as of the October 2010 GenBank Release.
1.3.3 Discontinued qualifiers: /codon and /label
With October's GenBank Release 180.0, both the /codon and /label
qualifiers have been discontinued.
Existing /codon qualifiers have been replaced by the appropriate
/transl_except qualifier. If the /codon qualifier impacted multiple
protein residues of a coding region's translation, a /transl_except
has been added for each such residue.
The text from existing /label qualifiers have been moved to /note
qualifers of the features involved.
1.3.4 Discontinued feature: conflict
The conflict feature has been discontinued as of the October 2010
GenBank Release. Existing conflict features have been converted to
misc_difference (which supports all of the qualifiers that conflict
used to).
1.3.5 New feature: mobile_element
A new feature for the annotation of gene cassettes, transposons, and
insertion sequences is now supported as of this October 2010 GenBank
Release: mobile_element .
This new feature has a mandatory /mobile_element_type qualifier, to
provide information about the nature of the mobile element. At present,
this is a free-text qualifier.
Existing repeat_region features that possessed /mobile_element qualifiers
have been converted to mobile_element features. All qualifiers other than
/mobile_element which have been legal for repeat_region are also supported
for mobile_element, and they were moved to the new feature during the
conversion.
We expect that the /mobile_element qualifier will be discontinued within
a fairly short time.
1.3.6 Three previously-announced changes delayed
Three of the Feature-Table changes that were agreed to at the May 2010
International Nucleotide Sequence Database Collaboration annual meeting,
and scheduled for October 2010 implementation, will be delayed. These
changes are:
Discontinuation of the /partial qualifier.
A classification system for /inference and /experiment.
Introduction of the /whole_replicon qualifier.
See Section 1.4 (Upcoming Changes) for further details.
1.3.7 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.8 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
ninety-four of the GSS flatfiles in Release 180.0. Consider gbgss124.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
October 15 2010
NCBI-GenBank Flat File Release 180.0
GSS Sequences (Part 1)
87146 loci, 64102517 bases, from 87146 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "124" based on the number of files dumped from the other
system. We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.
1.4 Upcoming Changes
A variety of changes affecting the GenBank flatfile format were implemented
in October 2010, as a result of discussions among DDBJ, EBI, and NCBI at the
May 2010 International Nucleotide Sequence Database Collaboration annual
meeting.
However, three of the planned changes could not be completed for this
October 15 GenBank 180.0 release:
a) The /partial qualifier will be discontinued, given that 5' and 3'
partiality can be indicated via a feature's location ('<' and '>').
b) A classification system will be introduced for the /inference and
/experiment qualifiers, such that the inferential or experimental
information can be associated with a feature's existence, location,
or description.
c) A /whole_replicon qualifier will be introduced, allowing records
which represent the entirety of a replicon (a chromosome; an organelle;
a mitochondrial plasmid) to be identified as such.
An investigation of (a) for older sequence records has thrown into question
whether the /partial qualifier can actually be done away with. On-going
review over the next few weeks will determine whether this change will be
implemented as agreed, amended, or abandoned.
The implementation of (b) has been delayed because of delays in software
development supporting the new classification system. However, those delays
are short-lived and we expect that the change will be completed well before
the December 2010 GenBank release.
Specification of the conditions under which the /whole_replicon qualifier
is, and is not, allowed to be used for sequence records is not yet complete,
so implementation of (c) will likewise be delayed for a number of weeks.
We will inform GenBank users when the issues impacting these three changes
have been clarified.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1475 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut74.idx - Index of the entries according to author name, part 74.
76. gbaut75.idx - Index of the entries according to author name, part 75.
77. gbaut76.idx - Index of the entries according to author name, part 76.
78. gbaut77.idx - Index of the entries according to author name, part 77.
79. gbaut78.idx - Index of the entries according to author name, part 78.
80. gbaut79.idx - Index of the entries according to author name, part 79.
81. gbaut8.idx - Index of the entries according to author name, part 8.
82. gbaut80.idx - Index of the entries according to author name, part 80.
83. gbaut9.idx - Index of the entries according to author name, part 9.
84. gbbct1.seq - Bacterial sequence entries, part 1.
85. gbbct10.seq - Bacterial sequence entries, part 10.
86. gbbct11.seq - Bacterial sequence entries, part 11.
87. gbbct12.seq - Bacterial sequence entries, part 12.
88. gbbct13.seq - Bacterial sequence entries, part 13.
89. gbbct14.seq - Bacterial sequence entries, part 14.
90. gbbct15.seq - Bacterial sequence entries, part 15.
91. gbbct16.seq - Bacterial sequence entries, part 16.
92. gbbct17.seq - Bacterial sequence entries, part 17.
93. gbbct18.seq - Bacterial sequence entries, part 18.
94. gbbct19.seq - Bacterial sequence entries, part 19.
95. gbbct2.seq - Bacterial sequence entries, part 2.
96. gbbct20.seq - Bacterial sequence entries, part 20.
97. gbbct21.seq - Bacterial sequence entries, part 21.
98. gbbct22.seq - Bacterial sequence entries, part 22.
99. gbbct23.seq - Bacterial sequence entries, part 23.
100. gbbct24.seq - Bacterial sequence entries, part 24.
101. gbbct25.seq - Bacterial sequence entries, part 25.
102. gbbct26.seq - Bacterial sequence entries, part 26.
103. gbbct27.seq - Bacterial sequence entries, part 27.
104. gbbct28.seq - Bacterial sequence entries, part 28.
105. gbbct29.seq - Bacterial sequence entries, part 29.
106. gbbct3.seq - Bacterial sequence entries, part 3.
107. gbbct30.seq - Bacterial sequence entries, part 30.
108. gbbct31.seq - Bacterial sequence entries, part 31.
109. gbbct32.seq - Bacterial sequence entries, part 32.
110. gbbct33.seq - Bacterial sequence entries, part 33.
111. gbbct34.seq - Bacterial sequence entries, part 34.
112. gbbct35.seq - Bacterial sequence entries, part 35.
113. gbbct36.seq - Bacterial sequence entries, part 36.
114. gbbct37.seq - Bacterial sequence entries, part 37.
115. gbbct38.seq - Bacterial sequence entries, part 38.
116. gbbct39.seq - Bacterial sequence entries, part 39.
117. gbbct4.seq - Bacterial sequence entries, part 4.
118. gbbct40.seq - Bacterial sequence entries, part 40.
119. gbbct41.seq - Bacterial sequence entries, part 41.
120. gbbct42.seq - Bacterial sequence entries, part 42.
121. gbbct43.seq - Bacterial sequence entries, part 43.
122. gbbct44.seq - Bacterial sequence entries, part 44.
123. gbbct45.seq - Bacterial sequence entries, part 45.
124. gbbct46.seq - Bacterial sequence entries, part 46.
125. gbbct47.seq - Bacterial sequence entries, part 47.
126. gbbct48.seq - Bacterial sequence entries, part 48.
127. gbbct49.seq - Bacterial sequence entries, part 49.
128. gbbct5.seq - Bacterial sequence entries, part 5.
129. gbbct50.seq - Bacterial sequence entries, part 50.
130. gbbct51.seq - Bacterial sequence entries, part 51.
131. gbbct52.seq - Bacterial sequence entries, part 52.
132. gbbct53.seq - Bacterial sequence entries, part 53.
133. gbbct54.seq - Bacterial sequence entries, part 54.
134. gbbct55.seq - Bacterial sequence entries, part 55.
135. gbbct56.seq - Bacterial sequence entries, part 56.
136. gbbct57.seq - Bacterial sequence entries, part 57.
137. gbbct58.seq - Bacterial sequence entries, part 58.
138. gbbct59.seq - Bacterial sequence entries, part 59.
139. gbbct6.seq - Bacterial sequence entries, part 6.
140. gbbct60.seq - Bacterial sequence entries, part 60.
141. gbbct7.seq - Bacterial sequence entries, part 7.
142. gbbct8.seq - Bacterial sequence entries, part 8.
143. gbbct9.seq - Bacterial sequence entries, part 9.
144. gbchg.txt - Accession numbers of entries updated since the previous release.
145. gbcon1.seq - Constructed sequence entries, part 1.
146. gbcon10.seq - Constructed sequence entries, part 10.
147. gbcon100.seq - Constructed sequence entries, part 100.
148. gbcon101.seq - Constructed sequence entries, part 101.
149. gbcon102.seq - Constructed sequence entries, part 102.
150. gbcon103.seq - Constructed sequence entries, part 103.
151. gbcon104.seq - Constructed sequence entries, part 104.
152. gbcon105.seq - Constructed sequence entries, part 105.
153. gbcon106.seq - Constructed sequence entries, part 106.
154. gbcon107.seq - Constructed sequence entries, part 107.
155. gbcon108.seq - Constructed sequence entries, part 108.
156. gbcon109.seq - Constructed sequence entries, part 109.
157. gbcon11.seq - Constructed sequence entries, part 11.
158. gbcon110.seq - Constructed sequence entries, part 110.
159. gbcon111.seq - Constructed sequence entries, part 111.
160. gbcon112.seq - Constructed sequence entries, part 112.
161. gbcon113.seq - Constructed sequence entries, part 113.
162. gbcon114.seq - Constructed sequence entries, part 114.
163. gbcon115.seq - Constructed sequence entries, part 115.
164. gbcon116.seq - Constructed sequence entries, part 116.
165. gbcon117.seq - Constructed sequence entries, part 117.
166. gbcon118.seq - Constructed sequence entries, part 118.
167. gbcon119.seq - Constructed sequence entries, part 119.
168. gbcon12.seq - Constructed sequence entries, part 12.
169. gbcon120.seq - Constructed sequence entries, part 120.
170. gbcon121.seq - Constructed sequence entries, part 121.
171. gbcon122.seq - Constructed sequence entries, part 122.
172. gbcon123.seq - Constructed sequence entries, part 123.
173. gbcon124.seq - Constructed sequence entries, part 124.
174. gbcon125.seq - Constructed sequence entries, part 125.
175. gbcon126.seq - Constructed sequence entries, part 126.
176. gbcon127.seq - Constructed sequence entries, part 127.
177. gbcon128.seq - Constructed sequence entries, part 128.
178. gbcon129.seq - Constructed sequence entries, part 129.
179. gbcon13.seq - Constructed sequence entries, part 13.
180. gbcon130.seq - Constructed sequence entries, part 130.
181. gbcon131.seq - Constructed sequence entries, part 131.
182. gbcon132.seq - Constructed sequence entries, part 132.
183. gbcon133.seq - Constructed sequence entries, part 133.
184. gbcon134.seq - Constructed sequence entries, part 134.
185. gbcon135.seq - Constructed sequence entries, part 135.
186. gbcon136.seq - Constructed sequence entries, part 136.
187. gbcon137.seq - Constructed sequence entries, part 137.
188. gbcon138.seq - Constructed sequence entries, part 138.
189. gbcon139.seq - Constructed sequence entries, part 139.
190. gbcon14.seq - Constructed sequence entries, part 14.
191. gbcon140.seq - Constructed sequence entries, part 140.
192. gbcon141.seq - Constructed sequence entries, part 141.
193. gbcon142.seq - Constructed sequence entries, part 142.
194. gbcon15.seq - Constructed sequence entries, part 15.
195. gbcon16.seq - Constructed sequence entries, part 16.
196. gbcon17.seq - Constructed sequence entries, part 17.
197. gbcon18.seq - Constructed sequence entries, part 18.
198. gbcon19.seq - Constructed sequence entries, part 19.
199. gbcon2.seq - Constructed sequence entries, part 2.
200. gbcon20.seq - Constructed sequence entries, part 20.
201. gbcon21.seq - Constructed sequence entries, part 21.
202. gbcon22.seq - Constructed sequence entries, part 22.
203. gbcon23.seq - Constructed sequence entries, part 23.
204. gbcon24.seq - Constructed sequence entries, part 24.
205. gbcon25.seq - Constructed sequence entries, part 25.
206. gbcon26.seq - Constructed sequence entries, part 26.
207. gbcon27.seq - Constructed sequence entries, part 27.
208. gbcon28.seq - Constructed sequence entries, part 28.
209. gbcon29.seq - Constructed sequence entries, part 29.
210. gbcon3.seq - Constructed sequence entries, part 3.
211. gbcon30.seq - Constructed sequence entries, part 30.
212. gbcon31.seq - Constructed sequence entries, part 31.
213. gbcon32.seq - Constructed sequence entries, part 32.
214. gbcon33.seq - Constructed sequence entries, part 33.
215. gbcon34.seq - Constructed sequence entries, part 34.
216. gbcon35.seq - Constructed sequence entries, part 35.
217. gbcon36.seq - Constructed sequence entries, part 36.
218. gbcon37.seq - Constructed sequence entries, part 37.
219. gbcon38.seq - Constructed sequence entries, part 38.
220. gbcon39.seq - Constructed sequence entries, part 39.
221. gbcon4.seq - Constructed sequence entries, part 4.
222. gbcon40.seq - Constructed sequence entries, part 40.
223. gbcon41.seq - Constructed sequence entries, part 41.
224. gbcon42.seq - Constructed sequence entries, part 42.
225. gbcon43.seq - Constructed sequence entries, part 43.
226. gbcon44.seq - Constructed sequence entries, part 44.
227. gbcon45.seq - Constructed sequence entries, part 45.
228. gbcon46.seq - Constructed sequence entries, part 46.
229. gbcon47.seq - Constructed sequence entries, part 47.
230. gbcon48.seq - Constructed sequence entries, part 48.
231. gbcon49.seq - Constructed sequence entries, part 49.
232. gbcon5.seq - Constructed sequence entries, part 5.
233. gbcon50.seq - Constructed sequence entries, part 50.
234. gbcon51.seq - Constructed sequence entries, part 51.
235. gbcon52.seq - Constructed sequence entries, part 52.
236. gbcon53.seq - Constructed sequence entries, part 53.
237. gbcon54.seq - Constructed sequence entries, part 54.
238. gbcon55.seq - Constructed sequence entries, part 55.
239. gbcon56.seq - Constructed sequence entries, part 56.
240. gbcon57.seq - Constructed sequence entries, part 57.
241. gbcon58.seq - Constructed sequence entries, part 58.
242. gbcon59.seq - Constructed sequence entries, part 59.
243. gbcon6.seq - Constructed sequence entries, part 6.
244. gbcon60.seq - Constructed sequence entries, part 60.
245. gbcon61.seq - Constructed sequence entries, part 61.
246. gbcon62.seq - Constructed sequence entries, part 62.
247. gbcon63.seq - Constructed sequence entries, part 63.
248. gbcon64.seq - Constructed sequence entries, part 64.
249. gbcon65.seq - Constructed sequence entries, part 65.
250. gbcon66.seq - Constructed sequence entries, part 66.
251. gbcon67.seq - Constructed sequence entries, part 67.
252. gbcon68.seq - Constructed sequence entries, part 68.
253. gbcon69.seq - Constructed sequence entries, part 69.
254. gbcon7.seq - Constructed sequence entries, part 7.
255. gbcon70.seq - Constructed sequence entries, part 70.
256. gbcon71.seq - Constructed sequence entries, part 71.
257. gbcon72.seq - Constructed sequence entries, part 72.
258. gbcon73.seq - Constructed sequence entries, part 73.
259. gbcon74.seq - Constructed sequence entries, part 74.
260. gbcon75.seq - Constructed sequence entries, part 75.
261. gbcon76.seq - Constructed sequence entries, part 76.
262. gbcon77.seq - Constructed sequence entries, part 77.
263. gbcon78.seq - Constructed sequence entries, part 78.
264. gbcon79.seq - Constructed sequence entries, part 79.
265. gbcon8.seq - Constructed sequence entries, part 8.
266. gbcon80.seq - Constructed sequence entries, part 80.
267. gbcon81.seq - Constructed sequence entries, part 81.
268. gbcon82.seq - Constructed sequence entries, part 82.
269. gbcon83.seq - Constructed sequence entries, part 83.
270. gbcon84.seq - Constructed sequence entries, part 84.
