Release Notes For GenBank Release 182
GBREL.TXT Genetic Sequence Data Bank
February 15 2011
NCBI-GenBank Flat File Release 182.0
Distribution Release Notes
132015054 loci, 124277818310 bases, from 132015054 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 182.0
1.2 Cutoff Date
1.3 Important Changes in Release 182.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 182.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for GenBank's web-based submission tool (BankIt) :
http://www.ncbi.nlm.nih.gov/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 182.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana, courtesy of the Bio-Mirror project:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:
http://www.bio-mirror.net/
1.2 Cutoff Date
This full release, 182.0, incorporates data available to the collaborating
databases as of February 14, 2011 at approximately 1:30am EST. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 182.0
1.3.1 Organizational changes
The total number of sequence data files increased by 27 with this release:
- the BCT division is now composed of 65 files (+2)
- the CON division is now composed of 148 files (+5)
- the ENV division is now composed of 40 files (+7)
- the EST division is now composed of 433 files (+6)
- the GSS division is now composed of 227 files (+3)
- the MAM division is now composed of 7 files (+1)
- the PAT division is now composed of 140 files (+2)
- the TSA division is now composed of 16 files (+1)
The total number of 'index' files increased by 13 with this release:
- the AUT (author name) index is now composed of 95 files (+13)
1.3.2 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.3 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
ninety-five of the GSS flatfiles in Release 182.0. Consider gbgss133.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
February 15 2011
NCBI-GenBank Flat File Release 182.0
GSS Sequences (Part 1)
87132 loci, 64062850 bases, from 87132 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "133" based on the number of files dumped from the other
system. We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.
1.4 Upcoming Changes
A variety of changes affecting the GenBank flatfile format were implemented
in October 2010, as a result of discussions among DDBJ, EBI, and NCBI at the
May 2010 International Nucleotide Sequence Database Collaboration annual
meeting.
However, three of the planned changes could not be completed for the
October 15 GenBank 180.0 release:
a) The /partial qualifier will be discontinued, given that 5' and 3'
partiality can be indicated via a feature's location ('<' and '>').
b) A classification system will be introduced for the /inference and
/experiment qualifiers, such that the inferential or experimental
information can be associated with a feature's existence, location,
or description.
c) A /whole_replicon qualifier will be introduced, allowing records
which represent the entirety of a replicon (a chromosome; an organelle;
a mitochondrial plasmid) to be identified as such.
An investigation of (a) for older sequence records has thrown into question
whether the /partial qualifier can actually be done away with. On-going
review will determine whether this change will be implemented as agreed,
amended, or abandoned.
The implementation of (b) has been delayed because of delays in software
development supporting the new classification system. We do not expect to
be able to deploy the new /inference and /experiment qualifiers until at
least February 2011.
Specification of the conditions under which the /whole_replicon qualifier
is, and is not, allowed to be used for sequence records is not yet complete,
so implementation of (c) has likewise been delayed.
We will inform GenBank users when the issues impacting these three changes
have been clarified.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1553 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut74.idx - Index of the entries according to author name, part 74.
76. gbaut75.idx - Index of the entries according to author name, part 75.
77. gbaut76.idx - Index of the entries according to author name, part 76.
78. gbaut77.idx - Index of the entries according to author name, part 77.
79. gbaut78.idx - Index of the entries according to author name, part 78.
80. gbaut79.idx - Index of the entries according to author name, part 79.
81. gbaut8.idx - Index of the entries according to author name, part 8.
82. gbaut80.idx - Index of the entries according to author name, part 80.
83. gbaut81.idx - Index of the entries according to author name, part 81.
84. gbaut82.idx - Index of the entries according to author name, part 82.
85. gbaut83.idx - Index of the entries according to author name, part 83.
86. gbaut84.idx - Index of the entries according to author name, part 84.
87. gbaut85.idx - Index of the entries according to author name, part 85.
88. gbaut86.idx - Index of the entries according to author name, part 86.
89. gbaut87.idx - Index of the entries according to author name, part 87.
90. gbaut88.idx - Index of the entries according to author name, part 88.
91. gbaut89.idx - Index of the entries according to author name, part 89.
92. gbaut9.idx - Index of the entries according to author name, part 9.
93. gbaut90.idx - Index of the entries according to author name, part 90.
94. gbaut91.idx - Index of the entries according to author name, part 91.
95. gbaut92.idx - Index of the entries according to author name, part 92.
96. gbaut93.idx - Index of the entries according to author name, part 93.
97. gbaut94.idx - Index of the entries according to author name, part 94.
98. gbaut95.idx - Index of the entries according to author name, part 95.
99. gbbct1.seq - Bacterial sequence entries, part 1.
100. gbbct10.seq - Bacterial sequence entries, part 10.
101. gbbct11.seq - Bacterial sequence entries, part 11.
102. gbbct12.seq - Bacterial sequence entries, part 12.
103. gbbct13.seq - Bacterial sequence entries, part 13.
104. gbbct14.seq - Bacterial sequence entries, part 14.
105. gbbct15.seq - Bacterial sequence entries, part 15.
106. gbbct16.seq - Bacterial sequence entries, part 16.
107. gbbct17.seq - Bacterial sequence entries, part 17.
108. gbbct18.seq - Bacterial sequence entries, part 18.
109. gbbct19.seq - Bacterial sequence entries, part 19.
110. gbbct2.seq - Bacterial sequence entries, part 2.
111. gbbct20.seq - Bacterial sequence entries, part 20.
112. gbbct21.seq - Bacterial sequence entries, part 21.
113. gbbct22.seq - Bacterial sequence entries, part 22.
114. gbbct23.seq - Bacterial sequence entries, part 23.
115. gbbct24.seq - Bacterial sequence entries, part 24.
116. gbbct25.seq - Bacterial sequence entries, part 25.
117. gbbct26.seq - Bacterial sequence entries, part 26.
118. gbbct27.seq - Bacterial sequence entries, part 27.
119. gbbct28.seq - Bacterial sequence entries, part 28.
120. gbbct29.seq - Bacterial sequence entries, part 29.
121. gbbct3.seq - Bacterial sequence entries, part 3.
122. gbbct30.seq - Bacterial sequence entries, part 30.
123. gbbct31.seq - Bacterial sequence entries, part 31.
124. gbbct32.seq - Bacterial sequence entries, part 32.
125. gbbct33.seq - Bacterial sequence entries, part 33.
126. gbbct34.seq - Bacterial sequence entries, part 34.
127. gbbct35.seq - Bacterial sequence entries, part 35.
128. gbbct36.seq - Bacterial sequence entries, part 36.
129. gbbct37.seq - Bacterial sequence entries, part 37.
130. gbbct38.seq - Bacterial sequence entries, part 38.
131. gbbct39.seq - Bacterial sequence entries, part 39.
132. gbbct4.seq - Bacterial sequence entries, part 4.
133. gbbct40.seq - Bacterial sequence entries, part 40.
134. gbbct41.seq - Bacterial sequence entries, part 41.
135. gbbct42.seq - Bacterial sequence entries, part 42.
136. gbbct43.seq - Bacterial sequence entries, part 43.
137. gbbct44.seq - Bacterial sequence entries, part 44.
138. gbbct45.seq - Bacterial sequence entries, part 45.
139. gbbct46.seq - Bacterial sequence entries, part 46.
140. gbbct47.seq - Bacterial sequence entries, part 47.
141. gbbct48.seq - Bacterial sequence entries, part 48.
142. gbbct49.seq - Bacterial sequence entries, part 49.
143. gbbct5.seq - Bacterial sequence entries, part 5.
144. gbbct50.seq - Bacterial sequence entries, part 50.
145. gbbct51.seq - Bacterial sequence entries, part 51.
146. gbbct52.seq - Bacterial sequence entries, part 52.
147. gbbct53.seq - Bacterial sequence entries, part 53.
148. gbbct54.seq - Bacterial sequence entries, part 54.
149. gbbct55.seq - Bacterial sequence entries, part 55.
150. gbbct56.seq - Bacterial sequence entries, part 56.
151. gbbct57.seq - Bacterial sequence entries, part 57.
152. gbbct58.seq - Bacterial sequence entries, part 58.
153. gbbct59.seq - Bacterial sequence entries, part 59.
154. gbbct6.seq - Bacterial sequence entries, part 6.
155. gbbct60.seq - Bacterial sequence entries, part 60.
156. gbbct61.seq - Bacterial sequence entries, part 61.
157. gbbct62.seq - Bacterial sequence entries, part 62.
158. gbbct63.seq - Bacterial sequence entries, part 63.
159. gbbct64.seq - Bacterial sequence entries, part 64.
160. gbbct65.seq - Bacterial sequence entries, part 65.
161. gbbct7.seq - Bacterial sequence entries, part 7.
162. gbbct8.seq - Bacterial sequence entries, part 8.
163. gbbct9.seq - Bacterial sequence entries, part 9.
164. gbchg.txt - Accession numbers of entries updated since the previous release.
165. gbcon1.seq - Constructed sequence entries, part 1.
166. gbcon10.seq - Constructed sequence entries, part 10.
167. gbcon100.seq - Constructed sequence entries, part 100.
168. gbcon101.seq - Constructed sequence entries, part 101.
169. gbcon102.seq - Constructed sequence entries, part 102.
170. gbcon103.seq - Constructed sequence entries, part 103.
171. gbcon104.seq - Constructed sequence entries, part 104.
172. gbcon105.seq - Constructed sequence entries, part 105.
173. gbcon106.seq - Constructed sequence entries, part 106.
174. gbcon107.seq - Constructed sequence entries, part 107.
175. gbcon108.seq - Constructed sequence entries, part 108.
176. gbcon109.seq - Constructed sequence entries, part 109.
177. gbcon11.seq - Constructed sequence entries, part 11.
178. gbcon110.seq - Constructed sequence entries, part 110.
179. gbcon111.seq - Constructed sequence entries, part 111.
180. gbcon112.seq - Constructed sequence entries, part 112.
181. gbcon113.seq - Constructed sequence entries, part 113.
182. gbcon114.seq - Constructed sequence entries, part 114.
183. gbcon115.seq - Constructed sequence entries, part 115.
184. gbcon116.seq - Constructed sequence entries, part 116.
185. gbcon117.seq - Constructed sequence entries, part 117.
186. gbcon118.seq - Constructed sequence entries, part 118.
187. gbcon119.seq - Constructed sequence entries, part 119.
188. gbcon12.seq - Constructed sequence entries, part 12.
189. gbcon120.seq - Constructed sequence entries, part 120.
190. gbcon121.seq - Constructed sequence entries, part 121.
191. gbcon122.seq - Constructed sequence entries, part 122.
192. gbcon123.seq - Constructed sequence entries, part 123.
193. gbcon124.seq - Constructed sequence entries, part 124.
194. gbcon125.seq - Constructed sequence entries, part 125.
195. gbcon126.seq - Constructed sequence entries, part 126.
196. gbcon127.seq - Constructed sequence entries, part 127.
197. gbcon128.seq - Constructed sequence entries, part 128.
198. gbcon129.seq - Constructed sequence entries, part 129.
199. gbcon13.seq - Constructed sequence entries, part 13.
200. gbcon130.seq - Constructed sequence entries, part 130.
201. gbcon131.seq - Constructed sequence entries, part 131.
202. gbcon132.seq - Constructed sequence entries, part 132.
203. gbcon133.seq - Constructed sequence entries, part 133.
204. gbcon134.seq - Constructed sequence entries, part 134.
205. gbcon135.seq - Constructed sequence entries, part 135.
206. gbcon136.seq - Constructed sequence entries, part 136.
207. gbcon137.seq - Constructed sequence entries, part 137.
208. gbcon138.seq - Constructed sequence entries, part 138.
209. gbcon139.seq - Constructed sequence entries, part 139.
210. gbcon14.seq - Constructed sequence entries, part 14.
211. gbcon140.seq - Constructed sequence entries, part 140.
212. gbcon141.seq - Constructed sequence entries, part 141.
213. gbcon142.seq - Constructed sequence entries, part 142.
214. gbcon143.seq - Constructed sequence entries, part 143.
215. gbcon144.seq - Constructed sequence entries, part 144.
216. gbcon145.seq - Constructed sequence entries, part 145.
217. gbcon146.seq - Constructed sequence entries, part 146.
218. gbcon147.seq - Constructed sequence entries, part 147.
219. gbcon148.seq - Constructed sequence entries, part 148.
220. gbcon15.seq - Constructed sequence entries, part 15.
221. gbcon16.seq - Constructed sequence entries, part 16.
222. gbcon17.seq - Constructed sequence entries, part 17.
223. gbcon18.seq - Constructed sequence entries, part 18.
224. gbcon19.seq - Constructed sequence entries, part 19.
225. gbcon2.seq - Constructed sequence entries, part 2.
226. gbcon20.seq - Constructed sequence entries, part 20.
227. gbcon21.seq - Constructed sequence entries, part 21.
228. gbcon22.seq - Constructed sequence entries, part 22.
229. gbcon23.seq - Constructed sequence entries, part 23.
230. gbcon24.seq - Constructed sequence entries, part 24.
231. gbcon25.seq - Constructed sequence entries, part 25.
232. gbcon26.seq - Constructed sequence entries, part 26.
233. gbcon27.seq - Constructed sequence entries, part 27.
234. gbcon28.seq - Constructed sequence entries, part 28.
235. gbcon29.seq - Constructed sequence entries, part 29.
236. gbcon3.seq - Constructed sequence entries, part 3.
237. gbcon30.seq - Constructed sequence entries, part 30.
238. gbcon31.seq - Constructed sequence entries, part 31.
239. gbcon32.seq - Constructed sequence entries, part 32.
240. gbcon33.seq - Constructed sequence entries, part 33.
241. gbcon34.seq - Constructed sequence entries, part 34.
242. gbcon35.seq - Constructed sequence entries, part 35.
243. gbcon36.seq - Constructed sequence entries, part 36.
244. gbcon37.seq - Constructed sequence entries, part 37.
245. gbcon38.seq - Constructed sequence entries, part 38.
246. gbcon39.seq - Constructed sequence entries, part 39.
247. gbcon4.seq - Constructed sequence entries, part 4.
248. gbcon40.seq - Constructed sequence entries, part 40.
249. gbcon41.seq - Constructed sequence entries, part 41.
250. gbcon42.seq - Constructed sequence entries, part 42.
251. gbcon43.seq - Constructed sequence entries, part 43.
252. gbcon44.seq - Constructed sequence entries, part 44.
253. gbcon45.seq - Constructed sequence entries, part 45.
254. gbcon46.seq - Constructed sequence entries, part 46.
255. gbcon47.seq - Constructed sequence entries, part 47.
256. gbcon48.seq - Constructed sequence entries, part 48.
257. gbcon49.seq - Constructed sequence entries, part 49.
258. gbcon5.seq - Constructed sequence entries, part 5.
259. gbcon50.seq - Constructed sequence entries, part 50.
260. gbcon51.seq - Constructed sequence entries, part 51.
261. gbcon52.seq - Constructed sequence entries, part 52.
262. gbcon53.seq - Constructed sequence entries, part 53.
263. gbcon54.seq - Constructed sequence entries, part 54.
264. gbcon55.seq - Constructed sequence entries, part 55.
265. gbcon56.seq - Constructed sequence entries, part 56.
266. gbcon57.seq - Constructed sequence entries, part 57.
267. gbcon58.seq - Constructed sequence entries, part 58.
268. gbcon59.seq - Constructed sequence entries, part 59.
269. gbcon6.seq - Constructed sequence entries, part 6.
270. gbcon60.seq - Constructed sequence entries, part 60.
271. gbcon61.seq - Constructed sequence entries, part 61.
272. gbcon62.seq - Constructed sequence entries, part 62.
273. gbcon63.seq - Constructed sequence entries, part 63.
274. gbcon64.seq - Constructed sequence entries, part 64.
275. gbcon65.seq - Constructed sequence entries, part 65.
276. gbcon66.seq - Constructed sequence entries, part 66.
277. gbcon67.seq - Constructed sequence entries, part 67.
278. gbcon68.seq - Constructed sequence entries, part 68.
279. gbcon69.seq - Constructed sequence entries, part 69.
280. gbcon7.seq - Constructed sequence entries, part 7.
281. gbcon70.seq - Constructed sequence entries, part 70.
282. gbcon71.seq - Constructed sequence entries, part 71.
283. gbcon72.seq - Constructed sequence entries, part 72.
284. gbcon73.seq - Constructed sequence entries, part 73.
285. gbcon74.seq - Constructed sequence entries, part 74.
286. gbcon75.seq - Constructed sequence entries, part 75.
287. gbcon76.seq - Constructed sequence entries, part 76.
288. gbcon77.seq - Constructed sequence entries, part 77.
289. gbcon78.seq - Constructed sequence entries, part 78.
290. gbcon79.seq - Constructed sequence entries, part 79.
291. gbcon8.seq - Constructed sequence entries, part 8.
