Release Notes For GenBank Release 184
GBREL.TXT Genetic Sequence Data Bank
June 15 2011
NCBI-GenBank Flat File Release 184.0
Distribution Release Notes
140482268 loci, 129178292958 bases, from 140482268 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 184.0
1.2 Cutoff Date
1.3 Important Changes in Release 184.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 184.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for GenBank's web-based submission tool (BankIt) :
http://www.ncbi.nlm.nih.gov/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 184.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana, courtesy of the Bio-Mirror project:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:
http://www.bio-mirror.net/
1.2 Cutoff Date
This full release, 184.0, incorporates data available to the collaborating
databases as of April 29, 2011 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 184.0
1.3.1 Organizational changes
The total number of sequence data files increased by 60 with this release:
- the BCT division is now composed of 72 files (+4)
- the CON division is now composed of 149 files (+1)
- the ENV division is now composed of 40 files (-1)
- the EST division is now composed of 445 files (+10)
- the GSS division is now composed of 247 files (+10)
- the INV division is now composed of 30 files (+1)
- the PAT division is now composed of 164 files (+23)
- the PLN division is now composed of 48 files (+2)
- the TSA division is now composed of 30 files (+8)
- the VRL division is now composed of 18 files (+1)
- the VRT division is now composed of 24 files (+1)
The decrease in the number of ENV division files was caused by the
removal of nearly 100,000 uncultured bacterial sequence records from
an environmental sampling sequence project, which had been redundantly
submitted to GenBank twice.
The total number of 'index' files decreased by 18 with this release:
- the AUT (author name) index is now composed of 88 files (-20)
- the JOU (journal name) index is now composed of 12 files (+2)
The decrease in the number of AUT index files was due to both the removal
of redundantly-submitted bacterial sequence records (mentioned above), and
to corrections in the database where author names are separately stored
for the purpose of generating the gbaut* index files.
1.3.2 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.3 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
103 of the GSS flatfiles in Release 184.0. Consider gbgss145.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
June 15 2011
NCBI-GenBank Flat File Release 184.0
GSS Sequences (Part 1)
87117 loci, 64024027 bases, from 87117 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "145" based on the number of files dumped from the other
system. We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.
1.4 Upcoming Changes
The May 2011 International Nucleotide Sequence Database Collaboration annual
meeting resolved a variety of outstanding issues related to changes for the
/partial qualifier, the /inference and /experiment qualifiers, and the
/whole_replicon qualifier. In addition, some new changes for 2011 were agreed
upon. A summary of these changes will be provided via the GenBank newsgroup
within two months.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1638 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut74.idx - Index of the entries according to author name, part 74.
76. gbaut75.idx - Index of the entries according to author name, part 75.
77. gbaut76.idx - Index of the entries according to author name, part 76.
78. gbaut77.idx - Index of the entries according to author name, part 77.
79. gbaut78.idx - Index of the entries according to author name, part 78.
80. gbaut79.idx - Index of the entries according to author name, part 79.
81. gbaut8.idx - Index of the entries according to author name, part 8.
82. gbaut80.idx - Index of the entries according to author name, part 80.
83. gbaut81.idx - Index of the entries according to author name, part 81.
84. gbaut82.idx - Index of the entries according to author name, part 82.
85. gbaut83.idx - Index of the entries according to author name, part 83.
86. gbaut84.idx - Index of the entries according to author name, part 84.
87. gbaut85.idx - Index of the entries according to author name, part 85.
88. gbaut86.idx - Index of the entries according to author name, part 86.
89. gbaut87.idx - Index of the entries according to author name, part 87.
90. gbaut88.idx - Index of the entries according to author name, part 88.
91. gbaut9.idx - Index of the entries according to author name, part 9.
92. gbbct1.seq - Bacterial sequence entries, part 1.
93. gbbct10.seq - Bacterial sequence entries, part 10.
94. gbbct11.seq - Bacterial sequence entries, part 11.
95. gbbct12.seq - Bacterial sequence entries, part 12.
96. gbbct13.seq - Bacterial sequence entries, part 13.
97. gbbct14.seq - Bacterial sequence entries, part 14.
98. gbbct15.seq - Bacterial sequence entries, part 15.