271. gbcon85.seq - Constructed sequence entries, part 85.
272. gbcon86.seq - Constructed sequence entries, part 86.
273. gbcon87.seq - Constructed sequence entries, part 87.
274. gbcon88.seq - Constructed sequence entries, part 88.
275. gbcon89.seq - Constructed sequence entries, part 89.
276. gbcon9.seq - Constructed sequence entries, part 9.
277. gbcon90.seq - Constructed sequence entries, part 90.
278. gbcon91.seq - Constructed sequence entries, part 91.
279. gbcon92.seq - Constructed sequence entries, part 92.
280. gbcon93.seq - Constructed sequence entries, part 93.
281. gbcon94.seq - Constructed sequence entries, part 94.
282. gbcon95.seq - Constructed sequence entries, part 95.
283. gbcon96.seq - Constructed sequence entries, part 96.
284. gbcon97.seq - Constructed sequence entries, part 97.
285. gbcon98.seq - Constructed sequence entries, part 98.
286. gbcon99.seq - Constructed sequence entries, part 99.
287. gbdel.txt - Accession numbers of entries deleted since the previous release.
288. gbenv1.seq - Environmental sampling sequence entries, part 1.
289. gbenv10.seq - Environmental sampling sequence entries, part 10.
290. gbenv11.seq - Environmental sampling sequence entries, part 11.
291. gbenv12.seq - Environmental sampling sequence entries, part 12.
292. gbenv13.seq - Environmental sampling sequence entries, part 13.
293. gbenv14.seq - Environmental sampling sequence entries, part 14.
294. gbenv15.seq - Environmental sampling sequence entries, part 15.
295. gbenv16.seq - Environmental sampling sequence entries, part 16.
296. gbenv17.seq - Environmental sampling sequence entries, part 17.
297. gbenv18.seq - Environmental sampling sequence entries, part 18.
298. gbenv19.seq - Environmental sampling sequence entries, part 19.
299. gbenv2.seq - Environmental sampling sequence entries, part 2.
300. gbenv20.seq - Environmental sampling sequence entries, part 20.
301. gbenv21.seq - Environmental sampling sequence entries, part 21.
302. gbenv22.seq - Environmental sampling sequence entries, part 22.
303. gbenv23.seq - Environmental sampling sequence entries, part 23.
304. gbenv24.seq - Environmental sampling sequence entries, part 24.
305. gbenv25.seq - Environmental sampling sequence entries, part 25.
306. gbenv26.seq - Environmental sampling sequence entries, part 26.
307. gbenv27.seq - Environmental sampling sequence entries, part 27.
308. gbenv28.seq - Environmental sampling sequence entries, part 28.
309. gbenv29.seq - Environmental sampling sequence entries, part 29.
310. gbenv3.seq - Environmental sampling sequence entries, part 3.
311. gbenv30.seq - Environmental sampling sequence entries, part 30.
312. gbenv4.seq - Environmental sampling sequence entries, part 4.
313. gbenv5.seq - Environmental sampling sequence entries, part 5.
314. gbenv6.seq - Environmental sampling sequence entries, part 6.
315. gbenv7.seq - Environmental sampling sequence entries, part 7.
316. gbenv8.seq - Environmental sampling sequence entries, part 8.
317. gbenv9.seq - Environmental sampling sequence entries, part 9.
318. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
319. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
320. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
321. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
322. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
323. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
324. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
325. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
326. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
327. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
328. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
329. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
330. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
331. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
332. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
333. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
334. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
335. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
336. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
337. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
338. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
339. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
340. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
341. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
342. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
343. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
344. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
345. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
346. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
347. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
348. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
349. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
350. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
351. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
352. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
353. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
354. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
355. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
356. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
357. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
358. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
359. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
360. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
361. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
362. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
363. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
364. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
365. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
366. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
367. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
368. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
369. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
370. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
371. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
372. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
373. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
374. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
375. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
376. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
377. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
378. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
379. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
380. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
381. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
382. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
383. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
384. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
385. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
386. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
387. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
388. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
389. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
390. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
391. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
392. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
393. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
394. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
395. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
396. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
397. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
398. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
399. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
400. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
401. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
402. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
403. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
404. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
405. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
406. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
407. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
408. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
409. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
410. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
411. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
412. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
413. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
414. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
415. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
416. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
417. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
418. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
419. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
420. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
421. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
422. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
423. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
424. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
425. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
426. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
427. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
428. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
429. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
430. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
431. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
432. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
433. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
434. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
435. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
436. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
437. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
438. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
439. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
440. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
441. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
442. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
443. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
444. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
445. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
446. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
447. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
448. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
449. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
450. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
451. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
452. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
453. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
454. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
455. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
456. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
457. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
458. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
459. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
460. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
461. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
462. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
463. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
464. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
465. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
466. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
467. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
468. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
469. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
470. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
471. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
472. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
473. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
474. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
475. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
476. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
477. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
478. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
479. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
480. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
481. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
482. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
483. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
484. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
485. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
486. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
487. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
488. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
489. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
490. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
491. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
492. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
493. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
494. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
495. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
496. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
497. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
498. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
499. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
500. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
501. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
502. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
503. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
504. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
505. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
506. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
507. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
508. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
509. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
510. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
511. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
512. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
513. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
514. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
515. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
516. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
517. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
518. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
519. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
520. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
521. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
522. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
523. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
524. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
525. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
526. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
527. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
528. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
529. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
530. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
531. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
532. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
533. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
534. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
535. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
536. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
537. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
538. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
539. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
540. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
541. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
542. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
543. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
544. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
545. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
546. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
547. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
548. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
549. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
550. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
551. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
552. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
553. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
554. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
555. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
556. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
557. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
558. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
559. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
560. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
561. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
562. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
563. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
564. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
565. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
566. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
567. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
568. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
569. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
570. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
571. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
572. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
573. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
574. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
575. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
576. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
577. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
578. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
579. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
580. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
581. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
582. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
583. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
584. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
585. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
586. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
587. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
588. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
589. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
590. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
591. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
592. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
593. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
594. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
595. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
596. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
597. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
598. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
599. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
600. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
601. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
602. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
603. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
604. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
605. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
606. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
607. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
608. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
609. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
610. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
611. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
612. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
613. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
614. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
615. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
616. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
617. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
618. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
619. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
620. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
621. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
622. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
623. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
624. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
625. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
626. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
627. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
628. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
629. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
630. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
631. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
632. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
633. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
634. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
635. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
636. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
637. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
638. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
639. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
640. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
641. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
642. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
643. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
644. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
645. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
646. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
647. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
648. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
649. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
650. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
651. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
652. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
653. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
654. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
655. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
656. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
657. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
658. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
659. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
660. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
661. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
662. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
663. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
664. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
665. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
666. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
667. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
668. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
669. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
670. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
671. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
672. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
673. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
674. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
675. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
676. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
677. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
678. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
679. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
680. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
681. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
682. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
683. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
684. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
685. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
686. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
687. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
688. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
689. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
690. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
691. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
692. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
693. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
694. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
695. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
696. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
697. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
698. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
699. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
700. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
701. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
702. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
703. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
704. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
705. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
706. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
707. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
708. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
709. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
710. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
711. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
712. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
713. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
714. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
715. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
716. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
717. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
718. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
719. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
720. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
721. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
722. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
723. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
724. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
725. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
726. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
727. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
728. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
729. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
730. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
731. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
732. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
733. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
734. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
735. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
736. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
737. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
738. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
739. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
740. gbgen.idx - Index of the entries according to gene symbols.
741. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
742. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
743. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
744. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
745. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
746. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
747. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
748. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
749. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
750. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
751. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
752. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
753. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
754. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
755. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
756. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
757. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
758. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
759. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
760. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
761. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
762. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
763. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
764. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
765. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
766. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
767. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
768. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
769. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
770. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
771. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
772. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
773. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
774. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
775. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
776. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
777. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
778. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
779. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
780. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
781. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
782. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
783. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
784. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
785. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
786. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
787. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
788. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
789. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
790. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
791. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
792. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
793. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
794. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
795. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
796. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
797. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
798. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
799. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
800. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
801. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
802. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
803. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
804. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
805. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
806. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
807. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
808. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
809. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
810. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
811. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
812. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
813. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
814. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
815. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
816. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
817. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
818. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
819. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
820. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
821. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
822. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
823. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
824. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
825. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
826. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
827. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
828. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
829. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
830. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
831. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
832. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
833. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
834. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
835. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
836. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
837. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
838. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
839. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
840. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
841. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
842. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
843. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
844. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
845. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
846. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
847. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
848. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
849. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
850. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
851. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
852. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
853. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
854. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
855. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
856. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
857. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
858. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
859. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
860. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
861. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
862. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
863. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
864. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
865. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
866. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
867. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
868. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
869. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
870. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
871. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
872. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
873. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
874. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
875. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
876. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
877. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
878. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
879. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
880. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
881. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
882. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
883. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
884. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
885. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
886. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
887. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
888. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
889. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
890. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
891. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
892. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
893. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
894. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
895. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
896. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
897. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
898. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
899. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
900. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
901. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
902. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
903. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
904. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
905. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
906. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
907. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
908. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
909. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
910. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
911. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
912. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
913. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
914. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
915. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
916. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
917. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
918. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
919. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
920. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
921. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
922. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
923. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
924. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
925. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
926. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
927. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
928. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
929. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
930. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
931. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
932. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
933. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
934. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
935. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
936. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
937. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
938. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
939. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
940. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
941. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
942. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
943. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
944. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
945. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
946. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
947. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
948. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
949. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
950. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
951. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
952. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
953. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
954. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
955. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
956. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
957. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
958. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
959. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
960. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
961. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
962. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
963. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
964. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
965. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
966. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
967. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
968. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
969. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
970. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
971. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
972. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
973. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
974. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
975. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
976. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
977. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
978. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
979. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
980. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
981. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
982. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
983. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
984. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
985. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
986. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
987. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
988. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
989. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
990. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
991. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
992. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
993. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
994. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
995. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
996. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
997. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
998. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
999. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1000. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1001. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1002. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1003. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1004. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1005. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1006. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1007. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1008. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1009. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1010. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1011. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1012. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1013. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1014. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1015. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1016. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1017. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1018. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1019. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1020. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1021. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1022. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1023. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1024. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1025. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1026. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1027. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1028. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1029. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1030. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1031. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1032. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1033. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1034. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1035. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1036. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1037. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1038. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1039. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1040. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1041. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1042. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1043. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1044. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1045. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1046. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1047. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1048. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1049. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1050. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1051. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1052. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1053. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1054. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1055. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1056. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1057. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1058. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1059. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1060. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1061. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1062. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1063. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1064. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1065. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1066. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1067. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1068. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1069. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1070. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1071. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1072. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1073. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1074. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1075. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1076. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1077. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1078. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1079. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1080. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1081. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1082. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1083. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1084. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1085. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1086. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1087. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1088. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1089. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1090. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1091. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1092. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1093. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1094. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1095. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1096. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1097. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1098. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1099. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1100. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1101. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1102. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1103. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1104. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1105. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1106. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1107. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1108. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1109. gbinv1.seq - Invertebrate sequence entries, part 1.
1110. gbinv10.seq - Invertebrate sequence entries, part 10.
1111. gbinv11.seq - Invertebrate sequence entries, part 11.
1112. gbinv12.seq - Invertebrate sequence entries, part 12.
1113. gbinv13.seq - Invertebrate sequence entries, part 13.
1114. gbinv14.seq - Invertebrate sequence entries, part 14.
1115. gbinv15.seq - Invertebrate sequence entries, part 15.
1116. gbinv16.seq - Invertebrate sequence entries, part 16.
1117. gbinv17.seq - Invertebrate sequence entries, part 17.
1118. gbinv18.seq - Invertebrate sequence entries, part 18.
1119. gbinv19.seq - Invertebrate sequence entries, part 19.
1120. gbinv2.seq - Invertebrate sequence entries, part 2.
1121. gbinv20.seq - Invertebrate sequence entries, part 20.
1122. gbinv21.seq - Invertebrate sequence entries, part 21.
1123. gbinv22.seq - Invertebrate sequence entries, part 22.
1124. gbinv23.seq - Invertebrate sequence entries, part 23.
1125. gbinv24.seq - Invertebrate sequence entries, part 24.
1126. gbinv25.seq - Invertebrate sequence entries, part 25.
1127. gbinv3.seq - Invertebrate sequence entries, part 3.
1128. gbinv4.seq - Invertebrate sequence entries, part 4.
1129. gbinv5.seq - Invertebrate sequence entries, part 5.
1130. gbinv6.seq - Invertebrate sequence entries, part 6.
1131. gbinv7.seq - Invertebrate sequence entries, part 7.
1132. gbinv8.seq - Invertebrate sequence entries, part 8.
1133. gbinv9.seq - Invertebrate sequence entries, part 9.
1134. gbjou1.idx - Index of the entries according to journal citation, part 1.
1135. gbjou10.idx - Index of the entries according to journal citation, part 10.
1136. gbjou2.idx - Index of the entries according to journal citation, part 2.
1137. gbjou3.idx - Index of the entries according to journal citation, part 3.
1138. gbjou4.idx - Index of the entries according to journal citation, part 4.
1139. gbjou5.idx - Index of the entries according to journal citation, part 5.
1140. gbjou6.idx - Index of the entries according to journal citation, part 6.
1141. gbjou7.idx - Index of the entries according to journal citation, part 7.
1142. gbjou8.idx - Index of the entries according to journal citation, part 8.
1143. gbjou9.idx - Index of the entries according to journal citation, part 9.
1144. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1145. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1146. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1147. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1148. gbmam1.seq - Other mammalian sequence entries, part 1.
1149. gbmam2.seq - Other mammalian sequence entries, part 2.
1150. gbmam3.seq - Other mammalian sequence entries, part 3.
1151. gbmam4.seq - Other mammalian sequence entries, part 4.
1152. gbmam5.seq - Other mammalian sequence entries, part 5.
1153. gbmam6.seq - Other mammalian sequence entries, part 6.
1154. gbnew.txt - Accession numbers of entries new since the previous release.
1155. gbpat1.seq - Patent sequence entries, part 1.
1156. gbpat10.seq - Patent sequence entries, part 10.
1157. gbpat100.seq - Patent sequence entries, part 100.
1158. gbpat101.seq - Patent sequence entries, part 101.
1159. gbpat102.seq - Patent sequence entries, part 102.
1160. gbpat103.seq - Patent sequence entries, part 103.
1161. gbpat104.seq - Patent sequence entries, part 104.
1162. gbpat105.seq - Patent sequence entries, part 105.
1163. gbpat106.seq - Patent sequence entries, part 106.
1164. gbpat107.seq - Patent sequence entries, part 107.
1165. gbpat108.seq - Patent sequence entries, part 108.
1166. gbpat109.seq - Patent sequence entries, part 109.
1167. gbpat11.seq - Patent sequence entries, part 11.
1168. gbpat110.seq - Patent sequence entries, part 110.
1169. gbpat111.seq - Patent sequence entries, part 111.
1170. gbpat112.seq - Patent sequence entries, part 112.
1171. gbpat113.seq - Patent sequence entries, part 113.
1172. gbpat114.seq - Patent sequence entries, part 114.
1173. gbpat115.seq - Patent sequence entries, part 115.
1174. gbpat116.seq - Patent sequence entries, part 116.
1175. gbpat117.seq - Patent sequence entries, part 117.
1176. gbpat118.seq - Patent sequence entries, part 118.
1177. gbpat119.seq - Patent sequence entries, part 119.
1178. gbpat12.seq - Patent sequence entries, part 12.
1179. gbpat120.seq - Patent sequence entries, part 120.
1180. gbpat121.seq - Patent sequence entries, part 121.
1181. gbpat122.seq - Patent sequence entries, part 122.
1182. gbpat123.seq - Patent sequence entries, part 123.
1183. gbpat124.seq - Patent sequence entries, part 124.
1184. gbpat125.seq - Patent sequence entries, part 125.
1185. gbpat126.seq - Patent sequence entries, part 126.