292. gbcon80.seq - Constructed sequence entries, part 80.
293. gbcon81.seq - Constructed sequence entries, part 81.
294. gbcon82.seq - Constructed sequence entries, part 82.
295. gbcon83.seq - Constructed sequence entries, part 83.
296. gbcon84.seq - Constructed sequence entries, part 84.
297. gbcon85.seq - Constructed sequence entries, part 85.
298. gbcon86.seq - Constructed sequence entries, part 86.
299. gbcon87.seq - Constructed sequence entries, part 87.
300. gbcon88.seq - Constructed sequence entries, part 88.
301. gbcon89.seq - Constructed sequence entries, part 89.
302. gbcon9.seq - Constructed sequence entries, part 9.
303. gbcon90.seq - Constructed sequence entries, part 90.
304. gbcon91.seq - Constructed sequence entries, part 91.
305. gbcon92.seq - Constructed sequence entries, part 92.
306. gbcon93.seq - Constructed sequence entries, part 93.
307. gbcon94.seq - Constructed sequence entries, part 94.
308. gbcon95.seq - Constructed sequence entries, part 95.
309. gbcon96.seq - Constructed sequence entries, part 96.
310. gbcon97.seq - Constructed sequence entries, part 97.
311. gbcon98.seq - Constructed sequence entries, part 98.
312. gbcon99.seq - Constructed sequence entries, part 99.
313. gbdel.txt - Accession numbers of entries deleted since the previous release.
314. gbenv1.seq - Environmental sampling sequence entries, part 1.
315. gbenv10.seq - Environmental sampling sequence entries, part 10.
316. gbenv11.seq - Environmental sampling sequence entries, part 11.
317. gbenv12.seq - Environmental sampling sequence entries, part 12.
318. gbenv13.seq - Environmental sampling sequence entries, part 13.
319. gbenv14.seq - Environmental sampling sequence entries, part 14.
320. gbenv15.seq - Environmental sampling sequence entries, part 15.
321. gbenv16.seq - Environmental sampling sequence entries, part 16.
322. gbenv17.seq - Environmental sampling sequence entries, part 17.
323. gbenv18.seq - Environmental sampling sequence entries, part 18.
324. gbenv19.seq - Environmental sampling sequence entries, part 19.
325. gbenv2.seq - Environmental sampling sequence entries, part 2.
326. gbenv20.seq - Environmental sampling sequence entries, part 20.
327. gbenv21.seq - Environmental sampling sequence entries, part 21.
328. gbenv22.seq - Environmental sampling sequence entries, part 22.
329. gbenv23.seq - Environmental sampling sequence entries, part 23.
330. gbenv24.seq - Environmental sampling sequence entries, part 24.
331. gbenv25.seq - Environmental sampling sequence entries, part 25.
332. gbenv26.seq - Environmental sampling sequence entries, part 26.
333. gbenv27.seq - Environmental sampling sequence entries, part 27.
334. gbenv28.seq - Environmental sampling sequence entries, part 28.
335. gbenv29.seq - Environmental sampling sequence entries, part 29.
336. gbenv3.seq - Environmental sampling sequence entries, part 3.
337. gbenv30.seq - Environmental sampling sequence entries, part 30.
338. gbenv31.seq - Environmental sampling sequence entries, part 31.
339. gbenv32.seq - Environmental sampling sequence entries, part 32.
340. gbenv33.seq - Environmental sampling sequence entries, part 33.
341. gbenv34.seq - Environmental sampling sequence entries, part 34.
342. gbenv35.seq - Environmental sampling sequence entries, part 35.
343. gbenv36.seq - Environmental sampling sequence entries, part 36.
344. gbenv37.seq - Environmental sampling sequence entries, part 37.
345. gbenv38.seq - Environmental sampling sequence entries, part 38.
346. gbenv39.seq - Environmental sampling sequence entries, part 39.
347. gbenv4.seq - Environmental sampling sequence entries, part 4.
348. gbenv40.seq - Environmental sampling sequence entries, part 40.
349. gbenv5.seq - Environmental sampling sequence entries, part 5.
350. gbenv6.seq - Environmental sampling sequence entries, part 6.
351. gbenv7.seq - Environmental sampling sequence entries, part 7.
352. gbenv8.seq - Environmental sampling sequence entries, part 8.
353. gbenv9.seq - Environmental sampling sequence entries, part 9.
354. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
355. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
356. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
357. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
358. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
359. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
360. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
361. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
362. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
363. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
364. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
365. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
366. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
367. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
368. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
369. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
370. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
371. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
372. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
373. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
374. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
375. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
376. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
377. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
378. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
379. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
380. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
381. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
382. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
383. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
384. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
385. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
386. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
387. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
388. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
389. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
390. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
391. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
392. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
393. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
394. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
395. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
396. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
397. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
398. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
399. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
400. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
401. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
402. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
403. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
404. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
405. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
406. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
407. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
408. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
409. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
410. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
411. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
412. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
413. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
414. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
415. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
416. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
417. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
418. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
419. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
420. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
421. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
422. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
423. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
424. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
425. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
426. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
427. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
428. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
429. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
430. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
431. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
432. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
433. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
434. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
435. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
436. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
437. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
438. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
439. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
440. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
441. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
442. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
443. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
444. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
445. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
446. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
447. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
448. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
449. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
450. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
451. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
452. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
453. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
454. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
455. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
456. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
457. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
458. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
459. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
460. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
461. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
462. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
463. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
464. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
465. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
466. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
467. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
468. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
469. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
470. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
471. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
472. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
473. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
474. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
475. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
476. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
477. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
478. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
479. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
480. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
481. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
482. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
483. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
484. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
485. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
486. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
487. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
488. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
489. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
490. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
491. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
492. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
493. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
494. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
495. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
496. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
497. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
498. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
499. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
500. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
501. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
502. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
503. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
504. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
505. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
506. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
507. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
508. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
509. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
510. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
511. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
512. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
513. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
514. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
515. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
516. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
517. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
518. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
519. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
520. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
521. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
522. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
523. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
524. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
525. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
526. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
527. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
528. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
529. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
530. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
531. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
532. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
533. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
534. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
535. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
536. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
537. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
538. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
539. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
540. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
541. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
542. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
543. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
544. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
545. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
546. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
547. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
548. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
549. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
550. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
551. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
552. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
553. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
554. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
555. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
556. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
557. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
558. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
559. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
560. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
561. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
562. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
563. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
564. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
565. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
566. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
567. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
568. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
569. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
570. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
571. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
572. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
573. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
574. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
575. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
576. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
577. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
578. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
579. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
580. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
581. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
582. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
583. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
584. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
585. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
586. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
587. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
588. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
589. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
590. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
591. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
592. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
593. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
594. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
595. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
596. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
597. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
598. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
599. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
600. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
601. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
602. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
603. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
604. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
605. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
606. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
607. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
608. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
609. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
610. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
611. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
612. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
613. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
614. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
615. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
616. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
617. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
618. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
619. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
620. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
621. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
622. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
623. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
624. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
625. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
626. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
627. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
628. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
629. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
630. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
631. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
632. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
633. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
634. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
635. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
636. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
637. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
638. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
639. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
640. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
641. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
642. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
643. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
644. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
645. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
646. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
647. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
648. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
649. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
650. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
651. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
652. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
653. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
654. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
655. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
656. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
657. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
658. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
659. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
660. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
661. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
662. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
663. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
664. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
665. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
666. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
667. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
668. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
669. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
670. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
671. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
672. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
673. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
674. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
675. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
676. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
677. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
678. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
679. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
680. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
681. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
682. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
683. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
684. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
685. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
686. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
687. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
688. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
689. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
690. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
691. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
692. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
693. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
694. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
695. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
696. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
697. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
698. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
699. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
700. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
701. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
702. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
703. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
704. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
705. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
706. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
707. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
708. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
709. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
710. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
711. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
712. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
713. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
714. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
715. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
716. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
717. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
718. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
719. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
720. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
721. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
722. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
723. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
724. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
725. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
726. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
727. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
728. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
729. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
730. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
731. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
732. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
733. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
734. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
735. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
736. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
737. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
738. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
739. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
740. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
741. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
742. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
743. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
744. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
745. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
746. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
747. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
748. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
749. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
750. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
751. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
752. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
753. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
754. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
755. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
756. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
757. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
758. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
759. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
760. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
761. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
762. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
763. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
764. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
765. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
766. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
767. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
768. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
769. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
770. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
771. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
772. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
773. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
774. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
775. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
776. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
777. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
778. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
779. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
780. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
781. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
782. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
783. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
784. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
785. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
786. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
787. gbgen.idx - Index of the entries according to gene symbols.
788. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
789. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
790. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
791. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
792. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
793. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
794. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
795. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
796. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
797. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
798. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
799. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
800. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
801. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
802. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
803. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
804. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
805. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
806. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
807. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
808. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
809. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
810. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
811. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
812. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
813. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
814. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
815. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
816. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
817. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
818. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
819. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
820. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
821. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
822. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
823. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
824. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
825. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
826. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
827. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
828. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
829. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
830. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
831. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
832. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
833. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
834. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
835. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
836. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
837. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
838. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
839. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
840. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
841. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
842. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
843. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
844. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
845. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
846. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
847. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
848. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
849. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
850. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
851. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
852. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
853. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
854. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
855. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
856. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
857. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
858. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
859. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
860. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
861. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
862. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
863. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
864. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
865. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
866. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
867. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
868. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
869. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
870. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
871. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
872. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
873. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
874. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
875. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
876. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
877. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
878. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
879. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
880. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
881. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
882. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
883. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
884. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
885. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
886. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
887. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
888. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
889. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
890. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
891. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
892. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
893. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
894. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
895. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
896. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
897. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
898. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
899. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
900. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
901. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
902. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
903. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
904. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
905. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
906. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
907. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
908. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
909. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
910. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
911. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
912. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
913. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
914. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
915. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
916. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
917. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
918. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
919. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
920. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
921. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
922. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
923. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
924. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
925. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
926. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
927. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
928. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
929. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
930. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
931. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
932. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
933. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
934. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
935. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
936. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
937. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
938. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
939. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
940. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
941. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
942. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
943. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
944. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
945. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
946. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
947. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
948. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
949. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
950. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
951. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
952. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
953. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
954. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
955. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
956. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
957. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
958. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
959. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
960. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
961. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
962. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
963. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
964. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
965. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
966. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
967. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
968. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
969. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
970. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
971. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
972. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
973. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
974. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
975. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
976. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
977. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
978. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
979. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
980. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
981. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
982. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
983. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
984. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
985. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
986. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
987. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
988. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
989. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
990. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
991. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
992. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
993. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
994. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
995. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
996. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
997. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
998. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
999. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1000. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1001. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1002. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1003. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1004. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1005. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1006. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1007. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1008. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1009. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1010. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1011. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1012. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1013. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1014. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1015. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1016. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1017. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1018. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1019. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1020. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1021. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1022. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1023. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1024. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1025. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1026. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1027. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1028. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1029. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1030. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1031. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1032. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1033. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1034. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1035. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1036. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1037. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1038. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1039. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1040. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1041. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1042. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1043. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1044. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1045. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1046. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1047. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1048. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1049. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1050. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1051. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1052. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1053. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1054. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1055. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1056. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1057. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1058. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1059. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1060. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1061. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1062. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1063. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1064. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1065. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1066. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1067. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1068. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1069. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1070. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1071. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1072. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1073. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1074. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1075. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1076. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1077. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1078. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1079. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1080. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1081. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1082. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1083. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1084. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1085. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1086. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1087. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1088. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1089. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1090. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1091. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1092. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1093. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1094. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1095. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1096. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1097. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1098. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1099. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1100. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1101. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1102. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1103. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1104. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1105. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1106. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1107. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1108. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1109. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1110. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1111. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1112. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1113. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1114. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1115. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1116. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1117. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1118. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1119. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1120. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1121. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1122. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1123. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1124. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1125. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1126. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1127. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1128. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1129. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1130. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1131. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1132. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1133. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1134. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1135. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1136. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1137. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1138. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1139. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1140. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1141. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1142. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1143. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1144. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1145. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1146. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1147. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1148. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1149. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1150. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1151. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1152. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1153. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1154. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1155. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1156. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1157. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1158. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1159. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1160. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1161. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1162. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1163. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1164. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1165. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1166. gbinv1.seq - Invertebrate sequence entries, part 1.
1167. gbinv10.seq - Invertebrate sequence entries, part 10.
1168. gbinv11.seq - Invertebrate sequence entries, part 11.
1169. gbinv12.seq - Invertebrate sequence entries, part 12.
1170. gbinv13.seq - Invertebrate sequence entries, part 13.
1171. gbinv14.seq - Invertebrate sequence entries, part 14.
1172. gbinv15.seq - Invertebrate sequence entries, part 15.
1173. gbinv16.seq - Invertebrate sequence entries, part 16.
1174. gbinv17.seq - Invertebrate sequence entries, part 17.
1175. gbinv18.seq - Invertebrate sequence entries, part 18.
1176. gbinv19.seq - Invertebrate sequence entries, part 19.
1177. gbinv2.seq - Invertebrate sequence entries, part 2.
1178. gbinv20.seq - Invertebrate sequence entries, part 20.
1179. gbinv21.seq - Invertebrate sequence entries, part 21.
1180. gbinv22.seq - Invertebrate sequence entries, part 22.
1181. gbinv23.seq - Invertebrate sequence entries, part 23.
1182. gbinv24.seq - Invertebrate sequence entries, part 24.
1183. gbinv25.seq - Invertebrate sequence entries, part 25.
1184. gbinv26.seq - Invertebrate sequence entries, part 26.
1185. gbinv3.seq - Invertebrate sequence entries, part 3.
1186. gbinv4.seq - Invertebrate sequence entries, part 4.
1187. gbinv5.seq - Invertebrate sequence entries, part 5.
1188. gbinv6.seq - Invertebrate sequence entries, part 6.
1189. gbinv7.seq - Invertebrate sequence entries, part 7.
1190. gbinv8.seq - Invertebrate sequence entries, part 8.
1191. gbinv9.seq - Invertebrate sequence entries, part 9.
1192. gbjou1.idx - Index of the entries according to journal citation, part 1.
1193. gbjou10.idx - Index of the entries according to journal citation, part 10.
1194. gbjou2.idx - Index of the entries according to journal citation, part 2.
1195. gbjou3.idx - Index of the entries according to journal citation, part 3.
1196. gbjou4.idx - Index of the entries according to journal citation, part 4.
1197. gbjou5.idx - Index of the entries according to journal citation, part 5.
1198. gbjou6.idx - Index of the entries according to journal citation, part 6.
1199. gbjou7.idx - Index of the entries according to journal citation, part 7.
1200. gbjou8.idx - Index of the entries according to journal citation, part 8.
1201. gbjou9.idx - Index of the entries according to journal citation, part 9.
1202. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1203. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1204. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1205. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1206. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1207. gbmam1.seq - Other mammalian sequence entries, part 1.
1208. gbmam2.seq - Other mammalian sequence entries, part 2.
1209. gbmam3.seq - Other mammalian sequence entries, part 3.
1210. gbmam4.seq - Other mammalian sequence entries, part 4.
1211. gbmam5.seq - Other mammalian sequence entries, part 5.
1212. gbmam6.seq - Other mammalian sequence entries, part 6.
1213. gbmam7.seq - Other mammalian sequence entries, part 7.
1214. gbnew.txt - Accession numbers of entries new since the previous release.
1215. gbpat1.seq - Patent sequence entries, part 1.
1216. gbpat10.seq - Patent sequence entries, part 10.
1217. gbpat100.seq - Patent sequence entries, part 100.
1218. gbpat101.seq - Patent sequence entries, part 101.
1219. gbpat102.seq - Patent sequence entries, part 102.
1220. gbpat103.seq - Patent sequence entries, part 103.
1221. gbpat104.seq - Patent sequence entries, part 104.
1222. gbpat105.seq - Patent sequence entries, part 105.
1223. gbpat106.seq - Patent sequence entries, part 106.
1224. gbpat107.seq - Patent sequence entries, part 107.
1225. gbpat108.seq - Patent sequence entries, part 108.
1226. gbpat109.seq - Patent sequence entries, part 109.
1227. gbpat11.seq - Patent sequence entries, part 11.
1228. gbpat110.seq - Patent sequence entries, part 110.
1229. gbpat111.seq - Patent sequence entries, part 111.
1230. gbpat112.seq - Patent sequence entries, part 112.
1231. gbpat113.seq - Patent sequence entries, part 113.
1232. gbpat114.seq - Patent sequence entries, part 114.
1233. gbpat115.seq - Patent sequence entries, part 115.
1234. gbpat116.seq - Patent sequence entries, part 116.
1235. gbpat117.seq - Patent sequence entries, part 117.
1236. gbpat118.seq - Patent sequence entries, part 118.
1237. gbpat119.seq - Patent sequence entries, part 119.