99. gbbct16.seq - Bacterial sequence entries, part 16.
100. gbbct17.seq - Bacterial sequence entries, part 17.
101. gbbct18.seq - Bacterial sequence entries, part 18.
102. gbbct19.seq - Bacterial sequence entries, part 19.
103. gbbct2.seq - Bacterial sequence entries, part 2.
104. gbbct20.seq - Bacterial sequence entries, part 20.
105. gbbct21.seq - Bacterial sequence entries, part 21.
106. gbbct22.seq - Bacterial sequence entries, part 22.
107. gbbct23.seq - Bacterial sequence entries, part 23.
108. gbbct24.seq - Bacterial sequence entries, part 24.
109. gbbct25.seq - Bacterial sequence entries, part 25.
110. gbbct26.seq - Bacterial sequence entries, part 26.
111. gbbct27.seq - Bacterial sequence entries, part 27.
112. gbbct28.seq - Bacterial sequence entries, part 28.
113. gbbct29.seq - Bacterial sequence entries, part 29.
114. gbbct3.seq - Bacterial sequence entries, part 3.
115. gbbct30.seq - Bacterial sequence entries, part 30.
116. gbbct31.seq - Bacterial sequence entries, part 31.
117. gbbct32.seq - Bacterial sequence entries, part 32.
118. gbbct33.seq - Bacterial sequence entries, part 33.
119. gbbct34.seq - Bacterial sequence entries, part 34.
120. gbbct35.seq - Bacterial sequence entries, part 35.
121. gbbct36.seq - Bacterial sequence entries, part 36.
122. gbbct37.seq - Bacterial sequence entries, part 37.
123. gbbct38.seq - Bacterial sequence entries, part 38.
124. gbbct39.seq - Bacterial sequence entries, part 39.
125. gbbct4.seq - Bacterial sequence entries, part 4.
126. gbbct40.seq - Bacterial sequence entries, part 40.
127. gbbct41.seq - Bacterial sequence entries, part 41.
128. gbbct42.seq - Bacterial sequence entries, part 42.
129. gbbct43.seq - Bacterial sequence entries, part 43.
130. gbbct44.seq - Bacterial sequence entries, part 44.
131. gbbct45.seq - Bacterial sequence entries, part 45.
132. gbbct46.seq - Bacterial sequence entries, part 46.
133. gbbct47.seq - Bacterial sequence entries, part 47.
134. gbbct48.seq - Bacterial sequence entries, part 48.
135. gbbct49.seq - Bacterial sequence entries, part 49.
136. gbbct5.seq - Bacterial sequence entries, part 5.
137. gbbct50.seq - Bacterial sequence entries, part 50.
138. gbbct51.seq - Bacterial sequence entries, part 51.
139. gbbct52.seq - Bacterial sequence entries, part 52.
140. gbbct53.seq - Bacterial sequence entries, part 53.
141. gbbct54.seq - Bacterial sequence entries, part 54.
142. gbbct55.seq - Bacterial sequence entries, part 55.
143. gbbct56.seq - Bacterial sequence entries, part 56.
144. gbbct57.seq - Bacterial sequence entries, part 57.
145. gbbct58.seq - Bacterial sequence entries, part 58.
146. gbbct59.seq - Bacterial sequence entries, part 59.
147. gbbct6.seq - Bacterial sequence entries, part 6.
148. gbbct60.seq - Bacterial sequence entries, part 60.
149. gbbct61.seq - Bacterial sequence entries, part 61.
150. gbbct62.seq - Bacterial sequence entries, part 62.
151. gbbct63.seq - Bacterial sequence entries, part 63.
152. gbbct64.seq - Bacterial sequence entries, part 64.
153. gbbct65.seq - Bacterial sequence entries, part 65.
154. gbbct66.seq - Bacterial sequence entries, part 66.
155. gbbct67.seq - Bacterial sequence entries, part 67.
156. gbbct68.seq - Bacterial sequence entries, part 68.
157. gbbct69.seq - Bacterial sequence entries, part 69.
158. gbbct7.seq - Bacterial sequence entries, part 7.
159. gbbct70.seq - Bacterial sequence entries, part 70.
160. gbbct71.seq - Bacterial sequence entries, part 71.