1186. gbpat127.seq - Patent sequence entries, part 127.
1187. gbpat128.seq - Patent sequence entries, part 128.
1188. gbpat13.seq - Patent sequence entries, part 13.
1189. gbpat14.seq - Patent sequence entries, part 14.
1190. gbpat15.seq - Patent sequence entries, part 15.
1191. gbpat16.seq - Patent sequence entries, part 16.
1192. gbpat17.seq - Patent sequence entries, part 17.
1193. gbpat18.seq - Patent sequence entries, part 18.
1194. gbpat19.seq - Patent sequence entries, part 19.
1195. gbpat2.seq - Patent sequence entries, part 2.
1196. gbpat20.seq - Patent sequence entries, part 20.
1197. gbpat21.seq - Patent sequence entries, part 21.
1198. gbpat22.seq - Patent sequence entries, part 22.
1199. gbpat23.seq - Patent sequence entries, part 23.
1200. gbpat24.seq - Patent sequence entries, part 24.
1201. gbpat25.seq - Patent sequence entries, part 25.
1202. gbpat26.seq - Patent sequence entries, part 26.
1203. gbpat27.seq - Patent sequence entries, part 27.
1204. gbpat28.seq - Patent sequence entries, part 28.
1205. gbpat29.seq - Patent sequence entries, part 29.
1206. gbpat3.seq - Patent sequence entries, part 3.
1207. gbpat30.seq - Patent sequence entries, part 30.
1208. gbpat31.seq - Patent sequence entries, part 31.
1209. gbpat32.seq - Patent sequence entries, part 32.
1210. gbpat33.seq - Patent sequence entries, part 33.
1211. gbpat34.seq - Patent sequence entries, part 34.
1212. gbpat35.seq - Patent sequence entries, part 35.
1213. gbpat36.seq - Patent sequence entries, part 36.
1214. gbpat37.seq - Patent sequence entries, part 37.
1215. gbpat38.seq - Patent sequence entries, part 38.
1216. gbpat39.seq - Patent sequence entries, part 39.
1217. gbpat4.seq - Patent sequence entries, part 4.
1218. gbpat40.seq - Patent sequence entries, part 40.
1219. gbpat41.seq - Patent sequence entries, part 41.
1220. gbpat42.seq - Patent sequence entries, part 42.
1221. gbpat43.seq - Patent sequence entries, part 43.
1222. gbpat44.seq - Patent sequence entries, part 44.
1223. gbpat45.seq - Patent sequence entries, part 45.
1224. gbpat46.seq - Patent sequence entries, part 46.
1225. gbpat47.seq - Patent sequence entries, part 47.
1226. gbpat48.seq - Patent sequence entries, part 48.
1227. gbpat49.seq - Patent sequence entries, part 49.
1228. gbpat5.seq - Patent sequence entries, part 5.
1229. gbpat50.seq - Patent sequence entries, part 50.
1230. gbpat51.seq - Patent sequence entries, part 51.
1231. gbpat52.seq - Patent sequence entries, part 52.
1232. gbpat53.seq - Patent sequence entries, part 53.
1233. gbpat54.seq - Patent sequence entries, part 54.
1234. gbpat55.seq - Patent sequence entries, part 55.
1235. gbpat56.seq - Patent sequence entries, part 56.
1236. gbpat57.seq - Patent sequence entries, part 57.
1237. gbpat58.seq - Patent sequence entries, part 58.
1238. gbpat59.seq - Patent sequence entries, part 59.
1239. gbpat6.seq - Patent sequence entries, part 6.
1240. gbpat60.seq - Patent sequence entries, part 60.
1241. gbpat61.seq - Patent sequence entries, part 61.
1242. gbpat62.seq - Patent sequence entries, part 62.
1243. gbpat63.seq - Patent sequence entries, part 63.
1244. gbpat64.seq - Patent sequence entries, part 64.
1245. gbpat65.seq - Patent sequence entries, part 65.
1246. gbpat66.seq - Patent sequence entries, part 66.
1247. gbpat67.seq - Patent sequence entries, part 67.
1248. gbpat68.seq - Patent sequence entries, part 68.
1249. gbpat69.seq - Patent sequence entries, part 69.
1250. gbpat7.seq - Patent sequence entries, part 7.
1251. gbpat70.seq - Patent sequence entries, part 70.
1252. gbpat71.seq - Patent sequence entries, part 71.
1253. gbpat72.seq - Patent sequence entries, part 72.
1254. gbpat73.seq - Patent sequence entries, part 73.
1255. gbpat74.seq - Patent sequence entries, part 74.
1256. gbpat75.seq - Patent sequence entries, part 75.
1257. gbpat76.seq - Patent sequence entries, part 76.
1258. gbpat77.seq - Patent sequence entries, part 77.
1259. gbpat78.seq - Patent sequence entries, part 78.
1260. gbpat79.seq - Patent sequence entries, part 79.
1261. gbpat8.seq - Patent sequence entries, part 8.
1262. gbpat80.seq - Patent sequence entries, part 80.
1263. gbpat81.seq - Patent sequence entries, part 81.
1264. gbpat82.seq - Patent sequence entries, part 82.
1265. gbpat83.seq - Patent sequence entries, part 83.
1266. gbpat84.seq - Patent sequence entries, part 84.
1267. gbpat85.seq - Patent sequence entries, part 85.
1268. gbpat86.seq - Patent sequence entries, part 86.
1269. gbpat87.seq - Patent sequence entries, part 87.
1270. gbpat88.seq - Patent sequence entries, part 88.
1271. gbpat89.seq - Patent sequence entries, part 89.
1272. gbpat9.seq - Patent sequence entries, part 9.
1273. gbpat90.seq - Patent sequence entries, part 90.
1274. gbpat91.seq - Patent sequence entries, part 91.
1275. gbpat92.seq - Patent sequence entries, part 92.
1276. gbpat93.seq - Patent sequence entries, part 93.
1277. gbpat94.seq - Patent sequence entries, part 94.
1278. gbpat95.seq - Patent sequence entries, part 95.
1279. gbpat96.seq - Patent sequence entries, part 96.
1280. gbpat97.seq - Patent sequence entries, part 97.
1281. gbpat98.seq - Patent sequence entries, part 98.
1282. gbpat99.seq - Patent sequence entries, part 99.
1283. gbphg1.seq - Phage sequence entries, part 1.
1284. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1285. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1286. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1287. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1288. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1289. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1290. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1291. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1292. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1293. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1294. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1295. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1296. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1297. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1298. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1299. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1300. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1301. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1302. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1303. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1304. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1305. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1306. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1307. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1308. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1309. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1310. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1311. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1312. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1313. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1314. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1315. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1316. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1317. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1318. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1319. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1320. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1321. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1322. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1323. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1324. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1325. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1326. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1327. gbpri1.seq - Primate sequence entries, part 1.
1328. gbpri10.seq - Primate sequence entries, part 10.
1329. gbpri11.seq - Primate sequence entries, part 11.
1330. gbpri12.seq - Primate sequence entries, part 12.
1331. gbpri13.seq - Primate sequence entries, part 13.
1332. gbpri14.seq - Primate sequence entries, part 14.
1333. gbpri15.seq - Primate sequence entries, part 15.
1334. gbpri16.seq - Primate sequence entries, part 16.
1335. gbpri17.seq - Primate sequence entries, part 17.
1336. gbpri18.seq - Primate sequence entries, part 18.
1337. gbpri19.seq - Primate sequence entries, part 19.
1338. gbpri2.seq - Primate sequence entries, part 2.
1339. gbpri20.seq - Primate sequence entries, part 20.
1340. gbpri21.seq - Primate sequence entries, part 21.
1341. gbpri22.seq - Primate sequence entries, part 22.
1342. gbpri23.seq - Primate sequence entries, part 23.
1343. gbpri24.seq - Primate sequence entries, part 24.
1344. gbpri25.seq - Primate sequence entries, part 25.
1345. gbpri26.seq - Primate sequence entries, part 26.
1346. gbpri27.seq - Primate sequence entries, part 27.
1347. gbpri28.seq - Primate sequence entries, part 28.
1348. gbpri29.seq - Primate sequence entries, part 29.
1349. gbpri3.seq - Primate sequence entries, part 3.
1350. gbpri30.seq - Primate sequence entries, part 30.
1351. gbpri31.seq - Primate sequence entries, part 31.
1352. gbpri32.seq - Primate sequence entries, part 32.
1353. gbpri33.seq - Primate sequence entries, part 33.
1354. gbpri34.seq - Primate sequence entries, part 34.
1355. gbpri35.seq - Primate sequence entries, part 35.
1356. gbpri36.seq - Primate sequence entries, part 36.
1357. gbpri37.seq - Primate sequence entries, part 37.
1358. gbpri38.seq - Primate sequence entries, part 38.
1359. gbpri39.seq - Primate sequence entries, part 39.
1360. gbpri4.seq - Primate sequence entries, part 4.
1361. gbpri40.seq - Primate sequence entries, part 40.
1362. gbpri41.seq - Primate sequence entries, part 41.
1363. gbpri42.seq - Primate sequence entries, part 42.
1364. gbpri5.seq - Primate sequence entries, part 5.
1365. gbpri6.seq - Primate sequence entries, part 6.
1366. gbpri7.seq - Primate sequence entries, part 7.
1367. gbpri8.seq - Primate sequence entries, part 8.
1368. gbpri9.seq - Primate sequence entries, part 9.
1369. gbrel.txt - Release notes (this document).
1370. gbrod1.seq - Rodent sequence entries, part 1.
1371. gbrod10.seq - Rodent sequence entries, part 10.
1372. gbrod11.seq - Rodent sequence entries, part 11.
1373. gbrod12.seq - Rodent sequence entries, part 12.
1374. gbrod13.seq - Rodent sequence entries, part 13.
1375. gbrod14.seq - Rodent sequence entries, part 14.
1376. gbrod15.seq - Rodent sequence entries, part 15.
1377. gbrod16.seq - Rodent sequence entries, part 16.
1378. gbrod17.seq - Rodent sequence entries, part 17.
1379. gbrod18.seq - Rodent sequence entries, part 18.
1380. gbrod19.seq - Rodent sequence entries, part 19.
1381. gbrod2.seq - Rodent sequence entries, part 2.
1382. gbrod20.seq - Rodent sequence entries, part 20.
1383. gbrod21.seq - Rodent sequence entries, part 21.
1384. gbrod22.seq - Rodent sequence entries, part 22.
1385. gbrod23.seq - Rodent sequence entries, part 23.
1386. gbrod24.seq - Rodent sequence entries, part 24.
1387. gbrod25.seq - Rodent sequence entries, part 25.
1388. gbrod26.seq - Rodent sequence entries, part 26.
1389. gbrod27.seq - Rodent sequence entries, part 27.
1390. gbrod28.seq - Rodent sequence entries, part 28.
1391. gbrod29.seq - Rodent sequence entries, part 29.
1392. gbrod3.seq - Rodent sequence entries, part 3.
1393. gbrod4.seq - Rodent sequence entries, part 4.
1394. gbrod5.seq - Rodent sequence entries, part 5.
1395. gbrod6.seq - Rodent sequence entries, part 6.
1396. gbrod7.seq - Rodent sequence entries, part 7.
1397. gbrod8.seq - Rodent sequence entries, part 8.
1398. gbrod9.seq - Rodent sequence entries, part 9.
1399. gbsdr1.txt - Short directory of the data bank, part 1.
1400. gbsdr2.txt - Short directory of the data bank, part 2.
1401. gbsdr3.txt - Short directory of the data bank, part 3.
1402. gbsec.idx - Index of the entries according to secondary accession number.
1403. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1404. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1405. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1406. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1407. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1408. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1409. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1410. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1411. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1412. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1413. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1414. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1415. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1416. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1417. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1418. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1419. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1420. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1421. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1422. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1423. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1424. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1425. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1426. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1427. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1428. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1429. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1430. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1431. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1432. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1433. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1434. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1435. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1436. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1437. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1438. gbuna1.seq - Unannotated sequence entries, part 1.
1439. gbvrl1.seq - Viral sequence entries, part 1.
1440. gbvrl10.seq - Viral sequence entries, part 10.
1441. gbvrl11.seq - Viral sequence entries, part 11.
1442. gbvrl12.seq - Viral sequence entries, part 12.
1443. gbvrl13.seq - Viral sequence entries, part 13.
1444. gbvrl14.seq - Viral sequence entries, part 14.
1445. gbvrl15.seq - Viral sequence entries, part 15.
1446. gbvrl2.seq - Viral sequence entries, part 2.
1447. gbvrl3.seq - Viral sequence entries, part 3.
1448. gbvrl4.seq - Viral sequence entries, part 4.
1449. gbvrl5.seq - Viral sequence entries, part 5.
1450. gbvrl6.seq - Viral sequence entries, part 6.
1451. gbvrl7.seq - Viral sequence entries, part 7.
1452. gbvrl8.seq - Viral sequence entries, part 8.
1453. gbvrl9.seq - Viral sequence entries, part 9.