1238. gbpat12.seq - Patent sequence entries, part 12.
1239. gbpat120.seq - Patent sequence entries, part 120.
1240. gbpat121.seq - Patent sequence entries, part 121.
1241. gbpat122.seq - Patent sequence entries, part 122.
1242. gbpat123.seq - Patent sequence entries, part 123.
1243. gbpat124.seq - Patent sequence entries, part 124.
1244. gbpat125.seq - Patent sequence entries, part 125.
1245. gbpat126.seq - Patent sequence entries, part 126.
1246. gbpat127.seq - Patent sequence entries, part 127.
1247. gbpat128.seq - Patent sequence entries, part 128.
1248. gbpat129.seq - Patent sequence entries, part 129.
1249. gbpat13.seq - Patent sequence entries, part 13.
1250. gbpat130.seq - Patent sequence entries, part 130.
1251. gbpat131.seq - Patent sequence entries, part 131.
1252. gbpat132.seq - Patent sequence entries, part 132.
1253. gbpat133.seq - Patent sequence entries, part 133.
1254. gbpat134.seq - Patent sequence entries, part 134.
1255. gbpat135.seq - Patent sequence entries, part 135.
1256. gbpat136.seq - Patent sequence entries, part 136.
1257. gbpat137.seq - Patent sequence entries, part 137.
1258. gbpat138.seq - Patent sequence entries, part 138.
1259. gbpat139.seq - Patent sequence entries, part 139.
1260. gbpat14.seq - Patent sequence entries, part 14.
1261. gbpat140.seq - Patent sequence entries, part 140.
1262. gbpat15.seq - Patent sequence entries, part 15.
1263. gbpat16.seq - Patent sequence entries, part 16.
1264. gbpat17.seq - Patent sequence entries, part 17.
1265. gbpat18.seq - Patent sequence entries, part 18.
1266. gbpat19.seq - Patent sequence entries, part 19.
1267. gbpat2.seq - Patent sequence entries, part 2.
1268. gbpat20.seq - Patent sequence entries, part 20.
1269. gbpat21.seq - Patent sequence entries, part 21.
1270. gbpat22.seq - Patent sequence entries, part 22.
1271. gbpat23.seq - Patent sequence entries, part 23.
1272. gbpat24.seq - Patent sequence entries, part 24.
1273. gbpat25.seq - Patent sequence entries, part 25.
1274. gbpat26.seq - Patent sequence entries, part 26.
1275. gbpat27.seq - Patent sequence entries, part 27.
1276. gbpat28.seq - Patent sequence entries, part 28.
1277. gbpat29.seq - Patent sequence entries, part 29.
1278. gbpat3.seq - Patent sequence entries, part 3.
1279. gbpat30.seq - Patent sequence entries, part 30.
1280. gbpat31.seq - Patent sequence entries, part 31.
1281. gbpat32.seq - Patent sequence entries, part 32.
1282. gbpat33.seq - Patent sequence entries, part 33.
1283. gbpat34.seq - Patent sequence entries, part 34.
1284. gbpat35.seq - Patent sequence entries, part 35.
1285. gbpat36.seq - Patent sequence entries, part 36.
1286. gbpat37.seq - Patent sequence entries, part 37.
1287. gbpat38.seq - Patent sequence entries, part 38.
1288. gbpat39.seq - Patent sequence entries, part 39.
1289. gbpat4.seq - Patent sequence entries, part 4.
1290. gbpat40.seq - Patent sequence entries, part 40.
1291. gbpat41.seq - Patent sequence entries, part 41.
1292. gbpat42.seq - Patent sequence entries, part 42.
1293. gbpat43.seq - Patent sequence entries, part 43.
1294. gbpat44.seq - Patent sequence entries, part 44.
1295. gbpat45.seq - Patent sequence entries, part 45.
1296. gbpat46.seq - Patent sequence entries, part 46.
1297. gbpat47.seq - Patent sequence entries, part 47.
1298. gbpat48.seq - Patent sequence entries, part 48.
1299. gbpat49.seq - Patent sequence entries, part 49.
1300. gbpat5.seq - Patent sequence entries, part 5.
1301. gbpat50.seq - Patent sequence entries, part 50.
1302. gbpat51.seq - Patent sequence entries, part 51.
1303. gbpat52.seq - Patent sequence entries, part 52.
1304. gbpat53.seq - Patent sequence entries, part 53.
1305. gbpat54.seq - Patent sequence entries, part 54.
1306. gbpat55.seq - Patent sequence entries, part 55.
1307. gbpat56.seq - Patent sequence entries, part 56.
1308. gbpat57.seq - Patent sequence entries, part 57.
1309. gbpat58.seq - Patent sequence entries, part 58.
1310. gbpat59.seq - Patent sequence entries, part 59.
1311. gbpat6.seq - Patent sequence entries, part 6.
1312. gbpat60.seq - Patent sequence entries, part 60.
1313. gbpat61.seq - Patent sequence entries, part 61.
1314. gbpat62.seq - Patent sequence entries, part 62.
1315. gbpat63.seq - Patent sequence entries, part 63.
1316. gbpat64.seq - Patent sequence entries, part 64.
1317. gbpat65.seq - Patent sequence entries, part 65.
1318. gbpat66.seq - Patent sequence entries, part 66.
1319. gbpat67.seq - Patent sequence entries, part 67.
1320. gbpat68.seq - Patent sequence entries, part 68.
1321. gbpat69.seq - Patent sequence entries, part 69.
1322. gbpat7.seq - Patent sequence entries, part 7.
1323. gbpat70.seq - Patent sequence entries, part 70.
1324. gbpat71.seq - Patent sequence entries, part 71.
1325. gbpat72.seq - Patent sequence entries, part 72.
1326. gbpat73.seq - Patent sequence entries, part 73.
1327. gbpat74.seq - Patent sequence entries, part 74.
1328. gbpat75.seq - Patent sequence entries, part 75.
1329. gbpat76.seq - Patent sequence entries, part 76.
1330. gbpat77.seq - Patent sequence entries, part 77.
1331. gbpat78.seq - Patent sequence entries, part 78.
1332. gbpat79.seq - Patent sequence entries, part 79.
1333. gbpat8.seq - Patent sequence entries, part 8.
1334. gbpat80.seq - Patent sequence entries, part 80.
1335. gbpat81.seq - Patent sequence entries, part 81.
1336. gbpat82.seq - Patent sequence entries, part 82.
1337. gbpat83.seq - Patent sequence entries, part 83.
1338. gbpat84.seq - Patent sequence entries, part 84.
1339. gbpat85.seq - Patent sequence entries, part 85.
1340. gbpat86.seq - Patent sequence entries, part 86.
1341. gbpat87.seq - Patent sequence entries, part 87.
1342. gbpat88.seq - Patent sequence entries, part 88.
1343. gbpat89.seq - Patent sequence entries, part 89.
1344. gbpat9.seq - Patent sequence entries, part 9.
1345. gbpat90.seq - Patent sequence entries, part 90.
1346. gbpat91.seq - Patent sequence entries, part 91.
1347. gbpat92.seq - Patent sequence entries, part 92.
1348. gbpat93.seq - Patent sequence entries, part 93.
1349. gbpat94.seq - Patent sequence entries, part 94.
1350. gbpat95.seq - Patent sequence entries, part 95.
1351. gbpat96.seq - Patent sequence entries, part 96.
1352. gbpat97.seq - Patent sequence entries, part 97.
1353. gbpat98.seq - Patent sequence entries, part 98.
1354. gbpat99.seq - Patent sequence entries, part 99.
1355. gbphg1.seq - Phage sequence entries, part 1.
1356. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1357. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1358. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1359. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1360. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1361. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1362. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1363. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1364. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1365. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1366. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1367. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1368. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1369. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1370. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1371. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1372. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1373. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1374. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1375. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1376. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1377. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1378. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1379. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1380. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1381. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1382. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1383. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1384. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1385. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1386. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1387. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1388. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1389. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1390. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1391. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1392. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1393. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1394. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1395. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1396. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1397. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1398. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1399. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1400. gbpri1.seq - Primate sequence entries, part 1.
1401. gbpri10.seq - Primate sequence entries, part 10.
1402. gbpri11.seq - Primate sequence entries, part 11.
1403. gbpri12.seq - Primate sequence entries, part 12.
1404. gbpri13.seq - Primate sequence entries, part 13.
1405. gbpri14.seq - Primate sequence entries, part 14.
1406. gbpri15.seq - Primate sequence entries, part 15.
1407. gbpri16.seq - Primate sequence entries, part 16.
1408. gbpri17.seq - Primate sequence entries, part 17.
1409. gbpri18.seq - Primate sequence entries, part 18.
1410. gbpri19.seq - Primate sequence entries, part 19.
1411. gbpri2.seq - Primate sequence entries, part 2.
1412. gbpri20.seq - Primate sequence entries, part 20.
1413. gbpri21.seq - Primate sequence entries, part 21.
1414. gbpri22.seq - Primate sequence entries, part 22.
1415. gbpri23.seq - Primate sequence entries, part 23.
1416. gbpri24.seq - Primate sequence entries, part 24.
1417. gbpri25.seq - Primate sequence entries, part 25.
1418. gbpri26.seq - Primate sequence entries, part 26.
1419. gbpri27.seq - Primate sequence entries, part 27.
1420. gbpri28.seq - Primate sequence entries, part 28.
1421. gbpri29.seq - Primate sequence entries, part 29.
1422. gbpri3.seq - Primate sequence entries, part 3.
1423. gbpri30.seq - Primate sequence entries, part 30.
1424. gbpri31.seq - Primate sequence entries, part 31.
1425. gbpri32.seq - Primate sequence entries, part 32.
1426. gbpri33.seq - Primate sequence entries, part 33.
1427. gbpri34.seq - Primate sequence entries, part 34.
1428. gbpri35.seq - Primate sequence entries, part 35.
1429. gbpri36.seq - Primate sequence entries, part 36.
1430. gbpri37.seq - Primate sequence entries, part 37.
1431. gbpri38.seq - Primate sequence entries, part 38.
1432. gbpri39.seq - Primate sequence entries, part 39.
1433. gbpri4.seq - Primate sequence entries, part 4.
1434. gbpri40.seq - Primate sequence entries, part 40.
1435. gbpri41.seq - Primate sequence entries, part 41.
1436. gbpri42.seq - Primate sequence entries, part 42.
1437. gbpri5.seq - Primate sequence entries, part 5.
1438. gbpri6.seq - Primate sequence entries, part 6.
1439. gbpri7.seq - Primate sequence entries, part 7.
1440. gbpri8.seq - Primate sequence entries, part 8.
1441. gbpri9.seq - Primate sequence entries, part 9.
1442. gbrel.txt - Release notes (this document).
1443. gbrod1.seq - Rodent sequence entries, part 1.
1444. gbrod10.seq - Rodent sequence entries, part 10.
1445. gbrod11.seq - Rodent sequence entries, part 11.
1446. gbrod12.seq - Rodent sequence entries, part 12.
1447. gbrod13.seq - Rodent sequence entries, part 13.
1448. gbrod14.seq - Rodent sequence entries, part 14.
1449. gbrod15.seq - Rodent sequence entries, part 15.
1450. gbrod16.seq - Rodent sequence entries, part 16.
1451. gbrod17.seq - Rodent sequence entries, part 17.
1452. gbrod18.seq - Rodent sequence entries, part 18.
1453. gbrod19.seq - Rodent sequence entries, part 19.
1454. gbrod2.seq - Rodent sequence entries, part 2.
1455. gbrod20.seq - Rodent sequence entries, part 20.
1456. gbrod21.seq - Rodent sequence entries, part 21.
1457. gbrod22.seq - Rodent sequence entries, part 22.
1458. gbrod23.seq - Rodent sequence entries, part 23.
1459. gbrod24.seq - Rodent sequence entries, part 24.
1460. gbrod25.seq - Rodent sequence entries, part 25.
1461. gbrod26.seq - Rodent sequence entries, part 26.
1462. gbrod27.seq - Rodent sequence entries, part 27.
1463. gbrod28.seq - Rodent sequence entries, part 28.
1464. gbrod29.seq - Rodent sequence entries, part 29.
1465. gbrod3.seq - Rodent sequence entries, part 3.
1466. gbrod4.seq - Rodent sequence entries, part 4.
1467. gbrod5.seq - Rodent sequence entries, part 5.
1468. gbrod6.seq - Rodent sequence entries, part 6.
1469. gbrod7.seq - Rodent sequence entries, part 7.
1470. gbrod8.seq - Rodent sequence entries, part 8.
1471. gbrod9.seq - Rodent sequence entries, part 9.
1472. gbsdr1.txt - Short directory of the data bank, part 1.
1473. gbsdr2.txt - Short directory of the data bank, part 2.
1474. gbsdr3.txt - Short directory of the data bank, part 3.
1475. gbsec.idx - Index of the entries according to secondary accession number.
1476. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1477. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1478. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1479. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1480. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1481. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1482. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1483. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1484. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1485. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1486. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1487. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1488. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1489. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1490. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1491. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1492. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1493. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1494. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1495. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1496. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1497. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1498. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1499. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1500. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1501. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1502. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1503. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1504. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1505. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1506. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1507. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1508. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1509. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1510. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1511. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1512. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1513. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1514. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1515. gbuna1.seq - Unannotated sequence entries, part 1.
1516. gbvrl1.seq - Viral sequence entries, part 1.
1517. gbvrl10.seq - Viral sequence entries, part 10.
1518. gbvrl11.seq - Viral sequence entries, part 11.
1519. gbvrl12.seq - Viral sequence entries, part 12.
1520. gbvrl13.seq - Viral sequence entries, part 13.
1521. gbvrl14.seq - Viral sequence entries, part 14.
1522. gbvrl15.seq - Viral sequence entries, part 15.
1523. gbvrl16.seq - Viral sequence entries, part 16.
1524. gbvrl2.seq - Viral sequence entries, part 2.
1525. gbvrl3.seq - Viral sequence entries, part 3.
1526. gbvrl4.seq - Viral sequence entries, part 4.
1527. gbvrl5.seq - Viral sequence entries, part 5.
1528. gbvrl6.seq - Viral sequence entries, part 6.
1529. gbvrl7.seq - Viral sequence entries, part 7.
1530. gbvrl8.seq - Viral sequence entries, part 8.
1531. gbvrl9.seq - Viral sequence entries, part 9.