161. gbbct72.seq - Bacterial sequence entries, part 72.
162. gbbct8.seq - Bacterial sequence entries, part 8.
163. gbbct9.seq - Bacterial sequence entries, part 9.
164. gbchg.txt - Accession numbers of entries updated since the previous release.
165. gbcon1.seq - Constructed sequence entries, part 1.
166. gbcon10.seq - Constructed sequence entries, part 10.
167. gbcon100.seq - Constructed sequence entries, part 100.
168. gbcon101.seq - Constructed sequence entries, part 101.
169. gbcon102.seq - Constructed sequence entries, part 102.
170. gbcon103.seq - Constructed sequence entries, part 103.
171. gbcon104.seq - Constructed sequence entries, part 104.
172. gbcon105.seq - Constructed sequence entries, part 105.
173. gbcon106.seq - Constructed sequence entries, part 106.
174. gbcon107.seq - Constructed sequence entries, part 107.
175. gbcon108.seq - Constructed sequence entries, part 108.
176. gbcon109.seq - Constructed sequence entries, part 109.
177. gbcon11.seq - Constructed sequence entries, part 11.
178. gbcon110.seq - Constructed sequence entries, part 110.
179. gbcon111.seq - Constructed sequence entries, part 111.
180. gbcon112.seq - Constructed sequence entries, part 112.
181. gbcon113.seq - Constructed sequence entries, part 113.
182. gbcon114.seq - Constructed sequence entries, part 114.
183. gbcon115.seq - Constructed sequence entries, part 115.
184. gbcon116.seq - Constructed sequence entries, part 116.
185. gbcon117.seq - Constructed sequence entries, part 117.
186. gbcon118.seq - Constructed sequence entries, part 118.
187. gbcon119.seq - Constructed sequence entries, part 119.
188. gbcon12.seq - Constructed sequence entries, part 12.
189. gbcon120.seq - Constructed sequence entries, part 120.
190. gbcon121.seq - Constructed sequence entries, part 121.
191. gbcon122.seq - Constructed sequence entries, part 122.
192. gbcon123.seq - Constructed sequence entries, part 123.
193. gbcon124.seq - Constructed sequence entries, part 124.
194. gbcon125.seq - Constructed sequence entries, part 125.
195. gbcon126.seq - Constructed sequence entries, part 126.
196. gbcon127.seq - Constructed sequence entries, part 127.
197. gbcon128.seq - Constructed sequence entries, part 128.
198. gbcon129.seq - Constructed sequence entries, part 129.
199. gbcon13.seq - Constructed sequence entries, part 13.
200. gbcon130.seq - Constructed sequence entries, part 130.
201. gbcon131.seq - Constructed sequence entries, part 131.
202. gbcon132.seq - Constructed sequence entries, part 132.
203. gbcon133.seq - Constructed sequence entries, part 133.
204. gbcon134.seq - Constructed sequence entries, part 134.
205. gbcon135.seq - Constructed sequence entries, part 135.
206. gbcon136.seq - Constructed sequence entries, part 136.
207. gbcon137.seq - Constructed sequence entries, part 137.
208. gbcon138.seq - Constructed sequence entries, part 138.
209. gbcon139.seq - Constructed sequence entries, part 139.
210. gbcon14.seq - Constructed sequence entries, part 14.
211. gbcon140.seq - Constructed sequence entries, part 140.
212. gbcon141.seq - Constructed sequence entries, part 141.
213. gbcon142.seq - Constructed sequence entries, part 142.
214. gbcon143.seq - Constructed sequence entries, part 143.
215. gbcon144.seq - Constructed sequence entries, part 144.
216. gbcon145.seq - Constructed sequence entries, part 145.
217. gbcon146.seq - Constructed sequence entries, part 146.
218. gbcon147.seq - Constructed sequence entries, part 147.
219. gbcon148.seq - Constructed sequence entries, part 148.
220. gbcon149.seq - Constructed sequence entries, part 149.
221. gbcon15.seq - Constructed sequence entries, part 15.
222. gbcon16.seq - Constructed sequence entries, part 16.
223. gbcon17.seq - Constructed sequence entries, part 17.
224. gbcon18.seq - Constructed sequence entries, part 18.