1454. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1455. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1456. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1457. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1458. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1459. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1460. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1461. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1462. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1463. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1464. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1465. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1466. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1467. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1468. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1469. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1470. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1471. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1472. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1473. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1474. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1475. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 180.0 flatfiles require roughly 457 GB (sequence
files only) or 490 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1445813706 gbacc1.idx
2204990304 gbacc2.idx
695760390 gbacc3.idx
184884194 gbaut1.idx
204773458 gbaut10.idx
250500206 gbaut11.idx
184098686 gbaut12.idx
187217108 gbaut13.idx
222471347 gbaut14.idx
242042651 gbaut15.idx
186802154 gbaut16.idx
184834231 gbaut17.idx
184823688 gbaut18.idx
185538223 gbaut19.idx
187650015 gbaut2.idx
192176095 gbaut20.idx
204249113 gbaut21.idx
202846619 gbaut22.idx
184407752 gbaut23.idx
184335931 gbaut24.idx
190942759 gbaut25.idx
194170686 gbaut26.idx
183787489 gbaut27.idx
184764072 gbaut28.idx
184990979 gbaut29.idx
213083264 gbaut3.idx
210204071 gbaut30.idx
183944859 gbaut31.idx
202067587 gbaut32.idx
184562199 gbaut33.idx
183890291 gbaut34.idx
183820743 gbaut35.idx
192473519 gbaut36.idx
186389081 gbaut37.idx
186460507 gbaut38.idx
254750895 gbaut39.idx
185013194 gbaut4.idx
185262263 gbaut40.idx
183937157 gbaut41.idx
194448954 gbaut42.idx
189729987 gbaut43.idx
183934477 gbaut44.idx
184276200 gbaut45.idx
183844542 gbaut46.idx
193214252 gbaut47.idx
193520661 gbaut48.idx
185795610 gbaut49.idx
186971366 gbaut5.idx
185752569 gbaut50.idx
188003439 gbaut51.idx
193568053 gbaut52.idx
188378637 gbaut53.idx
186176704 gbaut54.idx
184400089 gbaut55.idx
185320517 gbaut56.idx
184956764 gbaut57.idx
184060761 gbaut58.idx
185775727 gbaut59.idx
183844379 gbaut6.idx
184573585 gbaut60.idx
183755657 gbaut61.idx
184824463 gbaut62.idx
201384618 gbaut63.idx
184721061 gbaut64.idx
248708109 gbaut65.idx
186670884 gbaut66.idx
183952971 gbaut67.idx
185631673 gbaut68.idx
184019161 gbaut69.idx
185804166 gbaut7.idx
183853278 gbaut70.idx
185304708 gbaut71.idx
183912268 gbaut72.idx
183889220 gbaut73.idx
220619695 gbaut74.idx
210016573 gbaut75.idx
184361239 gbaut76.idx
184191040 gbaut77.idx
188391611 gbaut78.idx
216030304 gbaut79.idx
184921399 gbaut8.idx
18774028 gbaut80.idx
183925195 gbaut9.idx
245234317 gbbct1.seq
248119773 gbbct10.seq
249995568 gbbct11.seq
20201978 gbbct12.seq
242909148 gbbct13.seq
249684788 gbbct14.seq
245030455 gbbct15.seq
248595591 gbbct16.seq
248185887 gbbct17.seq
245867209 gbbct18.seq
237826198 gbbct19.seq
246931217 gbbct2.seq
239571799 gbbct20.seq
217750123 gbbct21.seq
242691119 gbbct22.seq
241410369 gbbct23.seq
248565113 gbbct24.seq
247802381 gbbct25.seq
249349560 gbbct26.seq
244148900 gbbct27.seq
247096025 gbbct28.seq
249960746 gbbct29.seq
246562421 gbbct3.seq
249717807 gbbct30.seq
249787172 gbbct31.seq
242897380 gbbct32.seq
249121416 gbbct33.seq
142296647 gbbct34.seq
243836637 gbbct35.seq
246981694 gbbct36.seq
247858360 gbbct37.seq
248263253 gbbct38.seq
231741157 gbbct39.seq
249998658 gbbct4.seq
241941072 gbbct40.seq
246885319 gbbct41.seq
245621374 gbbct42.seq
247129003 gbbct43.seq
243247701 gbbct44.seq
249883406 gbbct45.seq
124732651 gbbct46.seq
6878890 gbbct47.seq
14080611 gbbct48.seq
23152852 gbbct49.seq
150804230 gbbct5.seq
45032705 gbbct50.seq
87673379 gbbct51.seq
169914162 gbbct52.seq
249998561 gbbct53.seq
245941533 gbbct54.seq
242211042 gbbct55.seq
244051628 gbbct56.seq
247497013 gbbct57.seq
249989968 gbbct58.seq
249999389 gbbct59.seq
249349909 gbbct6.seq
220596739 gbbct60.seq
249816322 gbbct7.seq
249981198 gbbct8.seq
247134793 gbbct9.seq
6826821 gbchg.txt
249998938 gbcon1.seq
249992870 gbcon10.seq
249995445 gbcon100.seq
249996667 gbcon101.seq
249998797 gbcon102.seq
249995641 gbcon103.seq
156127743 gbcon104.seq
249995214 gbcon105.seq
249997693 gbcon106.seq
249998761 gbcon107.seq
249997855 gbcon108.seq
71466271 gbcon109.seq
249993110 gbcon11.seq
249999780 gbcon110.seq
249998466 gbcon111.seq
233219812 gbcon112.seq
250000256 gbcon113.seq
250000098 gbcon114.seq
249995503 gbcon115.seq
249682205 gbcon116.seq
158682237 gbcon117.seq
249565434 gbcon118.seq
249998941 gbcon119.seq
249574468 gbcon12.seq
14891407 gbcon120.seq
249995963 gbcon121.seq
249999409 gbcon122.seq
250000251 gbcon123.seq
249581155 gbcon124.seq
11138979 gbcon125.seq
249589305 gbcon126.seq
248950449 gbcon127.seq
249307716 gbcon128.seq
249995915 gbcon129.seq
247306877 gbcon13.seq
249999233 gbcon130.seq
161537553 gbcon131.seq
250000158 gbcon132.seq
250000013 gbcon133.seq
249801968 gbcon134.seq
249993762 gbcon135.seq
249999846 gbcon136.seq
248313252 gbcon137.seq
249996371 gbcon138.seq
249997052 gbcon139.seq
249993059 gbcon14.seq
249998676 gbcon140.seq
64826016 gbcon141.seq
21445522 gbcon142.seq
5457488 gbcon15.seq
250000059 gbcon16.seq
249996360 gbcon17.seq
209071098 gbcon18.seq
249998658 gbcon19.seq
248188797 gbcon2.seq
249956705 gbcon20.seq
96963359 gbcon21.seq
249999785 gbcon22.seq
120025218 gbcon23.seq
249997576 gbcon24.seq
249939133 gbcon25.seq
249999101 gbcon26.seq
249999374 gbcon27.seq
201173220 gbcon28.seq
249998460 gbcon29.seq
249791108 gbcon3.seq
250000050 gbcon30.seq
249998405 gbcon31.seq
249998847 gbcon32.seq
249999310 gbcon33.seq
195698166 gbcon34.seq
249994638 gbcon35.seq
249994355 gbcon36.seq
249996557 gbcon37.seq
249995872 gbcon38.seq
249998504 gbcon39.seq
249979031 gbcon4.seq
249995403 gbcon40.seq
60977708 gbcon41.seq
249996893 gbcon42.seq
249997617 gbcon43.seq
249994634 gbcon44.seq
249997569 gbcon45.seq
249997343 gbcon46.seq
42909814 gbcon47.seq
249995915 gbcon48.seq
249999280 gbcon49.seq
249997226 gbcon5.seq
249995710 gbcon50.seq
249996631 gbcon51.seq
249995091 gbcon52.seq
36225425 gbcon53.seq
249997103 gbcon54.seq
249996724 gbcon55.seq
249997253 gbcon56.seq
249996527 gbcon57.seq
249999884 gbcon58.seq
152476914 gbcon59.seq
249991121 gbcon6.seq
249996992 gbcon60.seq
249997178 gbcon61.seq
249997201 gbcon62.seq
249996856 gbcon63.seq
183504539 gbcon64.seq
249995931 gbcon65.seq
249997041 gbcon66.seq
249998416 gbcon67.seq
249998317 gbcon68.seq
245375145 gbcon69.seq
249994857 gbcon7.seq
249999551 gbcon70.seq
249998271 gbcon71.seq
249998133 gbcon72.seq
249998704 gbcon73.seq
249997871 gbcon74.seq
96481205 gbcon75.seq
250000212 gbcon76.seq
249996110 gbcon77.seq
249999860 gbcon78.seq
249998416 gbcon79.seq
6935327 gbcon8.seq
250000165 gbcon80.seq
62502628 gbcon81.seq
249999807 gbcon82.seq
249998139 gbcon83.seq
249998956 gbcon84.seq
249995391 gbcon85.seq
249998511 gbcon86.seq
21523692 gbcon87.seq
249996875 gbcon88.seq
249995114 gbcon89.seq
249994769 gbcon9.seq
249996256 gbcon90.seq
249999714 gbcon91.seq
197747900 gbcon92.seq
249995224 gbcon93.seq
249999439 gbcon94.seq
249997468 gbcon95.seq
249999950 gbcon96.seq
249995004 gbcon97.seq
133061783 gbcon98.seq
249998329 gbcon99.seq
315382 gbdel.txt
249999388 gbenv1.seq
249999105 gbenv10.seq
52834122 gbenv11.seq
249998913 gbenv12.seq
249999119 gbenv13.seq
249999582 gbenv14.seq
249999755 gbenv15.seq
249999356 gbenv16.seq
249997898 gbenv17.seq
119104901 gbenv18.seq
250000078 gbenv19.seq
249999085 gbenv2.seq
250000057 gbenv20.seq
249998885 gbenv21.seq
249999296 gbenv22.seq
124181291 gbenv23.seq
249999419 gbenv24.seq
249999834 gbenv25.seq
250000010 gbenv26.seq
249999006 gbenv27.seq
249999732 gbenv28.seq
249998674 gbenv29.seq
250000043 gbenv3.seq
215378606 gbenv30.seq
249998582 gbenv4.seq
249998994 gbenv5.seq
126982567 gbenv6.seq
249998525 gbenv7.seq
249999524 gbenv8.seq
249997476 gbenv9.seq
524291627 gbest1.seq
524290503 gbest10.seq
524289988 gbest100.seq
524289224 gbest101.seq
524290574 gbest102.seq
524288798 gbest103.seq
209781571 gbest104.seq
524290627 gbest105.seq
524290525 gbest106.seq
482468930 gbest107.seq
386214110 gbest108.seq
385739104 gbest109.seq
524290785 gbest11.seq
380693095 gbest110.seq
381217036 gbest111.seq
381807921 gbest112.seq
379084959 gbest113.seq
389877100 gbest114.seq
385902396 gbest115.seq
382537712 gbest116.seq
381809106 gbest117.seq
411443340 gbest118.seq
524290434 gbest119.seq
524289471 gbest12.seq
524291453 gbest120.seq
524291281 gbest121.seq
524290812 gbest122.seq
524291237 gbest123.seq
361432255 gbest124.seq
524289297 gbest125.seq
524290919 gbest126.seq
524289707 gbest127.seq
524292131 gbest128.seq
524290686 gbest129.seq
1489972 gbest13.seq
524290282 gbest130.seq
524290954 gbest131.seq
524290347 gbest132.seq
524290865 gbest133.seq
524290843 gbest134.seq
524290971 gbest135.seq
524289886 gbest136.seq
124886408 gbest137.seq
524290791 gbest138.seq
524289286 gbest139.seq
524289581 gbest14.seq
524289570 gbest140.seq
524290939 gbest141.seq
524290534 gbest142.seq
524289790 gbest143.seq
524291800 gbest144.seq
524289132 gbest145.seq
524290344 gbest146.seq
524288856 gbest147.seq
524292794 gbest148.seq
524291449 gbest149.seq
524290016 gbest15.seq
524290074 gbest150.seq
325816280 gbest151.seq
524291481 gbest152.seq
524289160 gbest153.seq
524290626 gbest154.seq
524288745 gbest155.seq
524289083 gbest156.seq
524290293 gbest157.seq
524290677 gbest158.seq
524291047 gbest159.seq
524290406 gbest16.seq
464071321 gbest160.seq
524293655 gbest161.seq
524289371 gbest162.seq
524291013 gbest163.seq
127394577 gbest164.seq
524290793 gbest165.seq
524294558 gbest166.seq
524290549 gbest167.seq
524289954 gbest168.seq
524290130 gbest169.seq
524289390 gbest17.seq
524290985 gbest170.seq
524292970 gbest171.seq
524290491 gbest172.seq
524290842 gbest173.seq
524290096 gbest174.seq
524292214 gbest175.seq
524290880 gbest176.seq
478291819 gbest177.seq
524291367 gbest178.seq
524291134 gbest179.seq
524289750 gbest18.seq
524289197 gbest180.seq
524289023 gbest181.seq
524290882 gbest182.seq
524289987 gbest183.seq
524289345 gbest184.seq
524289727 gbest185.seq
524289590 gbest186.seq
524290529 gbest187.seq
524291093 gbest188.seq
524290859 gbest189.seq
524289283 gbest19.seq
314552681 gbest190.seq
524291153 gbest191.seq
524290860 gbest192.seq
524293723 gbest193.seq
524290342 gbest194.seq
524290585 gbest195.seq
524291608 gbest196.seq
524289225 gbest197.seq
524290575 gbest198.seq
524288849 gbest199.seq
524290470 gbest2.seq
524289723 gbest20.seq
524290556 gbest200.seq
524290911 gbest201.seq
524289924 gbest202.seq
485786778 gbest203.seq
524290022 gbest204.seq
524289475 gbest205.seq
524289701 gbest206.seq
524289201 gbest207.seq
524288808 gbest208.seq
524290207 gbest209.seq
524289524 gbest21.seq
524289306 gbest210.seq
524290342 gbest211.seq
524290193 gbest212.seq
524288957 gbest213.seq
283634016 gbest214.seq
524291620 gbest215.seq
524289112 gbest216.seq
524292481 gbest217.seq
524291792 gbest218.seq
524291752 gbest219.seq
461149573 gbest22.seq
524289116 gbest220.seq
524290143 gbest221.seq
524288733 gbest222.seq
524290731 gbest223.seq
524290516 gbest224.seq
524291746 gbest225.seq
524290491 gbest226.seq
524290551 gbest227.seq
229176423 gbest228.seq
524291010 gbest229.seq
508128451 gbest23.seq
524290104 gbest230.seq
524291066 gbest231.seq
524293034 gbest232.seq
524291241 gbest233.seq
524289847 gbest234.seq
524290768 gbest235.seq
524291145 gbest236.seq
524290522 gbest237.seq
524290840 gbest238.seq
524289612 gbest239.seq
524289061 gbest24.seq
524291020 gbest240.seq
524290856 gbest241.seq
426507882 gbest242.seq
524291517 gbest243.seq
524289110 gbest244.seq
524291869 gbest245.seq
524289658 gbest246.seq
524289679 gbest247.seq
524290871 gbest248.seq
524289465 gbest249.seq
169058861 gbest25.seq
524289114 gbest250.seq
524291373 gbest251.seq
524291460 gbest252.seq
524291972 gbest253.seq
94020380 gbest254.seq
524291501 gbest255.seq
524290779 gbest256.seq
524290190 gbest257.seq
524290181 gbest258.seq
524291447 gbest259.seq
524288910 gbest26.seq
524289992 gbest260.seq
524290499 gbest261.seq
524289332 gbest262.seq
524288780 gbest263.seq
524290532 gbest264.seq
149285185 gbest265.seq
524291212 gbest266.seq
524291357 gbest267.seq