1532. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1533. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1534. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1535. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1536. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1537. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1538. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1539. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1540. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1541. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1542. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1543. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1544. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1545. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1546. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1547. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1548. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1549. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1550. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1551. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1552. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1553. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 182.0 flatfiles require roughly 479 GB (sequence
files only) or 517 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1556439450 gbacc1.idx
2263544415 gbacc2.idx
743472318 gbacc3.idx
184666863 gbaut1.idx
185057741 gbaut10.idx
185830401 gbaut11.idx
183907100 gbaut12.idx
241103184 gbaut13.idx
185197457 gbaut14.idx
185795066 gbaut15.idx
184883463 gbaut16.idx
184041609 gbaut17.idx
186326979 gbaut18.idx
193625288 gbaut19.idx
227361695 gbaut2.idx
184028954 gbaut20.idx
185073501 gbaut21.idx
187974502 gbaut22.idx
186898901 gbaut23.idx
184453557 gbaut24.idx
231208367 gbaut25.idx
186391756 gbaut26.idx
185214618 gbaut27.idx
183738484 gbaut28.idx
185918668 gbaut29.idx
191251840 gbaut3.idx
184018841 gbaut30.idx
245177716 gbaut31.idx
184406061 gbaut32.idx
186473759 gbaut33.idx
188648504 gbaut34.idx
184025968 gbaut35.idx
184377448 gbaut36.idx
226381465 gbaut37.idx
186544530 gbaut38.idx
223784281 gbaut39.idx
184072243 gbaut4.idx
189479806 gbaut40.idx
183838476 gbaut41.idx
184039817 gbaut42.idx
193008498 gbaut43.idx
183838113 gbaut44.idx
184339533 gbaut45.idx
241619040 gbaut46.idx
215330238 gbaut47.idx
183927386 gbaut48.idx
186347852 gbaut49.idx
213860931 gbaut5.idx
183828912 gbaut50.idx
185271301 gbaut51.idx
187091132 gbaut52.idx
184355682 gbaut53.idx
183676359 gbaut54.idx
189821806 gbaut55.idx
186292827 gbaut56.idx
207529706 gbaut57.idx
202599544 gbaut58.idx
183871930 gbaut59.idx
190213988 gbaut6.idx
184490741 gbaut60.idx
185081026 gbaut61.idx
189981062 gbaut62.idx
184256992 gbaut63.idx
253384044 gbaut64.idx
186427177 gbaut65.idx
184005750 gbaut66.idx
184411453 gbaut67.idx
184644023 gbaut68.idx
184968179 gbaut69.idx
188371618 gbaut7.idx
187347178 gbaut70.idx
183812301 gbaut71.idx
184960424 gbaut72.idx
185931161 gbaut73.idx
185439860 gbaut74.idx
203272165 gbaut75.idx
190383137 gbaut76.idx
184108701 gbaut77.idx
184076201 gbaut78.idx
184308135 gbaut79.idx
195369262 gbaut8.idx
184430929 gbaut80.idx
183884064 gbaut81.idx
186981804 gbaut82.idx
183960344 gbaut83.idx
225435427 gbaut84.idx
184213244 gbaut85.idx
183890428 gbaut86.idx
189051932 gbaut87.idx
189242710 gbaut88.idx
245121413 gbaut89.idx
238905766 gbaut9.idx
184134597 gbaut90.idx
190588772 gbaut91.idx
210853725 gbaut92.idx
185632299 gbaut93.idx
194910472 gbaut94.idx
3399415 gbaut95.idx
249116849 gbbct1.seq
249591213 gbbct10.seq
245138779 gbbct11.seq
148593999 gbbct12.seq
242955296 gbbct13.seq
249814797 gbbct14.seq
245439232 gbbct15.seq
248609047 gbbct16.seq
248217037 gbbct17.seq
245910054 gbbct18.seq
237872377 gbbct19.seq
246421868 gbbct2.seq
239625282 gbbct20.seq
217775461 gbbct21.seq
242724507 gbbct22.seq
241431048 gbbct23.seq
248624064 gbbct24.seq
247824208 gbbct25.seq
249350022 gbbct26.seq
244148846 gbbct27.seq
247096106 gbbct28.seq
249960605 gbbct29.seq
236027779 gbbct3.seq
249719096 gbbct30.seq
249795352 gbbct31.seq
242897885 gbbct32.seq
249121782 gbbct33.seq
142296675 gbbct34.seq
243836717 gbbct35.seq
246067142 gbbct36.seq
243600539 gbbct37.seq
249570521 gbbct38.seq
249103704 gbbct39.seq
249998093 gbbct4.seq
246433981 gbbct40.seq
242190413 gbbct41.seq
244000592 gbbct42.seq
248678507 gbbct43.seq
246123096 gbbct44.seq
167806217 gbbct45.seq
243651378 gbbct46.seq
247300295 gbbct47.seq
242367167 gbbct48.seq
239567682 gbbct49.seq
165758270 gbbct5.seq
137786052 gbbct50.seq
6880118 gbbct51.seq
14080966 gbbct52.seq
23154399 gbbct53.seq
45081957 gbbct54.seq
87716775 gbbct55.seq
169891053 gbbct56.seq
249995701 gbbct57.seq
249798248 gbbct58.seq
245578148 gbbct59.seq
241849893 gbbct6.seq
248404064 gbbct60.seq
245832707 gbbct61.seq
247607635 gbbct62.seq
250000258 gbbct63.seq
249999342 gbbct64.seq
238190545 gbbct65.seq
248846035 gbbct7.seq
248602443 gbbct8.seq
241397946 gbbct9.seq
242357376 gbchg.txt
249999723 gbcon1.seq
249992870 gbcon10.seq
249995445 gbcon100.seq
249996667 gbcon101.seq
249998797 gbcon102.seq
249995641 gbcon103.seq
156127743 gbcon104.seq
249995214 gbcon105.seq
249997693 gbcon106.seq
249998761 gbcon107.seq
249997849 gbcon108.seq
71466271 gbcon109.seq
249993110 gbcon11.seq
249997850 gbcon110.seq
250000112 gbcon111.seq
235562084 gbcon112.seq
250000256 gbcon113.seq
250000098 gbcon114.seq
249995503 gbcon115.seq
249681981 gbcon116.seq
163085195 gbcon117.seq
249752127 gbcon118.seq
249999746 gbcon119.seq
248621114 gbcon12.seq
95643917 gbcon120.seq
249997002 gbcon121.seq
249998975 gbcon122.seq
249999596 gbcon123.seq
249445745 gbcon124.seq
22409822 gbcon125.seq
249960501 gbcon126.seq
249962626 gbcon127.seq
249838400 gbcon128.seq
249999426 gbcon129.seq
247307680 gbcon13.seq
249999644 gbcon130.seq
184590758 gbcon131.seq
249999432 gbcon132.seq
249999914 gbcon133.seq
249799145 gbcon134.seq
249993762 gbcon135.seq
249999846 gbcon136.seq
248313252 gbcon137.seq
249999728 gbcon138.seq
249837837 gbcon139.seq
249998540 gbcon14.seq
103454675 gbcon140.seq
249998022 gbcon141.seq
249899993 gbcon142.seq
249990117 gbcon143.seq
249995965 gbcon144.seq
249995143 gbcon145.seq
249999563 gbcon146.seq
19514928 gbcon147.seq
21455318 gbcon148.seq
22737000 gbcon15.seq
249764369 gbcon16.seq
249996421 gbcon17.seq
151530570 gbcon18.seq
249995534 gbcon19.seq
248189653 gbcon2.seq
248348499 gbcon20.seq
122890034 gbcon21.seq
249999651 gbcon22.seq
120025218 gbcon23.seq
249997576 gbcon24.seq
249924092 gbcon25.seq
249999082 gbcon26.seq
249999373 gbcon27.seq
201173216 gbcon28.seq
249998458 gbcon29.seq
249791108 gbcon3.seq
250000048 gbcon30.seq
249998405 gbcon31.seq
249998852 gbcon32.seq
249977920 gbcon33.seq
209346446 gbcon34.seq
249994638 gbcon35.seq
249994355 gbcon36.seq
249996557 gbcon37.seq
249995872 gbcon38.seq
249998504 gbcon39.seq
249979031 gbcon4.seq
249995403 gbcon40.seq
60977708 gbcon41.seq
249996893 gbcon42.seq
249997617 gbcon43.seq
249994634 gbcon44.seq
249997569 gbcon45.seq
249997343 gbcon46.seq
42909814 gbcon47.seq
249995915 gbcon48.seq
249999280 gbcon49.seq
249997507 gbcon5.seq
249995710 gbcon50.seq
249996631 gbcon51.seq
249995091 gbcon52.seq
36225425 gbcon53.seq
249997103 gbcon54.seq
249996724 gbcon55.seq
249997253 gbcon56.seq
249996527 gbcon57.seq
249999884 gbcon58.seq
152476914 gbcon59.seq
249999187 gbcon6.seq
249996992 gbcon60.seq
249997178 gbcon61.seq
249997201 gbcon62.seq
249996856 gbcon63.seq
183504539 gbcon64.seq
249995931 gbcon65.seq
249997041 gbcon66.seq
249998416 gbcon67.seq
249998317 gbcon68.seq
245375145 gbcon69.seq
249995074 gbcon7.seq
249999551 gbcon70.seq
249998271 gbcon71.seq
249998133 gbcon72.seq
249998704 gbcon73.seq
249997871 gbcon74.seq
96481205 gbcon75.seq
250000212 gbcon76.seq
249996110 gbcon77.seq
249999860 gbcon78.seq
249998416 gbcon79.seq
1584353 gbcon8.seq
250000165 gbcon80.seq
62502628 gbcon81.seq
249999807 gbcon82.seq
249998139 gbcon83.seq
249998956 gbcon84.seq
249995391 gbcon85.seq
249998511 gbcon86.seq
21523692 gbcon87.seq
249996875 gbcon88.seq
249995114 gbcon89.seq
249994769 gbcon9.seq
249996256 gbcon90.seq
249999714 gbcon91.seq
197747900 gbcon92.seq
249995224 gbcon93.seq
249999439 gbcon94.seq
249997468 gbcon95.seq
249999950 gbcon96.seq
249995004 gbcon97.seq
133061783 gbcon98.seq
249998329 gbcon99.seq
157283 gbdel.txt
249999504 gbenv1.seq
250000212 gbenv10.seq
53620865 gbenv11.seq
250000143 gbenv12.seq
250000007 gbenv13.seq
249999336 gbenv14.seq
250000092 gbenv15.seq
249999618 gbenv16.seq
249999398 gbenv17.seq
192920043 gbenv18.seq
249999300 gbenv19.seq
249998391 gbenv2.seq
249998825 gbenv20.seq
249999426 gbenv21.seq
249998585 gbenv22.seq
123686582 gbenv23.seq
249998737 gbenv24.seq
249998416 gbenv25.seq
249999143 gbenv26.seq
249999146 gbenv27.seq
249998758 gbenv28.seq
15212303 gbenv29.seq
248307289 gbenv3.seq
249998069 gbenv30.seq
249996706 gbenv31.seq
249998288 gbenv32.seq
250000007 gbenv33.seq
106364137 gbenv34.seq
249999841 gbenv35.seq
249998040 gbenv36.seq
249999191 gbenv37.seq
249999306 gbenv38.seq
249997993 gbenv39.seq
249999090 gbenv4.seq
101330475 gbenv40.seq
249998825 gbenv5.seq
150047845 gbenv6.seq
249998594 gbenv7.seq
250000078 gbenv8.seq
249997714 gbenv9.seq
524289749 gbest1.seq
524291469 gbest10.seq
524290539 gbest100.seq
524289509 gbest101.seq
524289310 gbest102.seq
524289803 gbest103.seq
254811243 gbest104.seq
524288785 gbest105.seq
524291625 gbest106.seq
486233627 gbest107.seq
386816097 gbest108.seq
386176916 gbest109.seq
524289536 gbest11.seq
381480797 gbest110.seq
382661788 gbest111.seq
382599718 gbest112.seq
380020131 gbest113.seq
390473404 gbest114.seq
386274343 gbest115.seq
384106504 gbest116.seq
382729233 gbest117.seq
411523412 gbest118.seq
524290008 gbest119.seq
524289621 gbest12.seq
524289198 gbest120.seq
524289001 gbest121.seq
524289608 gbest122.seq
524289571 gbest123.seq
390642097 gbest124.seq
524289820 gbest125.seq
524292015 gbest126.seq
524289413 gbest127.seq
524291517 gbest128.seq
524290552 gbest129.seq
46225630 gbest13.seq
524289966 gbest130.seq
524290389 gbest131.seq
524290381 gbest132.seq
524289925 gbest133.seq
524290575 gbest134.seq
524288843 gbest135.seq
524288734 gbest136.seq
172039887 gbest137.seq
524289584 gbest138.seq
524290592 gbest139.seq
524289447 gbest14.seq
524290526 gbest140.seq
524291732 gbest141.seq
524289473 gbest142.seq
524289445 gbest143.seq
524291824 gbest144.seq
524292199 gbest145.seq
524291419 gbest146.seq
524291102 gbest147.seq
524289907 gbest148.seq
524290195 gbest149.seq
524289266 gbest15.seq
524290166 gbest150.seq
376059917 gbest151.seq
524291162 gbest152.seq
524291221 gbest153.seq
524288908 gbest154.seq
524290861 gbest155.seq
524289670 gbest156.seq
524292455 gbest157.seq
524293029 gbest158.seq
524289170 gbest159.seq
524290794 gbest16.seq
467502978 gbest160.seq
524290258 gbest161.seq
524290291 gbest162.seq
524288913 gbest163.seq
175541805 gbest164.seq
524290929 gbest165.seq
524292174 gbest166.seq
524290512 gbest167.seq
524292494 gbest168.seq
524290812 gbest169.seq
524290731 gbest17.seq
524291360 gbest170.seq
524291611 gbest171.seq
524288755 gbest172.seq
524288819 gbest173.seq
524289756 gbest174.seq
524289464 gbest175.seq
524289659 gbest176.seq
522853057 gbest177.seq
524291273 gbest178.seq
524291447 gbest179.seq
524291235 gbest18.seq
524289350 gbest180.seq
524290260 gbest181.seq
524288840 gbest182.seq
524289627 gbest183.seq
524290942 gbest184.seq
524288722 gbest185.seq
524289899 gbest186.seq
524289998 gbest187.seq
524289058 gbest188.seq
524290904 gbest189.seq
524290651 gbest19.seq
355548980 gbest190.seq
524291146 gbest191.seq
524289981 gbest192.seq
524288960 gbest193.seq
524290798 gbest194.seq
524292939 gbest195.seq
524290352 gbest196.seq
524289584 gbest197.seq
524291348 gbest198.seq
524289158 gbest199.seq
524290845 gbest2.seq
524289659 gbest20.seq
524290648 gbest200.seq
524290971 gbest201.seq
524290039 gbest202.seq
519178046 gbest203.seq
524291462 gbest204.seq
524289965 gbest205.seq
524288995 gbest206.seq
524288786 gbest207.seq
524291327 gbest208.seq
524290792 gbest209.seq
524290923 gbest21.seq
524289519 gbest210.seq
524290241 gbest211.seq
524289955 gbest212.seq
524289081 gbest213.seq
326627935 gbest214.seq
524289318 gbest215.seq
524292294 gbest216.seq
524292395 gbest217.seq
524291016 gbest218.seq
524289285 gbest219.seq
474203263 gbest22.seq
524289810 gbest220.seq
524288973 gbest221.seq
524290417 gbest222.seq
524289788 gbest223.seq
524292083 gbest224.seq
524291189 gbest225.seq
524290780 gbest226.seq
524289217 gbest227.seq
273049602 gbest228.seq
524292680 gbest229.seq
506170524 gbest23.seq
524289322 gbest230.seq
524290653 gbest231.seq
524292442 gbest232.seq
524289472 gbest233.seq
524289397 gbest234.seq
524291547 gbest235.seq
524289032 gbest236.seq
524290221 gbest237.seq
524288841 gbest238.seq
524289366 gbest239.seq
524290282 gbest24.seq
524290972 gbest240.seq
524292216 gbest241.seq
467136358 gbest242.seq
524292007 gbest243.seq
524291319 gbest244.seq
524291845 gbest245.seq
524290829 gbest246.seq
524290017 gbest247.seq
524291811 gbest248.seq
524291104 gbest249.seq
201867033 gbest25.seq
524290670 gbest250.seq
524289397 gbest251.seq
524292227 gbest252.seq
524290880 gbest253.seq
137603726 gbest254.seq
524292228 gbest255.seq
524290604 gbest256.seq
524290301 gbest257.seq
524290468 gbest258.seq
524289485 gbest259.seq
524290017 gbest26.seq
524289725 gbest260.seq
524289638 gbest261.seq
524289830 gbest262.seq
524290694 gbest263.seq
524290116 gbest264.seq
185483684 gbest265.seq
524291132 gbest266.seq
524289860 gbest267.seq
524289076 gbest268.seq
524289319 gbest269.seq
524291234 gbest27.seq
524289660 gbest270.seq
524289119 gbest271.seq
524290390 gbest272.seq
524290547 gbest273.seq
524290002 gbest274.seq
524291815 gbest275.seq
524288847 gbest276.seq
145297391 gbest277.seq
524291572 gbest278.seq
524289469 gbest279.seq
524292018 gbest28.seq
524289950 gbest280.seq
524289794 gbest281.seq
524289719 gbest282.seq
524290752 gbest283.seq
524289628 gbest284.seq
524290371 gbest285.seq
524288842 gbest286.seq
524288902 gbest287.seq
524289224 gbest288.seq
120139715 gbest289.seq
524292646 gbest29.seq
524289786 gbest290.seq
524291136 gbest291.seq
524289705 gbest292.seq
524292106 gbest293.seq
524288736 gbest294.seq
524290319 gbest295.seq
524289021 gbest296.seq
524289174 gbest297.seq
477649640 gbest298.seq
481774959 gbest299.seq
506975902 gbest3.seq
524289946 gbest30.seq
481328785 gbest300.seq
215730946 gbest301.seq
524288848 gbest302.seq
524289726 gbest303.seq
524290636 gbest304.seq
524290549 gbest305.seq
524288843 gbest306.seq
524289920 gbest307.seq
524289031 gbest308.seq
524290504 gbest309.seq
524290617 gbest31.seq
524289418 gbest310.seq
524288925 gbest311.seq
524291142 gbest312.seq
524289462 gbest313.seq
392790341 gbest314.seq
524288859 gbest315.seq
524290150 gbest316.seq
524288908 gbest317.seq
524290800 gbest318.seq
524288923 gbest319.seq
524290085 gbest32.seq
524290929 gbest320.seq
524288953 gbest321.seq
524290813 gbest322.seq
524290390 gbest323.seq
524291654 gbest324.seq
524290630 gbest325.seq
524289997 gbest326.seq
524291787 gbest327.seq
158011615 gbest328.seq
524290242 gbest329.seq
524291386 gbest33.seq
524291309 gbest330.seq
524291386 gbest331.seq
524290757 gbest332.seq
524290035 gbest333.seq
524289753 gbest334.seq
524289676 gbest335.seq
524290400 gbest336.seq
524288807 gbest337.seq
524291496 gbest338.seq
524291002 gbest339.seq
498033625 gbest34.seq
524290546 gbest340.seq
524290643 gbest341.seq
102522342 gbest342.seq
524289561 gbest343.seq
524291196 gbest344.seq
524289455 gbest345.seq
524291658 gbest346.seq
524291512 gbest347.seq
524293273 gbest348.seq
524295260 gbest349.seq
490692378 gbest35.seq
524291172 gbest350.seq
524292440 gbest351.seq
524289310 gbest352.seq
524291855 gbest353.seq
524290220 gbest354.seq
524290020 gbest355.seq
386450464 gbest356.seq
524289398 gbest357.seq
524288764 gbest358.seq
524289520 gbest359.seq
493267104 gbest36.seq
524291063 gbest360.seq
524291617 gbest361.seq
524290478 gbest362.seq
524288823 gbest363.seq
524290876 gbest364.seq
524289134 gbest365.seq
524293006 gbest366.seq
438138306 gbest367.seq
524290110 gbest368.seq
524289091 gbest369.seq
491104638 gbest37.seq
469747776 gbest370.seq
524289194 gbest371.seq
524291948 gbest372.seq
524291197 gbest373.seq
524291024 gbest374.seq
524289328 gbest375.seq
524290290 gbest376.seq
524289904 gbest377.seq
449297523 gbest378.seq
524289380 gbest379.seq
485983064 gbest38.seq
524290166 gbest380.seq
524291556 gbest381.seq
524290181 gbest382.seq
524290783 gbest383.seq
524291083 gbest384.seq
524288997 gbest385.seq
524292181 gbest386.seq
524289861 gbest387.seq
524290656 gbest388.seq
524288860 gbest389.seq
495733904 gbest39.seq
524291145 gbest390.seq
430157930 gbest391.seq
524291466 gbest392.seq
524288873 gbest393.seq
524288976 gbest394.seq
524290365 gbest395.seq
524291399 gbest396.seq
524292247 gbest397.seq
524290960 gbest398.seq
524290399 gbest399.seq
524290067 gbest4.seq
38125955 gbest40.seq
524290085 gbest400.seq
524290401 gbest401.seq
524291843 gbest402.seq
524289780 gbest403.seq
434915712 gbest404.seq
524290474 gbest405.seq
524291249 gbest406.seq
524288981 gbest407.seq
524290863 gbest408.seq
524290173 gbest409.seq
524291458 gbest41.seq
524293165 gbest410.seq
524295148 gbest411.seq
524290279 gbest412.seq
524295930 gbest413.seq
524292126 gbest414.seq
524290817 gbest415.seq
524289324 gbest416.seq
524290379 gbest417.seq
353029973 gbest418.seq
524293629 gbest419.seq
524290305 gbest42.seq
524288861 gbest420.seq
524290709 gbest421.seq
524291253 gbest422.seq
524288823 gbest423.seq
524291486 gbest424.seq
524292388 gbest425.seq
524291316 gbest426.seq
524289451 gbest427.seq
524290024 gbest428.seq
524290478 gbest429.seq
524288771 gbest43.seq
524291630 gbest430.seq
63598816 gbest431.seq
524291478 gbest432.seq
46278683 gbest433.seq
524289194 gbest44.seq
524289255 gbest45.seq
524290345 gbest46.seq
524290334 gbest47.seq
524289970 gbest48.seq
524290030 gbest49.seq
524290922 gbest5.seq
524290686 gbest50.seq
524291304 gbest51.seq
524288991 gbest52.seq
524288747 gbest53.seq
172188815 gbest54.seq
524290958 gbest55.seq
524290586 gbest56.seq
524289195 gbest57.seq
524290283 gbest58.seq
524290664 gbest59.seq
524290262 gbest6.seq
524290024 gbest60.seq
524290036 gbest61.seq
524291114 gbest62.seq
524289516 gbest63.seq
524289479 gbest64.seq
524289230 gbest65.seq
524289680 gbest66.seq
365549840 gbest67.seq
524288980 gbest68.seq
524289377 gbest69.seq
524290194 gbest7.seq
524290470 gbest70.seq
524289441 gbest71.seq
524291107 gbest72.seq
524288959 gbest73.seq
524290542 gbest74.seq
524289052 gbest75.seq
524290537 gbest76.seq
524288960 gbest77.seq
524289907 gbest78.seq
524292051 gbest79.seq
524288833 gbest8.seq
103431373 gbest80.seq
524289166 gbest81.seq
524289981 gbest82.seq
524290561 gbest83.seq
524290097 gbest84.seq
524289129 gbest85.seq
524291624 gbest86.seq
524290033 gbest87.seq
524290048 gbest88.seq
524291806 gbest89.seq
524289601 gbest9.seq
524289538 gbest90.seq
524290985 gbest91.seq
347655426 gbest92.seq
524288995 gbest93.seq
524289575 gbest94.seq
524288941 gbest95.seq
524291516 gbest96.seq
524289963 gbest97.seq
524290397 gbest98.seq
524289070 gbest99.seq
156645864 gbgen.idx
524289741 gbgss1.seq
524289918 gbgss10.seq
305402863 gbgss100.seq
524289763 gbgss101.seq
524289105 gbgss102.seq
524289783 gbgss103.seq
524290354 gbgss104.seq
524289487 gbgss105.seq
524290166 gbgss106.seq
524289935 gbgss107.seq
524291173 gbgss108.seq
524288868 gbgss109.seq
524291870 gbgss11.seq
524291270 gbgss110.seq
474454140 gbgss111.seq
524289665 gbgss112.seq
524289067 gbgss113.seq
524289464 gbgss114.seq
524288933 gbgss115.seq
524290285 gbgss116.seq
524289502 gbgss117.seq
524289976 gbgss118.seq
524290927 gbgss119.seq
524290331 gbgss12.seq
524290198 gbgss120.seq
524291725 gbgss121.seq
524290237 gbgss122.seq
524290604 gbgss123.seq
112192948 gbgss124.seq
524288935 gbgss125.seq
524290464 gbgss126.seq
524290482 gbgss127.seq
524290769 gbgss128.seq
524290308 gbgss129.seq
524290202 gbgss13.seq
524289229 gbgss130.seq
524289228 gbgss131.seq
40651663 gbgss132.seq
249998232 gbgss133.seq
249999841 gbgss134.seq
250000073 gbgss135.seq
250000238 gbgss136.seq
28276001 gbgss137.seq
249997137 gbgss138.seq
250000033 gbgss139.seq
524290255 gbgss14.seq
249998542 gbgss140.seq
249998333 gbgss141.seq
224919493 gbgss142.seq
249998415 gbgss143.seq
249998761 gbgss144.seq
249998880 gbgss145.seq
250000157 gbgss146.seq
188952519 gbgss147.seq
249999433 gbgss148.seq
249998390 gbgss149.seq
524290973 gbgss15.seq
249999267 gbgss150.seq
249998392 gbgss151.seq
249998759 gbgss152.seq
76677884 gbgss153.seq
249997579 gbgss154.seq
2077145 gbgss155.seq
79542372 gbgss156.seq
249999609 gbgss157.seq
249999331 gbgss158.seq
88106989 gbgss159.seq
524289904 gbgss16.seq
249999685 gbgss160.seq
249998355 gbgss161.seq
249998984 gbgss162.seq
203023933 gbgss163.seq
249999232 gbgss164.seq
249998256 gbgss165.seq
250000262 gbgss166.seq
246145215 gbgss167.seq
249999268 gbgss168.seq
249997406 gbgss169.seq
524289821 gbgss17.seq
249999793 gbgss170.seq
243553715 gbgss171.seq
249999336 gbgss172.seq
250000088 gbgss173.seq
249998347 gbgss174.seq
249999296 gbgss175.seq
121655059 gbgss176.seq
249998013 gbgss177.seq
250000031 gbgss178.seq
249999974 gbgss179.seq
524288720 gbgss18.seq
249998152 gbgss180.seq
94058788 gbgss181.seq
249998892 gbgss182.seq
249999850 gbgss183.seq
249998239 gbgss184.seq
249999582 gbgss185.seq
171078309 gbgss186.seq
249999236 gbgss187.seq
249997993 gbgss188.seq
249998006 gbgss189.seq
207635290 gbgss19.seq
249999353 gbgss190.seq
95926739 gbgss191.seq
249999461 gbgss192.seq
249999350 gbgss193.seq
249998406 gbgss194.seq
249998619 gbgss195.seq
249999398 gbgss196.seq
249999995 gbgss197.seq
17245248 gbgss198.seq
249999424 gbgss199.seq
524288790 gbgss2.seq
524290739 gbgss20.seq
249999963 gbgss200.seq
249997369 gbgss201.seq
43648880 gbgss202.seq
52862187 gbgss203.seq
250000236 gbgss204.seq
249997928 gbgss205.seq
250000245 gbgss206.seq
249999824 gbgss207.seq
249998258 gbgss208.seq
249998887 gbgss209.seq
524289546 gbgss21.seq
60367551 gbgss210.seq
249997633 gbgss211.seq
249998526 gbgss212.seq
249998545 gbgss213.seq
250000107 gbgss214.seq
249999308 gbgss215.seq
249999371 gbgss216.seq
40462803 gbgss217.seq
249999812 gbgss218.seq
249997079 gbgss219.seq
524289506 gbgss22.seq
249998029 gbgss220.seq
248228351 gbgss221.seq
249999561 gbgss222.seq
249998751 gbgss223.seq
249999599 gbgss224.seq
249999028 gbgss225.seq
249999713 gbgss226.seq
16550600 gbgss227.seq
524289664 gbgss23.seq
524290301 gbgss24.seq
524291759 gbgss25.seq
524290403 gbgss26.seq
524292009 gbgss27.seq
524289137 gbgss28.seq
524290737 gbgss29.seq
524291429 gbgss3.seq
466140389 gbgss30.seq
524290644 gbgss31.seq
524290000 gbgss32.seq
524289128 gbgss33.seq
524288742 gbgss34.seq
524291191 gbgss35.seq
524290101 gbgss36.seq
524289453 gbgss37.seq
477084638 gbgss38.seq
524288965 gbgss39.seq
524290659 gbgss4.seq
524289163 gbgss40.seq
476801969 gbgss41.seq
524290080 gbgss42.seq
524288837 gbgss43.seq
524290462 gbgss44.seq
524290447 gbgss45.seq
169969153 gbgss46.seq
524290347 gbgss47.seq
524289342 gbgss48.seq
524291265 gbgss49.seq
130223630 gbgss5.seq
524291334 gbgss50.seq
524289086 gbgss51.seq
524289952 gbgss52.seq
524290985 gbgss53.seq
524290958 gbgss54.seq
524290124 gbgss55.seq
524290902 gbgss56.seq
432582210 gbgss57.seq
524288728 gbgss58.seq
524291249 gbgss59.seq
524288973 gbgss6.seq
524291352 gbgss60.seq
424789040 gbgss61.seq
524290833 gbgss62.seq
524290918 gbgss63.seq
524289510 gbgss64.seq
524289470 gbgss65.seq
524291362 gbgss66.seq
524291159 gbgss67.seq
524290733 gbgss68.seq
524291038 gbgss69.seq
524291366 gbgss7.seq
524289964 gbgss70.seq
524288984 gbgss71.seq
524290918 gbgss72.seq
449867679 gbgss73.seq
524290077 gbgss74.seq
524289470 gbgss75.seq
524290803 gbgss76.seq
524289205 gbgss77.seq
524290151 gbgss78.seq
524289776 gbgss79.seq
524289914 gbgss8.seq
524289694 gbgss80.seq
524291883 gbgss81.seq
524291254 gbgss82.seq
524291793 gbgss83.seq
524291793 gbgss84.seq
275559034 gbgss85.seq
524290218 gbgss86.seq
524289173 gbgss87.seq
524291999 gbgss88.seq
524291781 gbgss89.seq
524290790 gbgss9.seq
524289364 gbgss90.seq
524291169 gbgss91.seq
524289097 gbgss92.seq
524289396 gbgss93.seq
524289998 gbgss94.seq
524291113 gbgss95.seq
524288887 gbgss96.seq
524290304 gbgss97.seq
524290369 gbgss98.seq
524289300 gbgss99.seq
249988446 gbhtc1.seq
250000195 gbhtc10.seq
249997913 gbhtc11.seq
79789050 gbhtc12.seq
249998718 gbhtc13.seq
249997964 gbhtc14.seq
57677630 gbhtc15.seq
249990019 gbhtc2.seq
249994097 gbhtc3.seq
249989139 gbhtc4.seq
249997691 gbhtc5.seq
249996247 gbhtc6.seq
249996862 gbhtc7.seq
83854894 gbhtc8.seq
249998542 gbhtc9.seq
249904812 gbhtg1.seq
249863408 gbhtg10.seq
249917503 gbhtg100.seq
249830439 gbhtg101.seq
249884880 gbhtg102.seq
249914920 gbhtg103.seq
5504377 gbhtg104.seq
249499238 gbhtg105.seq
249899099 gbhtg106.seq
249802366 gbhtg107.seq
249927313 gbhtg108.seq
249961038 gbhtg109.seq
1107147 gbhtg11.seq
249919195 gbhtg110.seq
249784857 gbhtg111.seq
249900985 gbhtg112.seq
249834672 gbhtg113.seq
65230355 gbhtg114.seq
249970085 gbhtg115.seq
249897536 gbhtg116.seq
249932767 gbhtg117.seq
249931552 gbhtg118.seq
249976607 gbhtg119.seq
249658387 gbhtg12.seq
59297358 gbhtg120.seq
249907068 gbhtg121.seq
249997872 gbhtg122.seq
249770919 gbhtg123.seq
249830702 gbhtg124.seq
249931708 gbhtg125.seq
155414982 gbhtg126.seq
249908662 gbhtg127.seq
249813867 gbhtg128.seq
249888286 gbhtg129.seq
249699749 gbhtg13.seq
249856313 gbhtg130.seq
249913340 gbhtg131.seq
249797073 gbhtg132.seq
249878457 gbhtg133.seq
249959770 gbhtg134.seq
249987298 gbhtg135.seq
31226731 gbhtg136.seq
249812920 gbhtg14.seq
249967540 gbhtg15.seq
249809968 gbhtg16.seq
249872360 gbhtg17.seq
249758294 gbhtg18.seq
249928943 gbhtg19.seq
249994630 gbhtg2.seq
249913596 gbhtg20.seq
242544182 gbhtg21.seq
249760645 gbhtg22.seq
249868408 gbhtg23.seq
249994184 gbhtg24.seq
249921752 gbhtg25.seq
249761207 gbhtg26.seq
249891619 gbhtg27.seq
249961145 gbhtg28.seq
249848492 gbhtg29.seq
249950135 gbhtg3.seq
249992987 gbhtg30.seq
225341986 gbhtg31.seq
249827828 gbhtg32.seq
249732911 gbhtg33.seq
249932308 gbhtg34.seq
249888115 gbhtg35.seq
249776978 gbhtg36.seq
249860337 gbhtg37.seq
249647940 gbhtg38.seq
249809629 gbhtg39.seq
249984089 gbhtg4.seq
249941134 gbhtg40.seq
226910359 gbhtg41.seq
249998331 gbhtg42.seq
249936527 gbhtg43.seq
249894895 gbhtg44.seq
249909173 gbhtg45.seq
250000253 gbhtg46.seq
249478757 gbhtg47.seq
249731618 gbhtg48.seq
249737497 gbhtg49.seq
249882044 gbhtg5.seq
249959815 gbhtg50.seq
237748579 gbhtg51.seq
249784840 gbhtg52.seq
249852612 gbhtg53.seq
249905747 gbhtg54.seq
249884954 gbhtg55.seq
249732248 gbhtg56.seq
20448445 gbhtg57.seq
249846592 gbhtg58.seq
250000116 gbhtg59.seq