524289027 gbest268.seq
524289647 gbest269.seq
524291206 gbest27.seq
524290160 gbest270.seq
524289622 gbest271.seq
524290752 gbest272.seq
524289048 gbest273.seq
524289395 gbest274.seq
524291235 gbest275.seq
524288984 gbest276.seq
96407626 gbest277.seq
524291499 gbest278.seq
524290784 gbest279.seq
524291238 gbest28.seq
524290451 gbest280.seq
524289217 gbest281.seq
524289441 gbest282.seq
524290982 gbest283.seq
524290571 gbest284.seq
524290211 gbest285.seq
524290014 gbest286.seq
524291341 gbest287.seq
524288774 gbest288.seq
50944792 gbest289.seq
524292806 gbest29.seq
524292229 gbest290.seq
524290568 gbest291.seq
524289066 gbest292.seq
524290621 gbest293.seq
524288777 gbest294.seq
524290358 gbest295.seq
524288733 gbest296.seq
524291143 gbest297.seq
479132208 gbest298.seq
479815038 gbest299.seq
512724177 gbest3.seq
524290866 gbest30.seq
481093270 gbest300.seq
174132855 gbest301.seq
524288796 gbest302.seq
524290527 gbest303.seq
524290586 gbest304.seq
524291001 gbest305.seq
524290209 gbest306.seq
524289504 gbest307.seq
524289407 gbest308.seq
524291368 gbest309.seq
524288817 gbest31.seq
524290802 gbest310.seq
524290720 gbest311.seq
524292016 gbest312.seq
524290800 gbest313.seq
352429471 gbest314.seq
524289434 gbest315.seq
524289994 gbest316.seq
524290476 gbest317.seq
524291755 gbest318.seq
524290657 gbest319.seq
524290408 gbest32.seq
524289269 gbest320.seq
524291999 gbest321.seq
524290976 gbest322.seq
524291295 gbest323.seq
523861100 gbest324.seq
524292330 gbest325.seq
524290900 gbest326.seq
524291766 gbest327.seq
123686313 gbest328.seq
524290286 gbest329.seq
524289952 gbest33.seq
524289996 gbest330.seq
524290396 gbest331.seq
524291767 gbest332.seq
524291243 gbest333.seq
524290708 gbest334.seq
524290274 gbest335.seq
524289590 gbest336.seq
524289801 gbest337.seq
524289662 gbest338.seq
524290459 gbest339.seq
490574819 gbest34.seq
524290924 gbest340.seq
524291216 gbest341.seq
61773865 gbest342.seq
524289701 gbest343.seq
524289179 gbest344.seq
524290359 gbest345.seq
524291073 gbest346.seq
524289964 gbest347.seq
524289415 gbest348.seq
524292672 gbest349.seq
490150714 gbest35.seq
524288762 gbest350.seq
524289674 gbest351.seq
524291282 gbest352.seq
524288888 gbest353.seq
524290178 gbest354.seq
524290896 gbest355.seq
336095676 gbest356.seq
524289216 gbest357.seq
524290695 gbest358.seq
524291221 gbest359.seq
492423379 gbest36.seq
524288983 gbest360.seq
524290030 gbest361.seq
524290624 gbest362.seq
524289388 gbest363.seq
524291334 gbest364.seq
524290716 gbest365.seq
524294364 gbest366.seq
392403117 gbest367.seq
524292488 gbest368.seq
524290999 gbest369.seq
491641530 gbest37.seq
524290720 gbest370.seq
524289046 gbest371.seq
524289253 gbest372.seq
524289345 gbest373.seq
524289244 gbest374.seq
524289957 gbest375.seq
524290807 gbest376.seq
524289349 gbest377.seq
524290334 gbest378.seq
190046125 gbest379.seq
484871815 gbest38.seq
524290227 gbest380.seq
524289235 gbest381.seq
524291433 gbest382.seq
524289626 gbest383.seq
524290738 gbest384.seq
524289580 gbest385.seq
524292546 gbest386.seq
524290066 gbest387.seq
524289215 gbest388.seq
524289203 gbest389.seq
497519208 gbest39.seq
524291845 gbest390.seq
524291689 gbest391.seq
378617042 gbest392.seq
524289715 gbest393.seq
524290087 gbest394.seq
524289089 gbest395.seq
524290530 gbest396.seq
524290243 gbest397.seq
524291737 gbest398.seq
524291665 gbest399.seq
524291765 gbest4.seq
5205751 gbest40.seq
524289360 gbest400.seq
524289120 gbest401.seq
524288806 gbest402.seq
524290898 gbest403.seq
524291779 gbest404.seq
396573932 gbest405.seq
524289750 gbest406.seq
524289678 gbest407.seq
524292578 gbest408.seq
524288837 gbest409.seq
524293134 gbest41.seq
524288861 gbest410.seq
524289692 gbest411.seq
524292273 gbest412.seq
524290588 gbest413.seq
524292636 gbest414.seq
524289295 gbest415.seq
524289300 gbest416.seq
524289407 gbest417.seq
524290577 gbest418.seq
381476639 gbest419.seq
524289064 gbest42.seq
524290061 gbest420.seq
524291918 gbest421.seq
244966885 gbest422.seq
524290526 gbest43.seq
524290296 gbest44.seq
524290314 gbest45.seq
524291882 gbest46.seq
524290047 gbest47.seq
524291166 gbest48.seq
524290122 gbest49.seq
524290822 gbest5.seq
524290806 gbest50.seq
524290968 gbest51.seq
524289779 gbest52.seq
524292209 gbest53.seq
118577116 gbest54.seq
524290781 gbest55.seq
524290246 gbest56.seq
524291205 gbest57.seq
524289313 gbest58.seq
524288906 gbest59.seq
524291294 gbest6.seq
524289344 gbest60.seq
524289341 gbest61.seq
524290329 gbest62.seq
524291173 gbest63.seq
524290885 gbest64.seq
524288962 gbest65.seq
524289606 gbest66.seq
307747537 gbest67.seq
524290700 gbest68.seq
524290450 gbest69.seq
524289082 gbest7.seq
524289187 gbest70.seq
524291630 gbest71.seq
524288838 gbest72.seq
524291544 gbest73.seq
524289099 gbest74.seq
524289792 gbest75.seq
524290013 gbest76.seq
524290466 gbest77.seq
524291294 gbest78.seq
524290666 gbest79.seq
524288950 gbest8.seq
56555005 gbest80.seq
524289306 gbest81.seq
524289467 gbest82.seq
524290775 gbest83.seq
524291121 gbest84.seq
524291258 gbest85.seq
524289311 gbest86.seq
524289294 gbest87.seq
524291302 gbest88.seq
524290250 gbest89.seq
524290755 gbest9.seq
524290571 gbest90.seq
524289870 gbest91.seq
295056133 gbest92.seq
524290279 gbest93.seq
524291351 gbest94.seq
524291020 gbest95.seq
524292130 gbest96.seq
524290508 gbest97.seq
524289975 gbest98.seq
524289834 gbest99.seq
136029171 gbgen.idx
524289989 gbgss1.seq
524292081 gbgss10.seq
232712117 gbgss100.seq
524290402 gbgss101.seq
524290252 gbgss102.seq
524289611 gbgss103.seq
524290440 gbgss104.seq
524288790 gbgss105.seq
524289822 gbgss106.seq
524289305 gbgss107.seq
524290852 gbgss108.seq
524290953 gbgss109.seq
524291788 gbgss11.seq
524289595 gbgss110.seq
443272225 gbgss111.seq
524290733 gbgss112.seq
524292088 gbgss113.seq
524291350 gbgss114.seq
524290870 gbgss115.seq
524290501 gbgss116.seq
524291310 gbgss117.seq
524289715 gbgss118.seq
524289149 gbgss119.seq
524290847 gbgss12.seq
524291917 gbgss120.seq
524289683 gbgss121.seq
524289253 gbgss122.seq
6673436 gbgss123.seq
249997408 gbgss124.seq
249998817 gbgss125.seq
249997906 gbgss126.seq
249997703 gbgss127.seq
28059611 gbgss128.seq
249997137 gbgss129.seq
524290765 gbgss13.seq
250000033 gbgss130.seq
249998542 gbgss131.seq
249998333 gbgss132.seq
224919493 gbgss133.seq
249998415 gbgss134.seq
249998761 gbgss135.seq
249998880 gbgss136.seq
249999114 gbgss137.seq
172035984 gbgss138.seq
249997088 gbgss139.seq
524289910 gbgss14.seq
249998903 gbgss140.seq
249999973 gbgss141.seq
249997822 gbgss142.seq
249997800 gbgss143.seq
76110243 gbgss144.seq
250000188 gbgss145.seq
2879209 gbgss146.seq
79542258 gbgss147.seq
249999490 gbgss148.seq
249999950 gbgss149.seq
524291672 gbgss15.seq
78247334 gbgss150.seq
249998378 gbgss151.seq
249999331 gbgss152.seq
249997693 gbgss153.seq
116326140 gbgss154.seq
249999232 gbgss155.seq
249999334 gbgss156.seq
249999609 gbgss157.seq
246354232 gbgss158.seq
249999268 gbgss159.seq
524288946 gbgss16.seq
249997406 gbgss160.seq
249999513 gbgss161.seq
243477113 gbgss162.seq
249999336 gbgss163.seq
249997687 gbgss164.seq
249997948 gbgss165.seq
249997418 gbgss166.seq
116439238 gbgss167.seq
249998013 gbgss168.seq
250000031 gbgss169.seq
524291284 gbgss17.seq
249999974 gbgss170.seq
249998152 gbgss171.seq
94058788 gbgss172.seq
249998892 gbgss173.seq
249999850 gbgss174.seq
249998239 gbgss175.seq
249999582 gbgss176.seq
163635826 gbgss177.seq
249999236 gbgss178.seq
249997993 gbgss179.seq
524290790 gbgss18.seq
249998006 gbgss180.seq
249999353 gbgss181.seq
95926739 gbgss182.seq
249999461 gbgss183.seq
249999350 gbgss184.seq
249998406 gbgss185.seq
249998619 gbgss186.seq
249998550 gbgss187.seq
249999411 gbgss188.seq
18590121 gbgss189.seq
155129762 gbgss19.seq
249999424 gbgss190.seq
249999963 gbgss191.seq
249997369 gbgss192.seq
43648880 gbgss193.seq
52862187 gbgss194.seq
249999919 gbgss195.seq
249998112 gbgss196.seq
249997774 gbgss197.seq
249999401 gbgss198.seq
249999038 gbgss199.seq
524289742 gbgss2.seq
524290226 gbgss20.seq
249999019 gbgss200.seq
20598532 gbgss201.seq
249999684 gbgss202.seq
249999565 gbgss203.seq
249998830 gbgss204.seq
249997904 gbgss205.seq
249998150 gbgss206.seq
249998117 gbgss207.seq
31871896 gbgss208.seq
249999812 gbgss209.seq
524291157 gbgss21.seq
249999035 gbgss210.seq
47503560 gbgss211.seq
249999561 gbgss212.seq
249998751 gbgss213.seq
249999599 gbgss214.seq
249999028 gbgss215.seq
249999713 gbgss216.seq
16550600 gbgss217.seq
524290189 gbgss22.seq
524290658 gbgss23.seq
524289588 gbgss24.seq
524288730 gbgss25.seq
524290251 gbgss26.seq
524289395 gbgss27.seq
524291766 gbgss28.seq
524289334 gbgss29.seq
524290106 gbgss3.seq
427751101 gbgss30.seq
524290372 gbgss31.seq
524289473 gbgss32.seq
524290353 gbgss33.seq
524290058 gbgss34.seq
524290137 gbgss35.seq
524290624 gbgss36.seq
524290508 gbgss37.seq
469007750 gbgss38.seq
524288725 gbgss39.seq
524289593 gbgss4.seq
524289230 gbgss40.seq
453251393 gbgss41.seq
524289796 gbgss42.seq
524289080 gbgss43.seq
524291071 gbgss44.seq
524289281 gbgss45.seq
156480824 gbgss46.seq
524290791 gbgss47.seq
524289036 gbgss48.seq
524291372 gbgss49.seq
114446950 gbgss5.seq
524288728 gbgss50.seq
524291549 gbgss51.seq
524290735 gbgss52.seq
524291229 gbgss53.seq
524290199 gbgss54.seq
524289099 gbgss55.seq
524289411 gbgss56.seq
403025462 gbgss57.seq
524289012 gbgss58.seq
524292027 gbgss59.seq
524289206 gbgss6.seq
524289083 gbgss60.seq
415166904 gbgss61.seq
524290796 gbgss62.seq
524288807 gbgss63.seq
524291150 gbgss64.seq
524290174 gbgss65.seq
524288840 gbgss66.seq
524290963 gbgss67.seq
524291629 gbgss68.seq
524291361 gbgss69.seq
524288432 gbgss7.seq
524291331 gbgss70.seq
524290474 gbgss71.seq
524289158 gbgss72.seq
411049101 gbgss73.seq
524289067 gbgss74.seq
524289786 gbgss75.seq
524290389 gbgss76.seq
524289438 gbgss77.seq
524289284 gbgss78.seq
524291930 gbgss79.seq
524291739 gbgss8.seq
524291383 gbgss80.seq
524290093 gbgss81.seq
524288891 gbgss82.seq
524290751 gbgss83.seq
524291514 gbgss84.seq
229679924 gbgss85.seq
524292132 gbgss86.seq
524289296 gbgss87.seq
524290639 gbgss88.seq
524290493 gbgss89.seq
524292063 gbgss9.seq
524291310 gbgss90.seq
524291780 gbgss91.seq
524291338 gbgss92.seq
524288829 gbgss93.seq
524291050 gbgss94.seq
524289791 gbgss95.seq
524291194 gbgss96.seq
524291029 gbgss97.seq
524291498 gbgss98.seq
524289295 gbgss99.seq
249988458 gbhtc1.seq
249998254 gbhtc10.seq
249998954 gbhtc11.seq
79142152 gbhtc12.seq
249998738 gbhtc13.seq
249999241 gbhtc14.seq
49208101 gbhtc15.seq
249990019 gbhtc2.seq
249994097 gbhtc3.seq
249989139 gbhtc4.seq
249997691 gbhtc5.seq
249996247 gbhtc6.seq
249996862 gbhtc7.seq
83854894 gbhtc8.seq
249997812 gbhtc9.seq
249904694 gbhtg1.seq
249863312 gbhtg10.seq
249752175 gbhtg100.seq
249945600 gbhtg101.seq
249902534 gbhtg102.seq
249961521 gbhtg103.seq
5952683 gbhtg104.seq
249499004 gbhtg105.seq
249885159 gbhtg106.seq
249900528 gbhtg107.seq
249944132 gbhtg108.seq
249888028 gbhtg109.seq
1107147 gbhtg11.seq
249873588 gbhtg110.seq
249886255 gbhtg111.seq
249914676 gbhtg112.seq
249918424 gbhtg113.seq
2779249 gbhtg114.seq
249925067 gbhtg115.seq
249963986 gbhtg116.seq
249957715 gbhtg117.seq
249794576 gbhtg118.seq
249993947 gbhtg119.seq
249658267 gbhtg12.seq
111404939 gbhtg120.seq
249903443 gbhtg121.seq
249792853 gbhtg122.seq
249854861 gbhtg123.seq
249983162 gbhtg124.seq
249832745 gbhtg125.seq
163080900 gbhtg126.seq
249921852 gbhtg127.seq
249813962 gbhtg128.seq
249948862 gbhtg129.seq
249701321 gbhtg13.seq
249961944 gbhtg130.seq
249862297 gbhtg131.seq
249918088 gbhtg132.seq
249983762 gbhtg133.seq
249995690 gbhtg134.seq
249961284 gbhtg135.seq
31852232 gbhtg136.seq
249952420 gbhtg14.seq
249947884 gbhtg15.seq
249835884 gbhtg16.seq
249628655 gbhtg17.seq
249706830 gbhtg18.seq
249666330 gbhtg19.seq
249994606 gbhtg2.seq
249821773 gbhtg20.seq
243536188 gbhtg21.seq
249760645 gbhtg22.seq
249868408 gbhtg23.seq
249853408 gbhtg24.seq
249813402 gbhtg25.seq
249774414 gbhtg26.seq
249988400 gbhtg27.seq
249872927 gbhtg28.seq
249864461 gbhtg29.seq
249950111 gbhtg3.seq
249832113 gbhtg30.seq
225825682 gbhtg31.seq
249827828 gbhtg32.seq
249684646 gbhtg33.seq
249884842 gbhtg34.seq
249770561 gbhtg35.seq
249676282 gbhtg36.seq
249939303 gbhtg37.seq
249954576 gbhtg38.seq
249629775 gbhtg39.seq
249984089 gbhtg4.seq
249981649 gbhtg40.seq
227934091 gbhtg41.seq
249998307 gbhtg42.seq
249936527 gbhtg43.seq
249894895 gbhtg44.seq
249909173 gbhtg45.seq
250000253 gbhtg46.seq
249478239 gbhtg47.seq
249731464 gbhtg48.seq
249735638 gbhtg49.seq
249882044 gbhtg5.seq
249959056 gbhtg50.seq
237748480 gbhtg51.seq
249784719 gbhtg52.seq
249852227 gbhtg53.seq
249905626 gbhtg54.seq
249884822 gbhtg55.seq
249732182 gbhtg56.seq
20448412 gbhtg57.seq
249846548 gbhtg58.seq
249989277 gbhtg59.seq
249898388 gbhtg6.seq
249904211 gbhtg60.seq