249898460 gbhtg6.seq
249917026 gbhtg60.seq
249939524 gbhtg61.seq
227541388 gbhtg62.seq
249902652 gbhtg63.seq
249986757 gbhtg64.seq
249918193 gbhtg65.seq
249883760 gbhtg66.seq
249966605 gbhtg67.seq
16805116 gbhtg68.seq
249960711 gbhtg69.seq
249933725 gbhtg7.seq
249973591 gbhtg70.seq
249953795 gbhtg71.seq
249936542 gbhtg72.seq
227270574 gbhtg73.seq
249814083 gbhtg74.seq
249953172 gbhtg75.seq
249976471 gbhtg76.seq
249876760 gbhtg77.seq
245743847 gbhtg78.seq
249883367 gbhtg79.seq
249933567 gbhtg8.seq
249988504 gbhtg80.seq
249985054 gbhtg81.seq
249923601 gbhtg82.seq
216520297 gbhtg83.seq
249912287 gbhtg84.seq
249753930 gbhtg85.seq
249999728 gbhtg86.seq
249969843 gbhtg87.seq
221623820 gbhtg88.seq
249843050 gbhtg89.seq
249923766 gbhtg9.seq
249970890 gbhtg90.seq
249816092 gbhtg91.seq
249823019 gbhtg92.seq
212441434 gbhtg93.seq
249819427 gbhtg94.seq
249934715 gbhtg95.seq
249954863 gbhtg96.seq
249842265 gbhtg97.seq
169279701 gbhtg98.seq
249746678 gbhtg99.seq
249997742 gbinv1.seq
249998437 gbinv10.seq
156836437 gbinv11.seq
249998686 gbinv12.seq
249998430 gbinv13.seq
249999370 gbinv14.seq
136124764 gbinv15.seq
247561587 gbinv16.seq
249925806 gbinv17.seq
249999756 gbinv18.seq
249045326 gbinv19.seq
249865949 gbinv2.seq
249998772 gbinv20.seq
249995974 gbinv21.seq
239454227 gbinv22.seq
250000249 gbinv23.seq
249998887 gbinv24.seq
249983951 gbinv25.seq
242221875 gbinv26.seq
214083265 gbinv3.seq
249997989 gbinv4.seq
249998282 gbinv5.seq
249997831 gbinv6.seq
212250579 gbinv7.seq
249998394 gbinv8.seq
249998698 gbinv9.seq
139490945 gbjou1.idx
187770430 gbjou10.idx
180222679 gbjou2.idx
142011534 gbjou3.idx
260936183 gbjou4.idx
278736810 gbjou5.idx
275131274 gbjou6.idx
301529037 gbjou7.idx
298017525 gbjou8.idx
276127381 gbjou9.idx
289145779 gbkey1.idx
178802528 gbkey2.idx
197478372 gbkey3.idx
220658816 gbkey4.idx
25895641 gbkey5.idx
249801897 gbmam1.seq
249998516 gbmam2.seq
249820675 gbmam3.seq
249997752 gbmam4.seq
250000023 gbmam5.seq
249996231 gbmam6.seq
2022519 gbmam7.seq
37204978 gbnew.txt
249999691 gbpat1.seq
249999905 gbpat10.seq
249999878 gbpat100.seq
249849703 gbpat101.seq
66835452 gbpat102.seq
249999441 gbpat103.seq
249999845 gbpat104.seq
249999888 gbpat105.seq
249999095 gbpat106.seq
160256390 gbpat107.seq
249999974 gbpat108.seq
249999633 gbpat109.seq
179257126 gbpat11.seq
249999435 gbpat110.seq
249998830 gbpat111.seq
249999029 gbpat112.seq
249999236 gbpat113.seq
249943136 gbpat114.seq
250000124 gbpat115.seq
249999983 gbpat116.seq
250000114 gbpat117.seq
86031991 gbpat118.seq
249999922 gbpat119.seq
250000000 gbpat12.seq
249999187 gbpat120.seq
249999389 gbpat121.seq
63529069 gbpat122.seq
249994671 gbpat123.seq
249996731 gbpat124.seq
250000102 gbpat125.seq
249999321 gbpat126.seq
250000166 gbpat127.seq
249998092 gbpat128.seq
222014044 gbpat129.seq
249981225 gbpat13.seq
250000249 gbpat130.seq
249999893 gbpat131.seq
249999893 gbpat132.seq
220539897 gbpat133.seq
249999753 gbpat134.seq
249997465 gbpat135.seq
249999639 gbpat136.seq
249999111 gbpat137.seq
249998926 gbpat138.seq
250000052 gbpat139.seq
249999737 gbpat14.seq
196630508 gbpat140.seq
249995220 gbpat15.seq
249998865 gbpat16.seq
65866387 gbpat17.seq
250000027 gbpat18.seq
249999801 gbpat19.seq
249998547 gbpat2.seq
249999076 gbpat20.seq
249996841 gbpat21.seq
185764925 gbpat22.seq
249999987 gbpat23.seq
249998065 gbpat24.seq
249999246 gbpat25.seq
250000047 gbpat26.seq
70926601 gbpat27.seq
249983374 gbpat28.seq
249999590 gbpat29.seq
249999343 gbpat3.seq
250000102 gbpat30.seq
249999654 gbpat31.seq
249999891 gbpat32.seq
180160871 gbpat33.seq
249997945 gbpat34.seq
249999933 gbpat35.seq
249998884 gbpat36.seq
249999786 gbpat37.seq
130526002 gbpat38.seq
249995217 gbpat39.seq
249998802 gbpat4.seq
249980197 gbpat40.seq
249999229 gbpat41.seq
249998815 gbpat42.seq
250000126 gbpat43.seq
249812989 gbpat44.seq
249999190 gbpat45.seq
249999579 gbpat46.seq
171259279 gbpat47.seq
249999672 gbpat48.seq
249998527 gbpat49.seq
71788701 gbpat5.seq
249999531 gbpat50.seq
250000197 gbpat51.seq
222934467 gbpat52.seq
249999057 gbpat53.seq
249999815 gbpat54.seq
249999876 gbpat55.seq
164687260 gbpat56.seq
249878083 gbpat57.seq
249997927 gbpat58.seq
249998816 gbpat59.seq
249999527 gbpat6.seq
249999394 gbpat60.seq
134897275 gbpat61.seq
249998194 gbpat62.seq
249999978 gbpat63.seq
249999690 gbpat64.seq
249998210 gbpat65.seq
249999753 gbpat66.seq
249999455 gbpat67.seq
144886744 gbpat68.seq
250000113 gbpat69.seq
249999919 gbpat7.seq
249999899 gbpat70.seq
249998837 gbpat71.seq
244402894 gbpat72.seq
248968678 gbpat73.seq
244459261 gbpat74.seq
247875799 gbpat75.seq
249999857 gbpat76.seq
160624439 gbpat77.seq
250000121 gbpat78.seq
249999657 gbpat79.seq
249997141 gbpat8.seq
249999470 gbpat80.seq
249999644 gbpat81.seq
249999943 gbpat82.seq
249999277 gbpat83.seq
249893818 gbpat84.seq
249864995 gbpat85.seq
153766003 gbpat86.seq
249999879 gbpat87.seq
249999564 gbpat88.seq
249929730 gbpat89.seq
249996803 gbpat9.seq
249824878 gbpat90.seq
249998855 gbpat91.seq
192933071 gbpat92.seq
249999717 gbpat93.seq
249999626 gbpat94.seq
249998458 gbpat95.seq
80116358 gbpat96.seq
249999129 gbpat97.seq
250000123 gbpat98.seq
249970165 gbpat99.seq
124461800 gbphg1.seq
249997712 gbpln1.seq
249999426 gbpln10.seq
249891211 gbpln11.seq
249809506 gbpln12.seq
98370871 gbpln13.seq
249995267 gbpln14.seq
249982800 gbpln15.seq
249994089 gbpln16.seq
249378749 gbpln17.seq
249941381 gbpln18.seq
249598316 gbpln19.seq
249803042 gbpln2.seq
249997395 gbpln20.seq
30471630 gbpln21.seq
249997220 gbpln22.seq
95121686 gbpln23.seq
249998242 gbpln24.seq
249999839 gbpln25.seq
249843981 gbpln26.seq
249998201 gbpln27.seq
249555685 gbpln28.seq
249997283 gbpln29.seq
249927407 gbpln3.seq
249998868 gbpln30.seq
175764844 gbpln31.seq
249998251 gbpln32.seq
249999930 gbpln33.seq
249997964 gbpln34.seq
249998689 gbpln35.seq
109972337 gbpln36.seq
249999220 gbpln37.seq
249998533 gbpln38.seq
249996082 gbpln39.seq
249919231 gbpln4.seq
249998207 gbpln40.seq
249999956 gbpln41.seq
249999920 gbpln42.seq
249998093 gbpln43.seq
188913534 gbpln44.seq
249928683 gbpln5.seq
249999193 gbpln6.seq
249997501 gbpln7.seq
73650188 gbpln8.seq
249998249 gbpln9.seq
148960519 gbpri1.seq
249958149 gbpri10.seq
125816106 gbpri11.seq
249966847 gbpri12.seq
249900330 gbpri13.seq
249899933 gbpri14.seq
249949219 gbpri15.seq
249911015 gbpri16.seq
249858970 gbpri17.seq
249821596 gbpri18.seq
249995784 gbpri19.seq
249873744 gbpri2.seq
249860666 gbpri20.seq
249996555 gbpri21.seq
167422036 gbpri22.seq
180128965 gbpri23.seq
249991678 gbpri24.seq
205132324 gbpri25.seq
249922721 gbpri26.seq
249875986 gbpri27.seq
249932093 gbpri28.seq
249916215 gbpri29.seq
249974814 gbpri3.seq
249936540 gbpri30.seq
249843597 gbpri31.seq
249828387 gbpri32.seq
249998935 gbpri33.seq
87386446 gbpri34.seq
249992029 gbpri35.seq
249998149 gbpri36.seq
249862801 gbpri37.seq
249998294 gbpri38.seq
249998704 gbpri39.seq
249922011 gbpri4.seq
162863635 gbpri40.seq
249974552 gbpri41.seq
132642574 gbpri42.seq
249754386 gbpri5.seq
249853260 gbpri6.seq
249844108 gbpri7.seq
249860358 gbpri8.seq
249964454 gbpri9.seq
289846 gbrel.txt
249771444 gbrod1.seq
249789785 gbrod10.seq
56114869 gbrod11.seq
249879313 gbrod12.seq
249787795 gbrod13.seq
249998696 gbrod14.seq
249654174 gbrod15.seq
249957033 gbrod16.seq
249890968 gbrod17.seq
249980772 gbrod18.seq
194029816 gbrod19.seq
249771529 gbrod2.seq
249850743 gbrod20.seq
249766312 gbrod21.seq
227793600 gbrod22.seq
249998002 gbrod23.seq
249995207 gbrod24.seq
249817306 gbrod25.seq
249962995 gbrod26.seq
249999773 gbrod27.seq
249999249 gbrod28.seq
112339966 gbrod29.seq
249872771 gbrod3.seq
249819570 gbrod4.seq
249888657 gbrod5.seq
249923821 gbrod6.seq
249981021 gbrod7.seq
249720282 gbrod8.seq
249726725 gbrod9.seq
3176962686 gbsdr1.txt
5497446847 gbsdr2.txt
2407668245 gbsdr3.txt
148607680 gbsec.idx
249996758 gbsts1.seq
249997362 gbsts10.seq
212226966 gbsts11.seq
249996524 gbsts12.seq
249998986 gbsts13.seq
249998938 gbsts14.seq
250000159 gbsts15.seq
27394715 gbsts16.seq
249999617 gbsts17.seq
249999376 gbsts18.seq
249998351 gbsts19.seq
249999616 gbsts2.seq
150361386 gbsts20.seq
249998933 gbsts3.seq
249996611 gbsts4.seq
39428238 gbsts5.seq
249997222 gbsts6.seq
249997899 gbsts7.seq
249998458 gbsts8.seq
249997742 gbsts9.seq
249996215 gbsyn1.seq
249999529 gbsyn2.seq
22374650 gbsyn3.seq
249999370 gbtsa1.seq
43503975 gbtsa10.seq
249997835 gbtsa11.seq
249999221 gbtsa12.seq
249999375 gbtsa13.seq
249999561 gbtsa14.seq
249999097 gbtsa15.seq
45492681 gbtsa16.seq
249999206 gbtsa2.seq
250000161 gbtsa3.seq
249999275 gbtsa4.seq
82919120 gbtsa5.seq
249998556 gbtsa6.seq
249999789 gbtsa7.seq
249998431 gbtsa8.seq
249998726 gbtsa9.seq
462759 gbuna1.seq
249999688 gbvrl1.seq
238514453 gbvrl10.seq
249988553 gbvrl11.seq
249999880 gbvrl12.seq
249997791 gbvrl13.seq
249999469 gbvrl14.seq
249991871 gbvrl15.seq
155799918 gbvrl16.seq
249996830 gbvrl2.seq
249996223 gbvrl3.seq
249999140 gbvrl4.seq
160487344 gbvrl5.seq
249997949 gbvrl6.seq
249999168 gbvrl7.seq
249999590 gbvrl8.seq
249998396 gbvrl9.seq
249840125 gbvrt1.seq
249854869 gbvrt10.seq
249949571 gbvrt11.seq
185273118 gbvrt12.seq
249999321 gbvrt13.seq
249942265 gbvrt14.seq
249986441 gbvrt15.seq
249998851 gbvrt16.seq
249999795 gbvrt17.seq
249877382 gbvrt18.seq
249999366 gbvrt19.seq
249998616 gbvrt2.seq
249777344 gbvrt20.seq
249998906 gbvrt21.seq
236510236 gbvrt22.seq
249800408 gbvrt3.seq
249999407 gbvrt4.seq
69131368 gbvrt5.seq
249994377 gbvrt6.seq
249996043 gbvrt7.seq
249899147 gbvrt8.seq
249974514 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 54834 91602553
BCT10 61 117892388
BCT11 120 115665846
BCT12 16112 60432674
BCT13 53940 85334500
BCT14 93 110189094
BCT15 151 93915681
BCT16 61 112455059
BCT17 52 112042350
BCT18 46 112693953
BCT19 56 110572060
BCT2 80 109792269
BCT20 66 108817610
BCT21 36 96325907
BCT22 40 106881287
BCT23 58 105533856
BCT24 74 111675186
BCT25 55 110045255
BCT26 63 106845575
BCT27 55 109391288
BCT28 52 108559385
BCT29 46 110496749
BCT3 51 106988267
BCT30 95 109522868
BCT31 59 110930031
BCT32 67 108616570
BCT33 124 109249408
BCT34 34 61811577
BCT35 202 109105476
BCT36 51 109861512
BCT37 41 106434793
BCT38 55 107714064
BCT39 58 109086312
BCT4 1697 109827505
BCT40 51 109156739
BCT41 68 104105901
BCT42 52 108433973
BCT43 55 107069743
BCT44 79 108442252
BCT45 59 74586910
BCT46 70 105467816
BCT47 53 103930668
BCT48 69 101912494
BCT49 220 95539834
BCT5 36759 60775644
BCT50 385 52078320
BCT51 1589 2511823
BCT52 3176 5212972
BCT53 6347 7901828
BCT54 12648 15076611
BCT55 25628 27747115
BCT56 50520 53965661
BCT57 76540 77541041
BCT58 71917 77155410
BCT59 7988 95009357
BCT6 39033 82650253
BCT60 5192 104183730
BCT61 2776 108530633
BCT62 156 121160867
BCT63 49174 88587955
BCT64 90053 70433938
BCT65 46682 86774191
BCT7 5533 96145968
BCT8 13866 89664937
BCT9 6715 95959666
ENV1 94641 71913278
ENV10 83020 87043331
ENV11 19399 16944800
ENV12 84947 80989468
ENV13 120754 43410098
ENV14 88799 78327325
ENV15 96676 68398338
ENV16 96882 62948237
ENV17 84865 72732853
ENV18 49769 67200251
ENV19 69561 85581068
ENV2 87474 70435287
ENV20 95173 71947841
ENV21 128332 31234992
ENV22 123371 29555993
ENV23 61520 13726389
ENV24 123308 50056555
ENV25 99039 67054183
ENV26 120719 57265744
ENV27 151844 53174675
ENV28 94320 67662754
ENV29 4319 5890339
ENV3 88441 77203505
ENV30 71058 96548027
ENV31 94896 69784306
ENV32 109320 42376101
ENV33 85512 72249111
ENV34 49194 25457190
ENV35 112447 47593555
ENV36 103527 64535142
ENV37 70461 95755115
ENV38 70428 95628575
ENV39 70403 95656825
ENV4 81465 83898595
ENV40 29643 37810514
ENV5 92039 81699530
ENV6 65165 34507820
ENV7 131791 31268854
ENV8 86981 71070549
ENV9 93961 73239897
EST1 161379 62545728
EST10 172478 72305713
EST100 230629 144068607
EST101 224869 112855880
EST102 206950 104473244
EST103 164537 101271494
EST104 75084 62809200
EST105 167707 112283181
EST106 170570 112258262
EST107 114243 65475921
EST108 64121 23569706
EST109 64297 22797506
EST11 168202 72480786
EST110 64602 23650022
EST111 64524 27215843
EST112 64664 22246956
EST113 65920 26004549
EST114 63991 27873125
EST115 64553 26537268
EST116 64760 26876108
EST117 64534 25312928
EST118 61251 39241325
EST119 173441 82949917
EST12 186524 84558184
EST120 177539 85699156
EST121 155235 94507847
EST122 150297 94825434
EST123 156434 95343258
EST124 107317 63449123
EST125 206582 101061568
EST126 154242 80034718
EST127 161182 85634980
EST128 156956 90142199
EST129 154707 81207400
EST13 22588 8710214
EST130 178273 107397809
EST131 212201 116807239
EST132 173089 98374191
EST133 167533 82033368
EST134 153931 82628659
EST135 151095 92201070
EST136 159742 92192420
EST137 50341 28234603
EST138 192161 109747650
EST139 234870 103919618
EST14 222173 112104766
EST140 154869 90685480
EST141 171335 93770162
EST142 147702 87136079
EST143 138015 87798779
EST144 157720 93977410
EST145 149005 77052583
EST146 124685 65453283
EST147 124104 64464366
EST148 129966 55254280
EST149 129059 51012222
EST15 169565 107637314
EST150 130471 51983049
EST151 96032 36183619
EST152 174807 87630439
EST153 183432 83619427
EST154 158348 111343813
EST155 217287 130532982
EST156 218267 122875158
EST157 170926 91420930
EST158 145541 113672056
EST159 143973 91586944
EST16 186468 112765717
EST160 148179 86337888
EST161 149802 80317826
EST162 146214 86490428
EST163 165056 89428279
EST164 58137 36225482
EST165 157307 97521769
EST166 189648 106553308
EST167 148775 81529039
EST168 132160 70024437
EST169 178000 98698062
EST17 195017 119761221
EST170 175967 102885375
EST171 153186 94101460
EST172 173783 88441359
EST173 128144 82635751
EST174 192077 112271647
EST175 163315 93994993
EST176 105579 59668313
EST177 182002 108036562
EST178 171736 102980166
EST179 184166 131447221
EST18 194294 118712022
EST180 154546 110037445
EST181 191570 95427551
EST182 153739 117521252
EST183 149430 88948269
EST184 148087 80661666
EST185 174332 77650592
EST186 151639 83503974
EST187 161019 101940816
EST188 147879 89353658
EST189 163190 101353479
EST19 165817 114342486
EST190 130565 75428595
EST191 135318 91102543
EST192 132615 89210384
EST193 149128 91480183
EST194 132939 89149200
EST195 122305 86162464
EST196 182708 96975607
EST197 176790 97538624
EST198 176362 97743460
EST199 173604 97345838
EST2 163981 61999756
EST20 206508 108585901
EST200 171159 95892375
EST201 175327 97746722
EST202 176439 96482144
EST203 175299 96075236
EST204 194675 105471940
EST205 205153 108583684
EST206 178112 107413278
EST207 189255 107700848
EST208 199739 118338940
EST209 196059 121073623
EST21 226141 108576241
EST210 183271 121084529
EST211 185699 112748360
EST212 220715 148415122
EST213 232484 109893674
EST214 107675 82812666
EST215 152151 102584382
EST216 148206 91699595
EST217 214161 115360113
EST218 170866 113040983
EST219 97189 95684034
EST22 176350 52335598
EST220 149680 109433981
EST221 159415 95331424
EST222 146015 106186390
EST223 228094 106038594
EST224 139279 102275597
EST225 142164 101847317
EST226 136366 95420057
EST227 124540 89852912
EST228 71864 43422683
EST229 143085 92825677
EST23 131075 37717427
EST230 134744 99599483
EST231 138690 98984380
EST232 125071 85278769
EST233 139403 88591662
EST234 159213 119573006
EST235 139466 120374899
EST236 137277 109341297
EST237 165171 100770876
EST238 176444 111511775
EST239 150853 100167126
EST24 121303 39558327
EST240 180947 120324660
EST241 161728 110801612
EST242 127260 97090021
EST243 166589 101924035
EST244 237437 100731487
EST245 149860 113846625
EST246 188826 61189959
EST247 222095 55684614
EST248 206923 91586905
EST249 177476 126287790
EST25 85001 34289004
EST250 164646 104165180
EST251 180514 109932914
EST252 157007 112671993
EST253 183144 118245062
EST254 45454 25383924
EST255 190256 100195200
EST256 179284 113998405
EST257 167199 110663089
EST258 244690 112711706
EST259 288175 123745081
EST26 217934 99799444
EST260 176529 111324834
EST261 199457 41113031
EST262 248409 123865926
EST263 153290 96982346
EST264 170007 106696009
EST265 62703 37476879
EST266 177270 120418086
EST267 185029 100181339
EST268 178446 116995024
EST269 185124 104884766
EST27 223247 112255693
EST270 212844 32130241
EST271 189114 65221429
EST272 188057 108310273
EST273 183598 118928641
EST274 174949 111408807
EST275 182224 109085753
EST276 154551 91912606
EST277 68261 19855352
EST278 130979 82430272
EST279 136047 87310038
EST28 189042 86573200
EST280 162373 99254439
EST281 266460 27999631
EST282 261973 30836486
EST283 149256 107366874
EST284 167408 114266694
EST285 163627 101214339
EST286 181570 82387283
EST287 247166 44600608
EST288 167609 113195527
EST289 43975 21587004
EST29 163380 71692401
EST290 187388 112630383
EST291 154397 96408653
EST292 201752 111279853
EST293 160683 114171434
EST294 168425 102888860
EST295 191466 117569252
EST296 182174 105144170
EST297 189774 98913894
EST298 190041 66443317
EST299 189908 71400761
EST3 159991 57093499
EST30 171233 68608345
EST300 189714 70367056
EST301 85591 33346717
EST302 191074 94756630
EST303 186081 134739382
EST304 149555 86841236
EST305 155576 94680133
EST306 132629 101141025
EST307 163108 97755782
EST308 178353 102615612
EST309 153112 99145774
EST31 156215 66548079
EST310 167296 94272118
EST311 162353 109062161
EST312 149817 108528593
EST313 168876 106422017
EST314 121741 91904016
EST315 185397 156515854
EST316 176119 94772857
EST317 136214 87504484
EST318 147190 101887009
EST319 140539 92787580
EST32 170607 76286719
EST320 142907 94378372
EST321 147946 102715579
EST322 157103 103729813
EST323 177877 106159143
EST324 151937 85955874
EST325 153418 89252066
EST326 151438 109296173
EST327 165977 99578499
EST328 45938 32195771
EST329 141227 88244798
EST33 181066 74067761
EST330 157189 97982398
EST331 206938 107591529
EST332 128872 71448147
EST333 124866 81863472
EST334 136043 87585037
EST335 137815 86676839
EST336 140606 84245214
EST337 223608 88019005
EST338 182041 82462344
EST339 166987 103834225
EST34 104726 30887906
EST340 168347 103728690
EST341 139341 87525185
EST342 25384 16779623
EST343 136619 91166182
EST344 151797 97693581
EST345 186788 120438212
EST346 164559 89578279
EST347 181833 104983602
EST348 170694 127911455
EST349 73990 44196692
EST35 98065 30029260
EST350 105008 56921449
EST351 138371 82451006
EST352 137334 79147291
EST353 161092 32793712
EST354 161084 32724038
EST355 166519 70376567
EST356 143419 94039061
EST357 253779 116953467
EST358 256267 118256811
EST359 173466 99067094
EST36 98321 31217100
EST360 142175 93371957
EST361 140608 86001246
EST362 163548 98812194
EST363 200742 122609315
EST364 222654 58310040
EST365 199455 123122035
EST366 198579 108260646
EST367 124023 61241376
EST368 188745 121332456
EST369 177492 112959751
EST37 97330 29336523
EST370 154340 118808947
EST371 186728 148224164
EST372 162520 95301657
EST373 204006 115788696
EST374 176064 104023175
EST375 220234 136365688
EST376 202919 126289624
EST377 189477 108272090
EST378 164196 88907765
EST379 172085 15547614
EST38 99416 30212665
EST380 161526 13685646
EST381 159722 27283479
EST382 161214 32423271
EST383 161053 32796624
EST384 150894 82070093
EST385 181967 106788968
EST386 168728 115974461
EST387 169534 99359343
EST388 157342 108852714
EST389 142028 99041887
EST39 101379 30818317
EST390 146496 96417182
EST391 139182 92462956
EST392 155597 112218959
EST393 168237 102894143
EST394 177137 46839405
EST395 168739 51322685
EST396 159775 110402233
EST397 165274 103680269
EST398 166479 107804821
EST399 155363 91760230
EST4 173290 68227083
EST40 8039 2034297
EST400 195361 125208742
EST401 147510 97917782
EST402 134227 91978432
EST403 156250 96605296
EST404 129964 77720086
EST405 176202 95757614
EST406 166925 98418974
EST407 164147 96093401
EST408 177392 109710770
EST409 139164 89022797
EST41 101806 53501971
EST410 87753 66501397
EST411 100943 68085315
EST412 145458 83551303
EST413 131550 79124756
EST414 137884 87350013
EST415 141297 86646080
EST416 155801 95108724
EST417 160900 85081247
EST418 140373 81194995
EST419 131220 86591482
EST42 121605 51755446
EST420 191684 109440943
EST421 172783 74946766
EST422 158831 91489355
EST423 174866 113771310
EST424 176890 97098537
EST425 137862 93401196
EST426 167694 74336852
EST427 195286 85895200
EST428 213096 89988749
EST429 165937 96295839
EST43 168023 87530733
EST430 168334 59868669
EST431 22951 7063570
EST432 160700 63359561
EST433 19487 5803289
EST44 169187 68018592
EST45 169305 90560040
EST46 173403 89924239
EST47 163910 84397973
EST48 164753 87551314
EST49 159208 91792946
EST5 171211 67090000
EST50 165056 92671459
EST51 161048 95281543
EST52 153926 69506889
EST53 155460 93383533
EST54 53310 28697484
EST55 170503 68293532
EST56 161467 77497982
EST57 172744 97788962
EST58 159350 100154769
EST59 158542 103651525
EST6 176940 69309090
EST60 167005 99352452
EST61 164810 107790561
EST62 176019 77318982
EST63 173311 103489083
EST64 152408 78941061
EST65 153056 88661558
EST66 158732 94065779
EST67 112052 66345252
EST68 145178 85874072
EST69 198362 110329936
EST7 170651 73349498
EST70 205588 108472043
EST71 208518 117458063
EST72 202416 120014768
EST73 198870 115120530
EST74 153962 80835278
EST75 135595 63518838
EST76 144384 74852072
EST77 157475 107344315
EST78 153841 83972359
EST79 147179 79119544
EST8 183537 73680326
EST80 28617 24812349
EST81 186081 95835958
EST82 216897 126902313
EST83 211711 113640496
EST84 219256 103893895
EST85 205790 89779943
EST86 152221 91077999
EST87 148253 82681582
EST88 167601 85688640
EST89 157413 86340913
EST9 169212 72414395
EST90 155062 99932636
EST91 154059 106993094
EST92 105601 53524590
EST93 154408 116877013
EST94 143826 105974589
EST95 148132 108295610
EST96 141757 86804354
EST97 161399 89362504
EST98 172586 108631128
EST99 255823 156860187
GSS1 203735 89312867
GSS10 134865 64313376
GSS100 108799 56561669
GSS101 194496 123062085
GSS102 170524 113704930
GSS103 202389 118983482
GSS104 208067 136529951
GSS105 213962 141049355
GSS106 212551 142479413
GSS107 208414 147640191
GSS108 209759 145917694
GSS109 208032 148355774
GSS11 138022 73189181
GSS110 205661 149808960
GSS111 164090 122161694
GSS112 134717 85285062
GSS113 172670 80997425
GSS114 189056 84036000
GSS115 174567 151764477
GSS116 181671 123592850
GSS117 187164 152274217
GSS118 194890 128066935
GSS119 191508 135992770
GSS12 149475 74219336
GSS120 207023 114954092
GSS121 177171 118812139
GSS122 170778 144329283
GSS123 167422 116553213
GSS124 37203 33808043
GSS125 173816 158002249
GSS126 176048 156409370
GSS127 174978 158136749
GSS128 175853 157901751
GSS129 182866 148245694
GSS13 146605 70974416
GSS130 182600 155692289
GSS131 171945 135451127
GSS132 15118 7992205
GSS133 87132 64062850
GSS134 83555 62804812
GSS135 103700 48626431
GSS136 68540 58458817
GSS137 7566 6944755
GSS138 68591 57924394
GSS139 69224 56650935
GSS14 176895 88657656
GSS140 69460 56187403
GSS141 71202 55998401
GSS142 68561 51865315
GSS143 75915 58209304
GSS144 87237 74898207
GSS145 81830 44609896
GSS146 92716 45046736
GSS147 63170 47586447
GSS148 77435 61351403
GSS149 69655 58699293
GSS15 163727 97515464
GSS150 67711 62706526
GSS151 62009 53369632
GSS152 95592 42925428
GSS153 21061 4909542
GSS154 112938 70877522
GSS155 822 559311
GSS156 23226 28867035
GSS157 109026 70640916
GSS158 84262 34482404
GSS159 36103 22420221
GSS16 175166 90441155
GSS160 103304 62490220
GSS161 102329 63761256
GSS162 104268 67656826
GSS163 82099 41276456
GSS164 83102 54651503
GSS165 95717 61368951
GSS166 107327 78544150
GSS167 106327 76654534
GSS168 106058 79947480
GSS169 103996 80016519
GSS17 191954 121602060
GSS170 76372 51037934
GSS171 104574 63293376
GSS172 109868 66415305
GSS173 106198 59308808
GSS174 68379 37446454
GSS175 69628 38764072
GSS176 37097 17751555
GSS177 85481 46023427
GSS178 97119 55907586
GSS179 94982 49597190
GSS18 192387 107784318
GSS180 96286 55922591
GSS181 42132 23615490
GSS182 114638 43642267
GSS183 117085 39368203
GSS184 108676 55514545
GSS185 101471 78372335
GSS186 67717 43620427
GSS187 95891 36542252
GSS188 95417 37268709
GSS189 96671 35161518
GSS19 79331 35564705
GSS190 94285 39167432
GSS191 37736 17626556
GSS192 103939 66277823
GSS193 94551 61190929
GSS194 95128 60357048
GSS195 94773 60868501
GSS196 75675 70017159
GSS197 75117 74330280
GSS198 4473 7127270
GSS199 83736 28233267
GSS2 185158 93986421
GSS20 184918 103934584
GSS200 84219 27346468
GSS201 84926 25909272
GSS202 14851 4422302
GSS203 16547 7508221
GSS204 92599 59605439
GSS205 84775 52587038
GSS206 96115 57298136
GSS207 89290 62469270
GSS208 89113 62767967
GSS209 88958 63029497
GSS21 168364 115535222
GSS210 21475 15119823
GSS211 87995 63795538
GSS212 90217 62488977
GSS213 91852 66673784
GSS214 83705 79638020
GSS215 84165 78995211
GSS216 91236 77203952
GSS217 15869 12057888
GSS218 117650 64297121
GSS219 81406 70473025
GSS22 172518 98964085
GSS220 73127 72712270
GSS221 91890 60357860
GSS222 94787 57200301
GSS223 93517 59081345
GSS224 93900 58510429
GSS225 94714 57307691
GSS226 94279 58016121
GSS227 6701 3333254
GSS23 190834 134329562
GSS24 198893 127661504
GSS25 176449 102829993
GSS26 193640 116266021
GSS27 168456 159190910
GSS28 191294 137442271
GSS29 162603 116618245
GSS3 177961 89026656
GSS30 172562 115698507
GSS31 200167 129345778
GSS32 221139 118630930
GSS33 223185 115899748
GSS34 224450 114208328
GSS35 216176 128923158
GSS36 201824 159079302
GSS37 198403 150015153
GSS38 189993 57319565
GSS39 185306 104010708
GSS4 168924 86150339
GSS40 191734 136125816
GSS41 157614 142421518
GSS42 186790 101740811
GSS43 176698 124421667
GSS44 188594 127050408
GSS45 193883 124542251
GSS46 57723 53850839
GSS47 174600 103522630
GSS48 170232 104826922
GSS49 171036 104583514
GSS5 42124 25877776
GSS50 185795 123933273
GSS51 189260 117038843
GSS52 187856 123909880
GSS53 188263 117836371
GSS54 191344 136709640
GSS55 188764 107152615
GSS56 194826 123639400
GSS57 149330 114138287
GSS58 175581 140830302
GSS59 164259 113008522
GSS6 163999 85738573
GSS60 164059 113443898
GSS61 151080 102384497
GSS62 159488 130770090
GSS63 172167 144277925
GSS64 185099 120114537
GSS65 206709 128412224
GSS66 195995 113280884
GSS67 249648 129859751
GSS68 158567 105919279
GSS69 163662 124361769
GSS7 167871 80311711
GSS70 165186 126441929
GSS71 165133 126004628
GSS72 182426 112559129
GSS73 168262 123377228
GSS74 202841 128926662
GSS75 173121 113975290
GSS76 203751 134201714
GSS77 225093 79713130
GSS78 186921 111092645
GSS79 127472 92848908
GSS8 168295 90336284
GSS80 147793 118830103
GSS81 141515 117921505
GSS82 144999 117052702
GSS83 145381 120795570
GSS84 145218 118700931
GSS85 79295 65797975
GSS86 151559 123936550
GSS87 149675 118983441
GSS88 145849 114834242
GSS89 144700 117194813
GSS9 138182 67450953
GSS90 146534 121810308
GSS91 150312 122496365
GSS92 149484 119952550
GSS93 148063 122798524