249893214 gbhtg61.seq
228240177 gbhtg62.seq
249902619 gbhtg63.seq
249986507 gbhtg64.seq
249918160 gbhtg65.seq
249883738 gbhtg66.seq
249966605 gbhtg67.seq
16805116 gbhtg68.seq
249960711 gbhtg69.seq
249933701 gbhtg7.seq
249973591 gbhtg70.seq
249953795 gbhtg71.seq
249936465 gbhtg72.seq
227481147 gbhtg73.seq
249814017 gbhtg74.seq
249953139 gbhtg75.seq
249976438 gbhtg76.seq
249874461 gbhtg77.seq
245743847 gbhtg78.seq
249883367 gbhtg79.seq
249933567 gbhtg8.seq
249988504 gbhtg80.seq
249984680 gbhtg81.seq
249923491 gbhtg82.seq
216520592 gbhtg83.seq
249912276 gbhtg84.seq
249753897 gbhtg85.seq
249968147 gbhtg86.seq
249990127 gbhtg87.seq
223452756 gbhtg88.seq
249843028 gbhtg89.seq
249923718 gbhtg9.seq
249841332 gbhtg90.seq
249816787 gbhtg91.seq
249847761 gbhtg92.seq
214033471 gbhtg93.seq
249820734 gbhtg94.seq
249980764 gbhtg95.seq
249790140 gbhtg96.seq
249800382 gbhtg97.seq
170963808 gbhtg98.seq
249797510 gbhtg99.seq
249993761 gbinv1.seq
250000023 gbinv10.seq
249997636 gbinv11.seq
160246748 gbinv12.seq
249996874 gbinv13.seq
249999535 gbinv14.seq
250000243 gbinv15.seq
128056260 gbinv16.seq
247210154 gbinv17.seq
249051369 gbinv18.seq
249999414 gbinv19.seq
249992095 gbinv2.seq
249997929 gbinv20.seq
249998353 gbinv21.seq
249997607 gbinv22.seq
249999139 gbinv23.seq
249980793 gbinv24.seq
14420395 gbinv25.seq
248042182 gbinv3.seq
249998867 gbinv4.seq
250000184 gbinv5.seq
249867934 gbinv6.seq
250000203 gbinv7.seq
12071741 gbinv8.seq
249996902 gbinv9.seq
140197244 gbjou1.idx
44656577 gbjou10.idx
145833298 gbjou2.idx
142011534 gbjou3.idx
260428856 gbjou4.idx
292574804 gbjou5.idx
268706560 gbjou6.idx
300468841 gbjou7.idx
287307673 gbjou8.idx
268614966 gbjou9.idx
265445136 gbkey1.idx
178809226 gbkey2.idx
321443926 gbkey3.idx
96468580 gbkey4.idx
249747140 gbmam1.seq
249999675 gbmam2.seq
249909598 gbmam3.seq
249991465 gbmam4.seq
249832203 gbmam5.seq
154858299 gbmam6.seq
46028279 gbnew.txt
250000010 gbpat1.seq
249997839 gbpat10.seq
249999441 gbpat100.seq
249999845 gbpat101.seq
249999888 gbpat102.seq
249999095 gbpat103.seq
250000223 gbpat104.seq
249999486 gbpat105.seq
169767065 gbpat106.seq
250000124 gbpat107.seq
249999983 gbpat108.seq
249999814 gbpat109.seq
178698078 gbpat11.seq
86031991 gbpat110.seq
249999922 gbpat111.seq
249999366 gbpat112.seq
249999990 gbpat113.seq
63514362 gbpat114.seq
249997314 gbpat115.seq
249995934 gbpat116.seq
250000135 gbpat117.seq
249996737 gbpat118.seq
249999047 gbpat119.seq
249997814 gbpat12.seq
249998556 gbpat120.seq
216404619 gbpat121.seq
250000249 gbpat122.seq
249999893 gbpat123.seq
249999893 gbpat124.seq
250000185 gbpat125.seq
249999753 gbpat126.seq
250000011 gbpat127.seq
14853843 gbpat128.seq
249999097 gbpat13.seq
249998211 gbpat14.seq
249998262 gbpat15.seq
249999588 gbpat16.seq
65707342 gbpat17.seq
249999229 gbpat18.seq
249999331 gbpat19.seq
249996676 gbpat2.seq
249999952 gbpat20.seq
249997141 gbpat21.seq
185161771 gbpat22.seq
249999809 gbpat23.seq
249928982 gbpat24.seq
249999339 gbpat25.seq
249999860 gbpat26.seq
70931223 gbpat27.seq
249998489 gbpat28.seq
249998897 gbpat29.seq
250000152 gbpat3.seq
249999326 gbpat30.seq
249998991 gbpat31.seq
249999739 gbpat32.seq
180118699 gbpat33.seq
249998765 gbpat34.seq
250000100 gbpat35.seq
249998158 gbpat36.seq
249999783 gbpat37.seq
130519975 gbpat38.seq
250000004 gbpat39.seq
250000173 gbpat4.seq
249972532 gbpat40.seq
249998826 gbpat41.seq
249998487 gbpat42.seq
249997701 gbpat43.seq
249805470 gbpat44.seq
249999190 gbpat45.seq
249999545 gbpat46.seq
171256347 gbpat47.seq
249998653 gbpat48.seq
249998527 gbpat49.seq
71763868 gbpat5.seq
249999531 gbpat50.seq
250000197 gbpat51.seq
222934467 gbpat52.seq
249999057 gbpat53.seq
249999815 gbpat54.seq
249999501 gbpat55.seq
164403390 gbpat56.seq
249999689 gbpat57.seq
249998637 gbpat58.seq
249999463 gbpat59.seq
249999527 gbpat6.seq
249999863 gbpat60.seq
134380705 gbpat61.seq
249996182 gbpat62.seq
249999978 gbpat63.seq
249999690 gbpat64.seq
249998210 gbpat65.seq
249999753 gbpat66.seq
249999374 gbpat67.seq
144886744 gbpat68.seq
250000113 gbpat69.seq
249999834 gbpat7.seq
249999899 gbpat70.seq
249998837 gbpat71.seq
244394826 gbpat72.seq
248968678 gbpat73.seq
244459261 gbpat74.seq
247875799 gbpat75.seq
249999757 gbpat76.seq
160624439 gbpat77.seq
250000121 gbpat78.seq
249999657 gbpat79.seq
249997938 gbpat8.seq
249999470 gbpat80.seq
249999644 gbpat81.seq
249996127 gbpat82.seq
221488049 gbpat83.seq
249999879 gbpat84.seq
249999564 gbpat85.seq
249929730 gbpat86.seq
249824878 gbpat87.seq
249998855 gbpat88.seq
192932772 gbpat89.seq
249999535 gbpat9.seq
250000012 gbpat90.seq
249999638 gbpat91.seq
250000098 gbpat92.seq
80103982 gbpat93.seq
249999825 gbpat94.seq
249999943 gbpat95.seq
249946575 gbpat96.seq
249999877 gbpat97.seq
249849702 gbpat98.seq
66835451 gbpat99.seq
110754297 gbphg1.seq
249996905 gbpln1.seq
249997369 gbpln10.seq
249868657 gbpln11.seq
249989619 gbpln12.seq
86220916 gbpln13.seq
249992985 gbpln14.seq
249936362 gbpln15.seq
249970582 gbpln16.seq
248077474 gbpln17.seq
249958127 gbpln18.seq
248470008 gbpln19.seq
249940151 gbpln2.seq
250000218 gbpln20.seq
26130132 gbpln21.seq
249999411 gbpln22.seq
94566860 gbpln23.seq
249998765 gbpln24.seq
249998293 gbpln25.seq
249775695 gbpln26.seq
249996551 gbpln27.seq
249998001 gbpln28.seq
249997232 gbpln29.seq
249862881 gbpln3.seq
249999721 gbpln30.seq
134309497 gbpln31.seq
249998016 gbpln32.seq
249999637 gbpln33.seq
249998761 gbpln34.seq
249998324 gbpln35.seq
104437258 gbpln36.seq
249998941 gbpln37.seq
249997712 gbpln38.seq
249998721 gbpln39.seq
249896287 gbpln4.seq
249999761 gbpln40.seq
249999169 gbpln41.seq
249998533 gbpln42.seq
95684252 gbpln43.seq
249979283 gbpln5.seq
249997452 gbpln6.seq
249996585 gbpln7.seq
27796706 gbpln8.seq
249998505 gbpln9.seq
148947183 gbpri1.seq
249872272 gbpri10.seq
124885190 gbpri11.seq
249966847 gbpri12.seq
249900330 gbpri13.seq
249899933 gbpri14.seq
249949219 gbpri15.seq
249911015 gbpri16.seq
249858970 gbpri17.seq
249821596 gbpri18.seq
249975833 gbpri19.seq
249951612 gbpri2.seq
249823069 gbpri20.seq
249897250 gbpri21.seq
136799378 gbpri22.seq
180127201 gbpri23.seq
249995462 gbpri24.seq
204691475 gbpri25.seq
249899019 gbpri26.seq
249845794 gbpri27.seq
249838572 gbpri28.seq
249827438 gbpri29.seq
249882950 gbpri3.seq
249875768 gbpri30.seq
249875155 gbpri31.seq
249962808 gbpri32.seq
249997922 gbpri33.seq
85071225 gbpri34.seq
249995363 gbpri35.seq
249998838 gbpri36.seq
249994107 gbpri37.seq
249998086 gbpri38.seq
249990743 gbpri39.seq
249988745 gbpri4.seq
146631824 gbpri40.seq
249999672 gbpri41.seq
74133527 gbpri42.seq
249914939 gbpri5.seq
249915740 gbpri6.seq
249893851 gbpri7.seq
249902601 gbpri8.seq
249974110 gbpri9.seq
282812 gbrel.txt
249980590 gbrod1.seq
249921262 gbrod10.seq
54232813 gbrod11.seq
249879313 gbrod12.seq
249787795 gbrod13.seq
249998696 gbrod14.seq
249654174 gbrod15.seq
249956811 gbrod16.seq
249890169 gbrod17.seq
249753341 gbrod18.seq
146949263 gbrod19.seq
249764620 gbrod2.seq
249834785 gbrod20.seq
249887334 gbrod21.seq
226629375 gbrod22.seq
249999747 gbrod23.seq
249991222 gbrod24.seq
249983314 gbrod25.seq
249865309 gbrod26.seq
249999564 gbrod27.seq
249999487 gbrod28.seq
99038741 gbrod29.seq
249931483 gbrod3.seq
249801432 gbrod4.seq
249816403 gbrod5.seq
249780898 gbrod6.seq
249802843 gbrod7.seq
249984012 gbrod8.seq
249792319 gbrod9.seq
2920060510 gbsdr1.txt
5355496749 gbsdr2.txt
2280718343 gbsdr3.txt
142025076 gbsec.idx
249999233 gbsts1.seq
249997362 gbsts10.seq
212226966 gbsts11.seq
249996524 gbsts12.seq
249999913 gbsts13.seq
249999565 gbsts14.seq
249998628 gbsts15.seq
27217038 gbsts16.seq
249999776 gbsts17.seq
249996039 gbsts18.seq
250000037 gbsts19.seq
249996363 gbsts2.seq
146410465 gbsts20.seq
249999929 gbsts3.seq
249998244 gbsts4.seq
36209595 gbsts5.seq
249997222 gbsts6.seq
249997899 gbsts7.seq
249998458 gbsts8.seq
249997742 gbsts9.seq
249999920 gbsyn1.seq
249995336 gbsyn2.seq
4014218 gbsyn3.seq
249999371 gbtsa1.seq
249999937 gbtsa10.seq
249999308 gbtsa11.seq
131698529 gbtsa12.seq
249999929 gbtsa2.seq
249998344 gbtsa3.seq
249998436 gbtsa4.seq
56706584 gbtsa5.seq
249998438 gbtsa6.seq
249999024 gbtsa7.seq
249998597 gbtsa8.seq
249997586 gbtsa9.seq
447611 gbuna1.seq
249761171 gbvrl1.seq
204545160 gbvrl10.seq
249990797 gbvrl11.seq
249990718 gbvrl12.seq
249994465 gbvrl13.seq
249996155 gbvrl14.seq
225701328 gbvrl15.seq
249997993 gbvrl2.seq
249820972 gbvrl3.seq
249999274 gbvrl4.seq
146494773 gbvrl5.seq
249997203 gbvrl6.seq
249997192 gbvrl7.seq
249998826 gbvrl8.seq
249996125 gbvrl9.seq
249869248 gbvrt1.seq
249884374 gbvrt10.seq
249968136 gbvrt11.seq
184518097 gbvrt12.seq
249997202 gbvrt13.seq
249809573 gbvrt14.seq
249898528 gbvrt15.seq
249999370 gbvrt16.seq
249999427 gbvrt17.seq
249995877 gbvrt18.seq
249998351 gbvrt19.seq
249998468 gbvrt2.seq
249997545 gbvrt20.seq
250000257 gbvrt21.seq
36302377 gbvrt22.seq
249784319 gbvrt3.seq
250000123 gbvrt4.seq
58599685 gbvrt5.seq
249996615 gbvrt6.seq
249999233 gbvrt7.seq
249790609 gbvrt8.seq
249774789 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 52450 90653157
BCT10 63 117808727
BCT11 10867 111821847
BCT12 5335 6693859
BCT13 53942 85334347
BCT14 93 110189094
BCT15 151 93915681
BCT16 61 112455059
BCT17 52 112042350
BCT18 46 112693953
BCT19 56 110572060
BCT2 79 110161703
BCT20 66 108817610
BCT21 36 96325907
BCT22 40 106881287
BCT23 58 105533856
BCT24 74 111675186
BCT25 55 110045255
BCT26 63 106845562
BCT27 55 109391288
BCT28 52 108559385
BCT29 46 110496749
BCT3 53 111366361
BCT30 95 109522868
BCT31 59 110930031
BCT32 67 108616570
BCT33 124 109249408
BCT34 34 61811577
BCT35 202 109105476
BCT36 48 109782718
BCT37 43 108253230
BCT38 50 107374448
BCT39 57 101734644
BCT4 4596 108796858
BCT40 47 105859699
BCT41 71 106999678
BCT42 42 106164962
BCT43 57 107308208
BCT44 89 106033309
BCT45 224 100751052
BCT46 381 46867102
BCT47 1589 2511823
BCT48 3176 5212972
BCT49 6347 7901828
BCT5 33857 55268445
BCT50 12648 15076611
BCT51 25628 27746754
BCT52 50514 53996730
BCT53 76557 77450832
BCT54 70922 76044610
BCT55 7669 98699909
BCT56 5892 111603349
BCT57 128 115544567
BCT58 27338 108990483
BCT59 89865 69829878
BCT6 39035 86636534
BCT60 41012 82060683
BCT7 6441 98419342
BCT8 14416 92769466
BCT9 5262 104258066
ENV1 94570 71844702
ENV10 83227 87129841
ENV11 19073 16706871
ENV12 85012 80968039
ENV13 120854 43338508
ENV14 92100 76841173
ENV15 96574 68514483
ENV16 106736 53811072
ENV17 68325 85649415
ENV18 30739 41463380
ENV19 69645 85530498
ENV2 90197 69290545
ENV20 96295 72019848
ENV21 127892 31103960
ENV22 122783 29390540
ENV23 60884 13574965
ENV24 123333 50267068
ENV25 106957 64544633
ENV26 138458 53477267
ENV27 89591 75130542
ENV28 71071 96508561
ENV29 109930 54442634
ENV3 84310 80652791
ENV30 69077 69720328
ENV4 86688 80806548
ENV5 91031 83245694
ENV6 57209 26620903
ENV7 131791 31268854
ENV8 86982 71071423
ENV9 94057 73376617
EST1 162618 63052492
EST10 171812 70538965
EST100 232613 144866631
EST101 222620 113025837
EST102 209208 103272725
EST103 161286 102955965
EST104 62689 53129624
EST105 168732 112757910
EST106 171265 112982585
EST107 113242 64514967
EST108 64234 23580975
EST109 64383 22860297
EST11 168685 73605007
EST110 64712 23768621
EST111 64631 27206234
EST112 64788 22266188
EST113 66047 26115057
EST114 64086 27886175
EST115 64671 26640246
EST116 64868 26842047
EST117 64658 25425409
EST118 61274 39720195
EST119 178173 85731609
EST12 196163 87559579
EST120 176378 84426195
EST121 155725 95546197
EST122 150429 94921525
EST123 158380 98572962
EST124 99324 56330813
EST125 207430 101504225
EST126 155191 80525375
EST127 162663 86296457
EST128 157520 90412579
EST129 157586 83165491
EST13 521 232090
EST130 177795 108103387
EST131 217307 116938288
EST132 169983 99879079
EST133 170418 80055720
EST134 152929 85801818
EST135 151948 90543308
EST136 163868 95438800
EST137 35236 19291677
EST138 194543 110999667
EST139 236069 104095130
EST14 223739 113093929
EST140 155836 92166999
EST141 172857 95024742
EST142 150072 86780014
EST143 136755 88856069
EST144 157819 93205939
EST145 150070 77252759
EST146 125314 65533547
EST147 124876 63627935
EST148 130504 55967596
EST149 129898 51467387
EST15 170017 108538741
EST150 131535 51803803
EST151 83846 31650193
EST152 175716 87979267
EST153 184610 84867097
EST154 160089 112142593
EST155 220920 132179988
EST156 220455 124704945
EST157 169991 91036848
EST158 144467 114107437
EST159 147867 93079477
EST16 188030 112160415
EST160 147297 83831707
EST161 146751 78032343
EST162 155026 92506312
EST163 166089 92137071
EST164 40691 24879389
EST165 158732 98361581
EST166 189599 106364877
EST167 152575 85203641
EST168 131414 68374736
EST169 181002 100111931
EST17 196230 121607753
EST170 175588 103927017
EST171 152637 92955764
EST172 173518 89039902
EST173 131191 83350024