GSS94 148165 122603607
GSS95 148721 121513729
GSS96 146688 115448618
GSS97 143833 116758008
GSS98 146799 121478785
GSS99 180819 131784426
HTC1 25057 27045808
HTC10 64097 67385497
HTC11 74560 76095719
HTC12 21439 31302476
HTC13 66997 61008541
HTC14 68336 69516375
HTC15 20854 14521356
HTC2 16086 36243320
HTC3 16029 36627693
HTC4 16251 35560357
HTC5 15981 40345967
HTC6 16068 37476179
HTC7 53837 31481114
HTC8 31133 19445871
HTC9 62284 77327447
HTG1 1318 188771164
HTG10 1298 186333849
HTG100 990 189440077
HTG101 996 189311689
HTG102 985 189405998
HTG103 1161 190529146
HTG104 30 4187142
HTG105 1090 189528150
HTG106 1040 189748285
HTG107 1394 191388699
HTG108 1301 190943512
HTG109 1620 191199764
HTG11 6 837687
HTG110 1384 191904805
HTG111 1367 191736493
HTG112 1190 189443047
HTG113 1073 184936493
HTG114 322 49161233
HTG115 1513 182381556
HTG116 991 192212231
HTG117 929 180563048
HTG118 1076 193799636
HTG119 1103 193128862
HTG12 1451 183826000
HTG120 244 45955630
HTG121 1029 189498766
HTG122 1054 192790433
HTG123 1165 191966364
HTG124 1081 192892137
HTG125 1075 193106029
HTG126 687 119947247
HTG127 1118 192671822
HTG128 1085 192382816
HTG129 1077 192462758
HTG13 875 191579912
HTG130 1124 192129858
HTG131 1049 192200516
HTG132 1069 192133132
HTG133 1067 192358596
HTG134 1129 191890252
HTG135 1183 189988586
HTG136 291 21296207
HTG14 750 192090960
HTG15 745 192095083
HTG16 784 191973539
HTG17 800 191864904
HTG18 771 191947816
HTG19 2061 170934592
HTG2 2470 186037380
HTG20 1082 187623508
HTG21 926 183819238
HTG22 785 191651908
HTG23 928 190141652
HTG24 907 190495401
HTG25 811 191323929
HTG26 784 191771279
HTG27 874 191079273
HTG28 896 190514509
HTG29 939 189964220
HTG3 2513 185208586
HTG30 911 190941779
HTG31 841 171462419
HTG32 875 191097680
HTG33 966 189353683
HTG34 884 191021659
HTG35 866 191265313
HTG36 826 191631729
HTG37 948 189902725
HTG38 948 190267532
HTG39 940 190178969
HTG4 2550 188439001
HTG40 1048 189151703
HTG41 1099 169476970
HTG42 1257 188188838
HTG43 1169 188132191
HTG44 1150 188026157
HTG45 1118 191332771
HTG46 1269 190703866
HTG47 1174 190717160
HTG48 1130 191137302
HTG49 1047 191184441
HTG5 1283 185453274
HTG50 1021 189712765
HTG51 1061 180778979
HTG52 969 190090757
HTG53 1106 190109635
HTG54 1046 190260051
HTG55 1014 189766536
HTG56 967 189017980
HTG57 89 15545773
HTG58 1010 189344282
HTG59 1031 190037155
HTG6 1273 185124562
HTG60 1072 187359162
HTG61 1129 188210893
HTG62 997 172674612
HTG63 1086 189585086
HTG64 1065 189567157
HTG65 1169 188828767
HTG66 1178 187478964
HTG67 1283 184490539
HTG68 95 12336833
HTG69 1221 185314622
HTG7 1276 185375030
HTG70 1239 184674446
HTG71 1244 184625496
HTG72 1183 187658245
HTG73 1030 171814917
HTG74 1118 188295824
HTG75 1103 190843621
HTG76 1137 190917883
HTG77 1182 190813322
HTG78 1102 187147429
HTG79 1171 190202119
HTG8 1459 184608562
HTG80 1115 190062476
HTG81 1214 189987246
HTG82 1120 189706900
HTG83 958 164506501
HTG84 1228 188383308
HTG85 1251 187687552
HTG86 1141 190066830
HTG87 1147 189784126
HTG88 982 168468910
HTG89 1183 189859637
HTG9 1200 186916809
HTG90 1104 190250569
HTG91 1145 190088330
HTG92 1103 190359001
HTG93 983 162125222
HTG94 1056 190715130
HTG95 1159 191010347
HTG96 1035 189201430
HTG97 1070 189559758
HTG98 690 128563367
HTG99 1018 189641315
INV1 94012 48447829
INV10 84065 65285727
INV11 52280 41570228
INV12 85007 66389534
INV13 80982 66955330
INV14 78579 68001903
INV15 41128 38312268
INV16 8168 145023213
INV17 320 155148771
INV18 28300 118228160
INV19 10914 144751463
INV2 11327 168975649
INV20 65795 80233049
INV21 74713 61141736
INV22 69179 48796975
INV23 76617 55340985
INV24 73629 48890325
INV25 73184 48477927
INV26 33536 101164807
INV3 1317 148745999
INV4 10948 132609061
INV5 76804 74793553
INV6 56453 86911101
INV7 43488 79476215
INV8 80649 71843213
INV9 59613 85950973
MAM1 14408 163096246
MAM2 25577 149866466
MAM3 53466 91284846
MAM4 25172 158857243
MAM5 82932 72935538
MAM6 56425 106010971
MAM7 624 592790
PAT1 222551 70117001
PAT10 124661 102486094
PAT100 158877 103325984
PAT101 137417 114988187
PAT102 42311 27994848
PAT103 193712 81686401
PAT104 150217 108404022
PAT105 356051 11379688
PAT106 257211 57607099
PAT107 138161 48226925
PAT108 322021 22795469
PAT109 155639 102753887
PAT11 98306 64091632
PAT110 147988 113763745
PAT111 114442 129449149
PAT112 24454 182747194
PAT113 155370 106773179
PAT114 175439 89936083
PAT115 203659 47736667
PAT116 277827 9628431
PAT117 220409 46465135
PAT118 106723 2881242
PAT119 270386 21672571
PAT12 142068 62828851
PAT120 186752 61240505
PAT121 109806 106057338
PAT122 47510 9549213
PAT123 87302 88258781
PAT124 78470 95599150
PAT125 145247 77675877
PAT126 167500 71389679
PAT127 121469 92946412
PAT128 102948 85417075
PAT129 165536 45971024
PAT13 105882 59871683
PAT130 270022 5130418
PAT131 269978 5129582
PAT132 269978 5129582
PAT133 237888 4519872
PAT134 269396 5118524
PAT135 235715 25782943
PAT136 204521 46982512
PAT137 172616 69047046
PAT138 92561 126279067
PAT139 161868 77929551
PAT14 103650 50160806
PAT140 149903 63314632
PAT15 121150 53321659
PAT16 113145 61277722
PAT17 39141 16227175
PAT18 146771 52594264
PAT19 153705 78039102
PAT2 194539 84646173
PAT20 104995 118172564
PAT21 133557 95531331
PAT22 84591 79293837
PAT23 123578 103411046
PAT24 119401 105827243
PAT25 145704 86536632
PAT26 175212 64262656
PAT27 71105 1777625
PAT28 102171 77387698
PAT29 93958 87647590
PAT3 171982 95895030
PAT30 119943 61672014
PAT31 96649 78966375
PAT32 128386 55033955
PAT33 92203 51115202
PAT34 111299 78151838
PAT35 138103 29119101
PAT36 158499 24085905
PAT37 114684 49015396
PAT38 44863 54579873
PAT39 95734 83197609
PAT4 153735 106065154
PAT40 100230 70978875
PAT41 136206 39303264
PAT42 143780 35446924
PAT43 123733 64747040
PAT44 104353 81197501
PAT45 93445 74211542
PAT46 113255 66591457
PAT47 65218 54831902
PAT48 135193 108001084
PAT49 167081 97032398
PAT5 57193 23949203
PAT50 116397 127555645
PAT51 196343 76722711
PAT52 80302 127991032
PAT53 27631 180872621
PAT54 185408 93066629
PAT55 274259 6856475
PAT56 129447 31627433
PAT57 161320 77719729
PAT58 92817 89411310
PAT59 106528 74777923
PAT6 170642 91909261
PAT60 122361 64031080
PAT61 67409 30294382
PAT62 70750 109767817
PAT63 87947 82758966
PAT64 92971 78937516
PAT65 93166 72441718
PAT66 93384 75085880
PAT67 115775 60531183
PAT68 102736 9941783
PAT69 175933 10547809
PAT7 154801 88242556
PAT70 171510 10872561
PAT71 171496 10866737
PAT72 99859 86225043
PAT73 99 196466297
PAT74 67 192869889
PAT75 103 195600591
PAT76 1137 196318757
PAT77 97599 5772236
PAT78 151009 9636510
PAT79 151022 9621259
PAT8 131199 96948597
PAT80 151024 9622125
PAT81 151021 9620837
PAT82 94633 88060720
PAT83 93691 93465245
PAT84 116501 55463268
PAT85 2492 193913009
PAT86 79466 64446778
PAT87 342935 8573375
PAT88 188806 88519660
PAT89 111348 132068608
PAT9 129499 101202077
PAT90 3850 194703659
PAT91 131292 110979300
PAT92 158599 54826034
PAT93 224731 34113482
PAT94 250080 15844362
PAT95 180680 63680037
PAT96 51647 26043244
PAT97 114193 110462231
PAT98 137709 83282930
PAT99 164147 99343851
PHG1 5835 50389900
PLN1 59893 93434637
PLN10 37376 49320674
PLN11 38520 70358228
PLN12 13997 137695107
PLN13 7719 40899077
PLN14 17578 144865462
PLN15 17634 146278605
PLN16 17564 146392665
PLN17 24586 128619888
PLN18 5995 149202121
PLN19 1266 170315035
PLN2 28326 129239043
PLN20 14719 154649642
PLN21 6526 7649997
PLN22 67340 69773747
PLN23 28544 30822374
PLN24 77004 76377499
PLN25 65404 81456402
PLN26 40834 117421530
PLN27 12265 134420639
PLN28 15454 137992095
PLN29 73631 77778504
PLN3 1384 180537542
PLN30 75592 77865679
PLN31 74703 33315075
PLN32 80809 71231538
PLN33 77906 76031681
PLN34 80114 70257282
PLN35 81746 76462649
PLN36 46986 23812817
PLN37 101177 57686617
PLN38 80899 69787993
PLN39 46385 99205415
PLN4 1864 186929373
PLN40 52321 103780294
PLN41 80441 73360590
PLN42 79564 70315852
PLN43 79394 67078621
PLN44 39860 69755964
PLN5 1844 194316519
PLN6 2836 176787207
PLN7 74789 81980480
PLN8 22210 21438750
PLN9 73122 75864932
PRI1 23017 59659245
PRI10 1282 179569531
PRI11 750 91157824
PRI12 1278 179183454
PRI13 1451 177770436
PRI14 1589 180081042
PRI15 1591 181937113
PRI16 1285 191720991
PRI17 1137 193649117
PRI18 1098 194174732
PRI19 1166 193723867
PRI2 17777 149944025
PRI20 1750 191720179
PRI21 2717 189637245
PRI22 20867 92905838
PRI23 32483 85337154
PRI24 61439 78188797
PRI25 30604 68651823
PRI26 6598 166805290
PRI27 2120 180578492
PRI28 1602 181614925
PRI29 2027 181677828
PRI3 1436 175494049
PRI30 1973 180540078
PRI31 13166 153854033
PRI32 1298 183382382
PRI33 43204 104894423
PRI34 22128 28080220
PRI35 32190 63610035
PRI36 20224 117496077
PRI37 18686 146786473
PRI38 67149 87158653
PRI39 50310 89079896
PRI4 1288 185770995
PRI40 35866 67105796
PRI41 54460 91727105
PRI42 29658 56544421
PRI5 1317 183887466
PRI6 1181 180033988
PRI7 1249 181215462
PRI8 1215 178157174
PRI9 1359 174576633
ROD1 32058 141024546
ROD10 983 181243384
ROD11 214 40582774
ROD12 1034 185475616
ROD13 940 182704112
ROD14 1040 189324025
ROD15 950 180306408
ROD16 967 182057152
ROD17 991 185812687
ROD18 1190 190560949
ROD19 16702 116537109
ROD2 915 175257467
ROD20 20206 148569736
ROD21 1135 182044035
ROD22 1066 166284921
ROD23 13616 162602043
ROD24 38731 69924077
ROD25 21987 103756874
ROD26 1519 187758894
ROD27 136892 37803860
ROD28 82838 72249091
ROD29 31313 35776614
ROD3 907 173346851
ROD4 900 173882256
ROD5 922 174217276
ROD6 969 178320239
ROD7 966 179459673
ROD8 980 181253783
ROD9 997 181893346
STS1 85279 36761705
STS10 57907 44419978
STS11 49213 37736560
STS12 57924 43637361
STS13 64465 42926766
STS14 93303 34078508
STS15 103304 26251485
STS16 11220 3036363
STS17 102778 27232221
STS18 87018 34309974
STS19 98585 33303134
STS2 84303 49842494
STS20 55817 20848317
STS3 66925 26376700
STS4 76919 36916047
STS5 8502 4983828
STS6 54177 31603126
STS7 54081 31788805
STS8 54235 31906296
STS9 55657 37682948
SYN1 44175 73306214
SYN2 48626 68935678
SYN3 4313 7940830
TSA1 120497 38242009
TSA10 17443 8670141
TSA11 86486 70566494
TSA12 121991 38853496
TSA13 134869 35825795
TSA14 62213 80945472
TSA15 59466 91022180
TSA16 16046 15520912
TSA2 113538 41673356
TSA3 110398 41018325
TSA4 110953 45737544
TSA5 43142 10915358
TSA6 118117 60745378
TSA7 105776 72379622
TSA8 112890 59888795
TSA9 114942 56877810
UNA1 224 124411
VRL1 70075 67578303
VRL10 52981 69913280
VRL11 62618 71407166
VRL12 58360 72423043
VRL13 62700 65736002
VRL14 58983 73704212
VRL15 58119 71929049
VRL16 44466 44135322
VRL2 73389 64075691
VRL3 69926 61020769
VRL4 67741 70915656
VRL5 41383 43372148
VRL6 48351 77608996
VRL7 60845 70449778
VRL8 61014 73336368
VRL9 67135 68733300
VRT1 36159 132792593
VRT10 1256 189217442
VRT11 8274 177839690
VRT12 3992 136488828
VRT13 13096 170782830
VRT14 5352 182588855
VRT15 3937 185996611
VRT16 38062 133850025
VRT17 79948 68492856
VRT18 78399 66638493
VRT19 78248 65426031
VRT2 9076 181475706
VRT20 42037 130553649
VRT21 75716 63433702
VRT22 74576 57763063
VRT3 64730 88829307
VRT4 16665 159097094
VRT5 22780 18255145
VRT6 73011 66829312
VRT7 31735 63524393
VRT8 30664 111976676
VRT9 1203 190000786
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 182.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:
Entries Bases Species
16787340 15527594745 Homo sapiens
7893287 8901881284 Mus musculus
2180416 6489629823 Rattus norvegicus
2198182 5377845969 Bos taurus
3925025 5053398492 Zea mays
3220979 4807338941 Sus scrofa
1698417 3123978887 Danio rerio
228260 1352941097 Strongylocentrotus purpuratus
1279973 1222969693 Oryza sativa Japonica Group
1770010 1194612454 Nicotiana tabacum
1424245 1147209090 Xenopus (Silurana) tropicalis
1215073 1052326710 Drosophila melanogaster
2296179 1004573283 Arabidopsis thaliana
214007 1002239797 Pan troglodytes
1453357 943623915 Canis lupus familiaris
661285 914649587 Vitis vinifera
810690 893458855 Gallus gallus
1889644 893120157 Glycine max
82398 826325584 Macaca mulatta
1217091 748804606 Ciona intestinalis
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
October 15 2010
NCBI-GenBank Flat File Release 182.0
Bacterial Sequences (Part 1)
51396 loci, 92682287 bases, from 51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
or 2010.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA).
Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
DBLINK Project:18787
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK Project:100,200,300
DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:
http://www.ncbi.nlm.nih.gov/genomes/static/gprj_help.html#introduction
As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 182.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Michel Eschenbrenner, Irene Fang,
Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
Susan Schafer, Ruth Timme, Beverly Underwood, Melissa Wright, and Linda Yankie
Data Management and Preparation
Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
WonHee Jang, Jonathan Kans, Leonid Khotomliansky, Michael Kimelman,
Jim Ostell, Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov
Database Administration
Slava Khotomliansky, Igor Lozitskiy, Ben Slade, Constantin Vasilyev
User Support
Peter Cooper, Wayne Matten, Scott McGinnis, Steve Pechous, Monica Romiti,
Eric Sayers, Tao Tao, Majda Valjavec-Gratian
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