EST174 194332 113656382
EST175 158666 90681958
EST176 114401 67791004
EST177 166288 96544556
EST178 172569 103540690
EST179 184784 132131559
EST18 194429 119199172
EST180 156898 112011990
EST181 191790 94165607
EST182 155361 117641007
EST183 151064 90547604
EST184 148435 79206389
EST185 174823 79999152
EST186 153173 85118768
EST187 160638 101956765
EST188 150425 90208411
EST189 164329 102176231
EST19 171211 115159703
EST190 117609 67536326
EST191 135813 91471775
EST192 133513 89649066
EST193 149232 91728842
EST194 133738 89623400
EST195 122888 86809348
EST196 184929 97601405
EST197 177680 98023399
EST198 177191 98321697
EST199 174402 97779923
EST2 164795 62096425
EST20 209083 109166344
EST200 172095 96260518
EST201 176298 98370687
EST202 177505 96675582
EST203 164709 90603927
EST204 195711 105958426
EST205 206152 109521895
EST206 179504 107961601
EST207 191852 109267645
EST208 201205 120943409
EST209 196073 120554342
EST21 226120 110014555
EST210 186733 120742190
EST211 188042 115830858
EST212 224586 146094342
EST213 228342 114227243
EST214 94637 72514880
EST215 152419 102949171
EST216 148736 91921555
EST217 214979 116082678
EST218 170147 112260247
EST219 98859 98941778
EST22 172351 48128798
EST220 151986 108849542
EST221 161202 96732477
EST222 147214 105893993
EST223 229309 107431440
EST224 139034 102138691
EST225 141611 102376928
EST226 136923 95623000
EST227 125787 91563599
EST228 61784 35413614
EST229 143965 93502147
EST23 127963 36941721
EST230 135418 100373245
EST231 138803 99129249
EST232 125443 85403913
EST233 142190 89313987
EST234 159811 120908161
EST235 137476 121891570
EST236 138659 107636746
EST237 169633 103239768
EST238 175597 111014146
EST239 155004 99862607
EST24 129892 43041968
EST240 180054 123645601
EST241 159604 109350869
EST242 117695 90044422
EST243 167075 102315256
EST244 241333 103023833
EST245 147772 113799324
EST246 193758 58738117
EST247 223970 58453710
EST248 203182 95358831
EST249 182771 125016377
EST25 70647 29329977
EST250 163007 103729283
EST251 181000 111895116
EST252 157511 114189158
EST253 187607 117902621
EST254 30985 17230602
EST255 190399 100332638
EST256 180635 115099168
EST257 167679 111158157
EST258 249092 113777746
EST259 289292 125362180
EST26 220411 101231966
EST260 176494 107022949
EST261 205907 47993681
EST262 242765 122619234
EST263 157921 100188503
EST264 169106 105290461
EST265 50709 30022589
EST266 179751 121879869
EST267 185507 100482787
EST268 182156 119681271
EST269 185133 103244746
EST27 225390 113328885
EST270 215483 29558069
EST271 189732 70062583
EST272 187920 110102155
EST273 185743 119788603
EST274 176392 111735492
EST275 182845 112547314
EST276 172330 81107013
EST277 36485 18908652
EST278 130906 82476973
EST279 137473 88132346
EST28 189026 86134485
EST280 165665 98280293
EST281 275099 28789642
EST282 259678 38286312
EST283 153802 107304129
EST284 166343 116141296
EST285 162055 100352825
EST286 200978 74462741
EST287 241086 58545761
EST288 164814 109371374
EST289 20544 10276884
EST29 162523 71125467
EST290 186912 112428814
EST291 157399 99188938
EST292 205325 112327623
EST293 158242 113768574
EST294 171370 103751020
EST295 194245 116004431
EST296 179419 109045583
EST297 196163 96024436
EST298 190778 68045384
EST299 191396 70941035
EST3 163203 58346077
EST30 174535 70158767
EST300 190719 70650833
EST301 69345 27562590
EST302 192007 96689338
EST303 187348 134714468
EST304 149070 87206847
EST305 155533 95492920
EST306 133777 101500525
EST307 163916 96855468
EST308 181162 104999030
EST309 155504 100406367
EST31 157352 67274141
EST310 165819 94850447
EST311 160795 108230125
EST312 153790 109739970
EST313 169252 108528436
EST314 111658 85666419
EST315 187132 157818907
EST316 174464 91778204
EST317 137562 89091802
EST318 148806 103481219
EST319 139378 91686338
EST32 171488 75449075
EST320 144647 95035090
EST321 148617 103414286
EST322 159898 107688032
EST323 176976 102952035
EST324 152506 85356970
EST325 153925 90968891
EST326 154060 109487652
EST327 164863 100882648
EST328 37166 25983936
EST329 141307 87396609
EST33 182196 75448560
EST330 161040 100183631
EST331 205960 108498518
EST332 127607 70005699
EST333 126899 83554498
EST334 137519 87500095
EST335 136288 86700139
EST336 147576 84175257
EST337 225078 89559605
EST338 181344 86454287
EST339 170105 104702046
EST34 99407 28095954
EST340 170435 102544756
EST341 132871 86178897
EST342 15235 10681129
EST343 137604 91444633
EST344 156921 98868072
EST345 182724 122207075
EST346 167462 87614087
EST347 185810 110948333
EST348 160909 119507619
EST349 74086 44318725
EST35 98358 30040859
EST350 113418 62038931
EST351 137457 81882803
EST352 142054 73897155
EST353 161699 33117817
EST354 161684 33089903
EST355 171653 79838496
EST356 125627 84174555
EST357 258614 118815656
EST358 257680 119865846
EST359 172671 99306949
EST36 98643 31223206
EST360 138272 92259786
EST361 141413 86236764
EST362 168558 101971081
EST363 206054 123606988
EST364 221101 57566465
EST365 210336 128559288
EST366 178870 96202724
EST367 121733 62503074
EST368 180330 119047861
EST369 174131 132473823
EST37 97478 29579354
EST370 155547 107864451
EST371 196422 107927512
EST372 177420 104811081
EST373 222191 137057393
EST374 207783 128132377
EST375 189532 109121697
EST376 187248 84534565
EST377 172063 13415221
EST378 158747 13975124
EST379 58585 10179851
EST38 99800 30264291
EST380 161528 33458332
EST381 161810 32795031
EST382 157609 57625717
EST383 163297 92920713
EST384 181919 123490711
EST385 172326 104480912
EST386 161888 110840471
EST387 144371 98583936
EST388 147772 103436736
EST389 158823 100157322
EST39 102298 30724804
EST390 167419 121681918
EST391 165812 101995482
EST392 127197 48906451
EST393 171401 26952778
EST394 166011 101824490
EST395 156346 104711809
EST396 181469 119901446
EST397 143275 77341512
EST398 199951 114218425
EST399 160148 119013984
EST4 174334 68724014
EST40 1095 282302
EST400 136929 93542608
EST401 142357 93683945
EST402 153219 93696905
EST403 177621 98718634
EST404 178330 98977830
EST405 112856 68796551
EST406 184907 112638737
EST407 146030 91976718
EST408 108494 74875770
EST409 96384 65283158
EST41 102108 53644189
EST410 112452 72105678
EST411 128469 77743994
EST412 141150 92733674
EST413 144188 84978634
EST414 166614 97662487
EST415 187765 113774931
EST416 127513 82023953
EST417 185868 95842444
EST418 182468 88907160
EST419 118153 71557687
EST42 122369 52112480
EST420 175043 67630620
EST421 171564 62690410
EST422 78624 30020659
EST43 168959 87984171
EST44 170186 68556188
EST45 171834 92525445
EST46 175215 91724014
EST47 164834 81919579
EST48 166743 92418144
EST49 160107 90950294
EST5 171974 67410247
EST50 165565 94284223
EST51 163920 93625360
EST52 155052 75161019
EST53 154711 93384388
EST54 38397 16290925
EST55 171535 68638216
EST56 161986 77967479
EST57 174741 100020112
EST58 159364 99419781
EST59 162357 105846618
EST6 180194 70823116
EST60 168293 101697116
EST61 167078 108605300
EST62 177560 78407789
EST63 174859 102934321
EST64 152473 79613731
EST65 154459 88230456
EST66 159936 96367438
EST67 95358 55614462
EST68 146237 86440334
EST69 198985 110620918
EST7 170955 73685961
EST70 210833 110653254
EST71 206238 117293751
EST72 207993 122792528
EST73 197007 113885406
EST74 154241 80256783
EST75 137154 64352698
EST76 147412 75984500
EST77 158559 110055127
EST78 151797 81130455
EST79 148229 81471910
EST8 183809 73282961
EST80 15300 16802946
EST81 187567 96561596
EST82 219471 128510099
EST83 211919 113446337
EST84 222523 104755405
EST85 205243 90321885
EST86 152617 92399917
EST87 151559 81459607
EST88 169990 89069929
EST89 156577 85505501
EST9 170921 74409391
EST90 156123 100124850
EST91 155951 106497635
EST92 90407 47618192
EST93 155639 117818121
EST94 144443 106441761
EST95 149183 109585898
EST96 143374 86335839
EST97 164196 91395558
EST98 176088 111612544
EST99 258661 157860018
GSS1 205789 90174747
GSS10 136697 66638930
GSS100 85231 43057555
GSS101 195369 123709625
GSS102 171362 114185150
GSS103 204082 120214971
GSS104 209359 137095544
GSS105 214970 142139377
GSS106 213642 143433159
GSS107 209744 148258595
GSS108 210974 146696949
GSS109 208995 149477422
GSS11 138935 74785184
GSS110 206574 150888518
GSS111 152874 113593535
GSS112 135296 85656970
GSS113 173591 81374386
GSS114 192345 86757146
GSS115 176167 150366252
GSS116 183021 128334250
GSS117 188345 152147956
GSS118 195882 129458296
GSS119 192306 135653506
GSS12 150052 71645258
GSS120 200620 111543834
GSS121 178655 133102172
GSS122 174425 140065381
GSS123 2595 1009235
GSS124 87146 64102517
GSS125 83555 62802306
GSS126 103711 48629580
GSS127 68516 58447747
GSS128 7504 6899982
GSS129 68591 57924394
GSS13 147386 72057865
GSS130 69224 56650935
GSS131 69460 56187403
GSS132 71202 55998401
GSS133 68561 51865315
GSS134 75915 58209304
GSS135 87237 74898207
GSS136 81830 44609896
GSS137 93341 45143465
GSS138 56581 44294953
GSS139 77438 61353715
GSS14 180591 90589334
GSS140 69655 58699702
GSS141 67711 62707076
GSS142 62046 53381270
GSS143 95569 42915019
GSS144 21044 4905042
GSS145 112672 70634090
GSS146 1088 802743
GSS147 23226 28867035
GSS148 106621 69122590
GSS149 85457 35201726
GSS15 165393 96605770
GSS150 37313 23219225
GSS151 120402 72958896
GSS152 118337 75092514
GSS153 105426 63990802
GSS154 47835 23142546
GSS155 83102 54651503
GSS156 95630 61300959
GSS157 107319 78552403
GSS158 106422 76714273
GSS159 106058 79947480
GSS16 175055 92851473
GSS160 103996 80016519
GSS161 76376 51040365
GSS162 104570 63290945
GSS163 109868 66415305
GSS164 106323 59388992
GSS165 68303 37395892
GSS166 70143 39046688
GSS167 36533 17439317
GSS168 85481 46023427
GSS169 97119 55907586
GSS17 196533 125621946
GSS170 94982 49597190
GSS171 96286 55922591
GSS172 42132 23615490
GSS173 114638 43642267
GSS174 117085 39368203
GSS175 108676 55514545
GSS176 101471 78372335
GSS177 65199 40988720
GSS178 95891 36542252
GSS179 95417 37268709
GSS18 194711 106479472
GSS180 96671 35161518
GSS181 94285 39167432
GSS182 37736 17626556
GSS183 103939 66277823
GSS184 94551 61190929
GSS185 95128 60357048
GSS186 94773 60868501
GSS187 75456 69806637
GSS188 74978 73998303
GSS189 4831 7669769
GSS19 59752 25437618
GSS190 83736 28233267
GSS191 84219 27346468
GSS192 84926 25909272
GSS193 14851 4422302
GSS194 16547 7508221
GSS195 92689 59664938
GSS196 91834 47919637
GSS197 96594 58917503
GSS198 91411 63211512
GSS199 90323 64889518
GSS2 186370 94788401
GSS20 186916 105322671
GSS200 91054 63764867
GSS201 7427 5313332
GSS202 89694 65112997
GSS203 91751 63324801
GSS204 91480 67269119
GSS205 83657 79703161
GSS206 84185 78966201
GSS207 91879 76832958
GSS208 12387 9639114
GSS209 117650 64297121
GSS21 169128 115837914
GSS210 96973 62004430
GSS211 17943 10969369
GSS212 94787 57200301
GSS213 93517 59081345
GSS214 93900 58510429
GSS215 94714 57307691
GSS216 94279 58016121
GSS217 6701 3333254
GSS22 174184 99582895
GSS23 192369 138599496
GSS24 201033 123471734
GSS25 175457 104246621
GSS26 197072 119480726
GSS27 167838 161610244
GSS28 190624 134427548
GSS29 167179 120575133
GSS3 178561 89383943
GSS30 158731 105315922
GSS31 201673 130043244
GSS32 222403 119400836
GSS33 224622 116464658
GSS34 225847 114839954
GSS35 216729 131101319
GSS36 202761 159857338
GSS37 199139 148662682
GSS38 188477 55109967
GSS39 186333 106234122
GSS4 169875 86614174
GSS40 191325 138933721
GSS41 150682 135332163
GSS42 187622 102184708
GSS43 178261 125609833
GSS44 189663 127750237
GSS45 194847 125942531
GSS46 53295 50118667
GSS47 175398 104012483
GSS48 170991 105338695
GSS49 171834 105223965
GSS5 37307 23392794
GSS50 186392 124599449
GSS51 190585 117318545
GSS52 190206 125111512
GSS53 189049 119453106
GSS54 189660 132334451
GSS55 193182 112144944
GSS56 194503 124514952
GSS57 139506 107239273
GSS58 176473 141452510
GSS59 164987 113501389
GSS6 165197 86454148
GSS60 164771 113957518
GSS61 148748 100755802
GSS62 160481 131381765
GSS63 173037 144912030
GSS64 187480 121672816
GSS65 207363 129090176
GSS66 196670 113303552
GSS67 251736 131206295
GSS68 157516 105626161
GSS69 165278 126105180
GSS7 168801 80509155
GSS70 165920 126999175
GSS71 168047 126904498
GSS72 184852 114660920
GSS73 153962 113516805
GSS74 204046 129696056
GSS75 174135 114723585
GSS76 204934 135114464
GSS77 227955 77639594
GSS78 187494 114996969
GSS79 126134 93247017
GSS8 168974 90773407
GSS80 148462 119526539
GSS81 143023 118724908
GSS82 146600 118581759
GSS83 146517 121755921
GSS84 147293 120525169
GSS85 66807 55325711
GSS86 153116 125189801
GSS87 151211 119797782
GSS88 147162 116207653
GSS89 146029 118503290
GSS9 138697 67649628
GSS90 148214 123451508
GSS91 151860 123280024
GSS92 150921 121305900
GSS93 149486 124130828
GSS94 149686 123749626
GSS95 150354 122457322
GSS96 147975 115583746
GSS97 145074 117966230
GSS98 148906 124769101
GSS99 184775 128705163
HTC1 25057 27045808
HTC10 64078 67375744
HTC11 74795 76398895
HTC12 21266 31047585
HTC13 66997 61008541
HTC14 68361 69531096
HTC15 17596 12458095
HTC2 16086 36243320
HTC3 16029 36627693
HTC4 16251 35560357
HTC5 15981 40345967
HTC6 16068 37476179
HTC7 53837 31481114
HTC8 31133 19445871
HTC9 62293 77362082
HTG1 1318 188771164
HTG10 1298 186333849
HTG100 989 189318323
HTG101 997 189394206
HTG102 985 189419172
HTG103 1161 190567827
HTG104 32 4526682
HTG105 1090 189528150
HTG106 1040 189738262
HTG107 1395 191466140
HTG108 1301 190961916
HTG109 1620 191136666
HTG11 6 837687
HTG110 1378 191801664
HTG111 1445 190411167
HTG112 1137 190213122
HTG113 1099 185226672
HTG114 19 2147866
HTG115 1514 182320332
HTG116 990 192291316
HTG117 739 168801207
HTG118 1087 193647321
HTG119 1101 193186076
HTG12 1451 183826000
HTG120 464 86304769
HTG121 1031 189856172
HTG122 1054 192626911
HTG123 1161 192048803
HTG124 1086 192991466
HTG125 1073 193035103
HTG126 720 125862637
HTG127 1120 192691168
HTG128 1087 192396449
HTG129 1080 192512306
HTG13 875 191580267
HTG130 1094 192371026
HTG131 1080 191988042
HTG132 1071 192267653
HTG133 1077 192406348
HTG134 1117 192086190
HTG135 1155 190016975
HTG136 240 23444335
HTG14 750 192192484
HTG15 745 192079551
HTG16 784 191991252
HTG17 800 191673948
HTG18 770 191911891
HTG19 2060 170753191
HTG2 2470 186037380
HTG20 1078 187572876
HTG21 933 184541383
HTG22 785 191651908
HTG23 928 190141652
HTG24 906 190387661
HTG25 811 191239638
HTG26 784 191781819
HTG27 874 191154594
HTG28 896 190443140
HTG29 939 189977999
HTG3 2513 185208586
HTG30 910 190822897
HTG31 843 171828946
HTG32 875 191097680
HTG33 966 189315433
HTG34 884 190984277
HTG35 865 191179116
HTG36 826 191553884
HTG37 948 189962435
HTG38 949 190503054
HTG39 940 190034955
HTG4 2550 188439001
HTG40 1047 189191247
HTG41 1103 170257655
HTG42 1257 188188838
HTG43 1169 188132191
HTG44 1150 188026157
HTG45 1118 191332771
HTG46 1269 190703866
HTG47 1174 190717160
HTG48 1130 191137302
HTG49 1047 191184441
HTG5 1283 185453274
HTG50 1021 189712765
HTG51 1061 180778979
HTG52 969 190090757
HTG53 1106 190109635
HTG54 1046 190260051
HTG55 1014 189766536
HTG56 967 189017980
HTG57 89 15545773
HTG58 1010 189344282
HTG59 1031 190032537
HTG6 1273 185124562
HTG60 1070 187377445
HTG61 1128 188170515
HTG62 1002 173184925
HTG63 1086 189585086
HTG64 1065 189567157
HTG65 1169 188828767
HTG66 1178 187478964
HTG67 1283 184490539
HTG68 95 12336833
HTG69 1221 185314622
HTG7 1276 185375030
HTG70 1239 184674446
HTG71 1244 184625496
HTG72 1183 187658245
HTG73 1031 171977135
HTG74 1118 188295824
HTG75 1103 190843621
HTG76 1137 190917883
HTG77 1182 190813322
HTG78 1102 187147429
HTG79 1171 190202119
HTG8 1459 184608562
HTG80 1115 190062476
HTG81 1214 189987246
HTG82 1120 189706900
HTG83 958 164506501
HTG84 1228 188383308
HTG85 1251 187687552
HTG86 1141 190046144
HTG87 1147 189797786
HTG88 990 169864866
HTG89 1183 189859637
HTG9 1200 186916809
HTG90 1104 190148649
HTG91 1145 190088330
HTG92 1100 190386057
HTG93 992 163352095
HTG94 1056 190721648
HTG95 1157 191052767
HTG96 1036 189089901
HTG97 1070 189523412
HTG98 697 129848543
HTG99 1018 189685746
INV1 94101 48399547
INV10 57626 88428724
INV11 83654 65541093
INV12 53552 42232276
INV13 85036 66305435
INV14 80904 66998014
INV15 78692 67790060
INV16 38378 36494398
INV17 8168 145023213
INV18 320 155148771
INV19 29051 118812911
INV2 8396 173252271
INV20 78018 65423005
INV21 73883 63166878
INV22 73366 49494194
INV23 74051 50376824
INV24 42929 100466924
INV25 1078 6779753
INV3 1188 167428329
INV4 23966 122201163
INV5 79467 71396354
INV6 36828 111459135
INV7 43107 103085585
INV8 4119 3200423
INV9 80644 71840339
MAM1 14080 163353933
MAM2 27184 146962170
MAM3 51853 94392894
MAM4 31524 148680320
MAM5 81866 77522000
MAM6 38820 59492200
PAT1 222584 70118640
PAT10 124645 102571664
PAT100 193712 81686401
PAT101 150217 108404022
PAT102 356051 11379688
PAT103 257211 57607099
PAT104 266090 51425150
PAT105 268710 45315201
PAT106 94335 72485595
PAT107 203659 47736667
PAT108 277827 9628431
PAT109 220409 46465135
PAT11 98067 63921710
PAT110 106723 2881242
PAT111 270386 21672571
PAT112 186754 61243094
PAT113 109815 106056960
PAT114 47499 9547002
PAT115 87390 88404059
PAT116 78495 95690560
PAT117 145700 77452710
PAT118 167131 71672065
PAT119 121715 92739548
PAT12 142116 62839306
PAT120 102686 85583689
PAT121 164069 42868362
PAT122 270022 5130418
PAT123 269978 5129582
PAT124 269978 5129582
PAT125 269634 5123046
PAT126 269396 5118524
PAT127 247246 29625533
PAT128 15355 3681658
PAT13 105847 59926449
PAT14 103682 50111599
PAT15 121155 53340285
PAT16 113167 61276231
PAT17 39069 16194026
PAT18 146866 52619866
PAT19 153883 78031245
PAT2 194513 84658194
PAT20 105015 118267861
PAT21 133366 95756379
PAT22 84489 78955747
PAT23 123584 103413558
PAT24 119395 105824731
PAT25 145802 86555806
PAT26 175038 64241582
PAT27 71181 1779525
PAT28 102177 77405969
PAT29 93964 87637529
PAT3 171988 95892359
PAT30 119943 61669806
PAT31 96657 78965237
PAT32 128385 55040981
PAT33 92184 51103312
PAT34 111301 78152661
PAT35 138107 29118428
PAT36 158496 24088068
PAT37 114684 49013158
PAT38 44860 54579798
PAT39 95735 83200429
PAT4 153746 106059888
PAT40 100229 70976055
PAT41 136206 39303264
PAT42 143781 35446940
PAT43 123737 64747144
PAT44 104348 81197381
PAT45 93445 74211542
PAT46 113255 66591457
PAT47 65218 54831902
PAT48 135193 108001084
PAT49 167081 97032398
PAT5 57169 23943480
PAT50 116397 127555645
PAT51 196343 76722711
PAT52 80302 127991032
PAT53 27631 180872621
PAT54 185408 93066629
PAT55 274454 6861350
PAT56 129252 31622558
PAT57 161322 77820344
PAT58 92937 89473089
PAT59 106721 74678844
PAT6 170642 91909261
PAT60 122357 64030175
PAT61 67098 30231972
PAT62 70750 109767817
PAT63 87947 82758966
PAT64 92971 78937516
PAT65 93166 72441718
PAT66 93384 75085880
PAT67 115775 60531183
PAT68 102736 9941783
PAT69 175933 10547809
PAT7 154847 88276419
PAT70 171510 10872561
PAT71 171496 10866737
PAT72 99859 86225043
PAT73 99 196466297
PAT74 67 192869889
PAT75 103 195600591
PAT76 1137 196318757
PAT77 97599 5772236
PAT78 151009 9636510
PAT79 151022 9621259
PAT8 131174 97068238
PAT80 151024 9622125
PAT81 151021 9620837
PAT82 94633 88060720
PAT83 109868 84438934
PAT84 342935 8573375
PAT85 188806 88519660
PAT86 111348 132068608
PAT87 3850 194703659
PAT88 131292 110979300
PAT89 158599 54826034
PAT9 129733 101132925
PAT90 224739 34113982
PAT91 250080 15844374
PAT92 180674 63687304
PAT93 51645 26035465
PAT94 114209 110462581
PAT95 137727 83290495
PAT96 164129 99338183
PAT97 158877 103325984
PAT98 137417 114988187
PAT99 42311 27994848
PHG1 5574 44675058
PLN1 59881 93426541
PLN10 37160 49276775
PLN11 37340 72908971
PLN12 14017 137396051
PLN13 7652 36617299
PLN14 17556 144689898
PLN15 17614 146132511
PLN16 17540 146254893
PLN17 24642 129067800
PLN18 5739 150765655
PLN19 1244 169457566
PLN2 24096 134545242
PLN20 15872 152719026
PLN21 5345 6422629
PLN22 67473 69922481
PLN23 28405 30656356
PLN24 77085 76410753
PLN25 65471 81618269
PLN26 40690 116669687
PLN27 15537 139705778
PLN28 19531 130509260
PLN29 77766 74269225
PLN3 1396 181629060
PLN30 90472 65894771
PLN31 48134 32709003
PLN32 80937 71251271
PLN33 78021 76066310
PLN34 80191 70541404
PLN35 81682 76684190
PLN36 45312 22112368
PLN37 101222 57728340
PLN38 81075 69277708
PLN39 45856 102100646
PLN4 1882 187350016
PLN40 78525 75284484
PLN41 78434 75314736
PLN42 74216 76796654
PLN43 17561 36623818
PLN5 1823 194438398
PLN6 15470 156794398
PLN7 75882 79387542
PLN8 8143 8485352
PLN9 73376 76197082
PRI1 23015 59645441
PRI10 1280 179427568
PRI11 745 90543993
PRI12 1278 179183454
PRI13 1451 177770436
PRI14 1589 180081042
PRI15 1591 181937113
PRI16 1285 191720991
PRI17 1137 193649117
PRI18 1098 194174732
PRI19 1166 193723867
PRI2 17590 150205814
PRI20 1759 191943310
PRI21 2748 190073284
PRI22 20543 69478867
PRI23 32483 85337156
PRI24 61487 78326126
PRI25 30556 68508260
PRI26 6602 167012246
PRI27 2120 180826269
PRI28 1603 181718304
PRI29 2030 181844962
PRI3 1435 175512642
PRI30 1976 180765380
PRI31 13058 154568425
PRI32 1295 183195058
PRI33 43857 104096766
PRI34 21463 27368236
PRI35 32191 63614159
PRI36 20231 117529774
PRI37 18704 147025890
PRI38 67371 86985568
PRI39 50314 89025658
PRI4 1288 185841046
PRI40 32945 61283195
PRI41 68786 81668506
PRI42 8632 42988582
PRI5 1317 183917363
PRI6 1182 180166249
PRI7 1250 181265435
PRI8 1216 178092374
PRI9 1360 174643732
ROD1 32001 141281577
ROD10 982 181217972
ROD11 208 39287360
ROD12 1034 185475616
ROD13 940 182704112
ROD14 1040 189324025
ROD15 950 180306408
ROD16 967 182057152
ROD17 991 185812687
ROD18 1189 190370327
ROD19 16440 82387923
ROD2 915 175229966
ROD20 20158 148888830
ROD21 1137 182363017
ROD22 1062 165597656
ROD23 13708 162712297
ROD24 38674 69920367
ROD25 21944 104115930
ROD26 1515 187856178
ROD27 137637 36990264
ROD28 82956 72586020
ROD29 27324 31930251
ROD3 908 173381822
ROD4 899 173861411
ROD5 922 174175352
ROD6 969 178238704
ROD7 965 179326222
ROD8 982 181406206
ROD9 997 182054285
STS1 85198 36520121
STS10 57907 44419978
STS11 49213 37736560
STS12 57924 43637361
STS13 64502 42942872
STS14 93330 34074517
STS15 103303 26251767
STS16 11147 3017128
STS17 102990 27289864
STS18 87041 34345853
STS19 98823 33227242
STS2 84773 49806133
STS20 54544 20186885
STS3 67436 26373836
STS4 75800 36971759
STS5 7808 4576869
STS6 54177 31603126
STS7 54081 31788805
STS8 54235 31906296
STS9 55657 37682948
SYN1 44280 72817447
SYN2 49092 70537397
SYN3 621 1853247
TSA1 120497 38242009
TSA10 89137 62197183
TSA11 134846 31200551
TSA12 76229 13521723
TSA2 113534 41672044
TSA3 110397 41018234
TSA4 111041 44110506
TSA5 30117 7017805
TSA6 117559 60377531
TSA7 110843 74874338
TSA8 116946 64891905
TSA9 114144 51421241
UNA1 222 120289
VRL1 70349 67339165
VRL10 44782 60282471
VRL11 62262 72140806
VRL12 58034 72255432
VRL13 61433 68435260
VRL14 59745 72773685
VRL15 59155 65373216
VRL2 73130 64084261
VRL3 70820 62797248
VRL4 69207 70548710
VRL5 36491 39712342
VRL6 48364 77592072
VRL7 63408 70096717
VRL8 61865 72467087
VRL9 65661 69894570
VRT1 34511 135701001
VRT10 1257 189413778
VRT11 8277 178097525
VRT12 3988 136034657
VRT13 13177 170897930
VRT14 5275 182914197
VRT15 3950 186224988
VRT16 38554 133290451
VRT17 80139 68443385
VRT18 78060 67236269
VRT19 78185 65601638
VRT2 11662 177600840
VRT20 63758 95987731
VRT21 77554 63547401
VRT22 11104 10538590
VRT3 62108 93097425
VRT4 20345 154696571
VRT5 19027 15793465
VRT6 73015 66830402
VRT7 31735 63527191
VRT8 30658 111967049
VRT9 1203 190000786
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 180.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:
Entries Bases Species
16403297 14891556303 Homo sapiens
7871531 8892650030 Mus musculus
2179595 6458987847 Rattus norvegicus
2190848 5362571338 Bos taurus
3892658 5037718386 Zea mays
3219186 4784078545 Sus scrofa
1698243 3125621603 Danio rerio
228238 1352920226 Strongylocentrotus purpuratus
1243345 1197439938 Oryza sativa Japonica Group
1756913 1187717551 Nicotiana tabacum
1424202 1147136093 Xenopus (Silurana) tropicalis
1212433 1049762304 Drosophila melanogaster
213953 1002175163 Pan troglodytes
2294285 1002146700 Arabidopsis thaliana
1452602 943091356 Canis lupus familiaris
660621 913979288 Vitis vinifera
810333 891564107 Gallus gallus
1880599 887191622 Glycine max
82244 823113612 Macaca mulatta
1216415 748356051 Ciona intestinalis
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
October 15 2010
NCBI-GenBank Flat File Release 180.0
Bacterial Sequences (Part 1)
51396 loci, 92682287 bases, from 51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
or 2010.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA).
Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
DBLINK Project:18787
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK Project:100,200,300
DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:
http://www.ncbi.nlm.nih.gov/genomes/static/gprj_help.html#introduction
As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 180.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Michel Eschenbrenner, Irene Fang,
Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
Susan Schafer, Beverly Underwood, Melissa Wright, and Linda Yankie
Data Management and Preparation
Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
Eugene Yaschenko, Sergey Zhdanov
Database Administration
Slava Khotomliansky, Igor Lozitskiy, Ben Slade, Constantin Vasilyev
User Support
Peter Cooper, Wayne Matten, Scott McGinnis, Steve Pechous, Monica Romiti,
Eric Sayers, Tao Tao, Majda Valjavec-Gratian
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