225. gbcon19.seq - Constructed sequence entries, part 19.
226. gbcon2.seq - Constructed sequence entries, part 2.
227. gbcon20.seq - Constructed sequence entries, part 20.
228. gbcon21.seq - Constructed sequence entries, part 21.
229. gbcon22.seq - Constructed sequence entries, part 22.
230. gbcon23.seq - Constructed sequence entries, part 23.
231. gbcon24.seq - Constructed sequence entries, part 24.
232. gbcon25.seq - Constructed sequence entries, part 25.
233. gbcon26.seq - Constructed sequence entries, part 26.
234. gbcon27.seq - Constructed sequence entries, part 27.
235. gbcon28.seq - Constructed sequence entries, part 28.
236. gbcon29.seq - Constructed sequence entries, part 29.
237. gbcon3.seq - Constructed sequence entries, part 3.
238. gbcon30.seq - Constructed sequence entries, part 30.
239. gbcon31.seq - Constructed sequence entries, part 31.
240. gbcon32.seq - Constructed sequence entries, part 32.
241. gbcon33.seq - Constructed sequence entries, part 33.
242. gbcon34.seq - Constructed sequence entries, part 34.
243. gbcon35.seq - Constructed sequence entries, part 35.
244. gbcon36.seq - Constructed sequence entries, part 36.
245. gbcon37.seq - Constructed sequence entries, part 37.
246. gbcon38.seq - Constructed sequence entries, part 38.
247. gbcon39.seq - Constructed sequence entries, part 39.
248. gbcon4.seq - Constructed sequence entries, part 4.
249. gbcon40.seq - Constructed sequence entries, part 40.
250. gbcon41.seq - Constructed sequence entries, part 41.
251. gbcon42.seq - Constructed sequence entries, part 42.
252. gbcon43.seq - Constructed sequence entries, part 43.
253. gbcon44.seq - Constructed sequence entries, part 44.
254. gbcon45.seq - Constructed sequence entries, part 45.
255. gbcon46.seq - Constructed sequence entries, part 46.
256. gbcon47.seq - Constructed sequence entries, part 47.
257. gbcon48.seq - Constructed sequence entries, part 48.
258. gbcon49.seq - Constructed sequence entries, part 49.
259. gbcon5.seq - Constructed sequence entries, part 5.
260. gbcon50.seq - Constructed sequence entries, part 50.
261. gbcon51.seq - Constructed sequence entries, part 51.
262. gbcon52.seq - Constructed sequence entries, part 52.
263. gbcon53.seq - Constructed sequence entries, part 53.
264. gbcon54.seq - Constructed sequence entries, part 54.
265. gbcon55.seq - Constructed sequence entries, part 55.
266. gbcon56.seq - Constructed sequence entries, part 56.
267. gbcon57.seq - Constructed sequence entries, part 57.
268. gbcon58.seq - Constructed sequence entries, part 58.
269. gbcon59.seq - Constructed sequence entries, part 59.
270. gbcon6.seq - Constructed sequence entries, part 6.
271. gbcon60.seq - Constructed sequence entries, part 60.
272. gbcon61.seq - Constructed sequence entries, part 61.
273. gbcon62.seq - Constructed sequence entries, part 62.
274. gbcon63.seq - Constructed sequence entries, part 63.
275. gbcon64.seq - Constructed sequence entries, part 64.
276. gbcon65.seq - Constructed sequence entries, part 65.
277. gbcon66.seq - Constructed sequence entries, part 66.
278. gbcon67.seq - Constructed sequence entries, part 67.
279. gbcon68.seq - Constructed sequence entries, part 68.
280. gbcon69.seq - Constructed sequence entries, part 69.
281. gbcon7.seq - Constructed sequence entries, part 7.
282. gbcon70.seq - Constructed sequence entries, part 70.
283. gbcon71.seq - Constructed sequence entries, part 71.
284. gbcon72.seq - Constructed sequence entries, part 72.
285. gbcon73.seq - Constructed sequence entries, part 73.
286. gbcon74.seq - Constructed sequence entries, part 74.
287. gbcon75.seq - Constructed sequence entries, part 75.
288. gbcon76.seq - Constructed sequence entries, part 76.
289. gbcon77.seq - Constructed sequence entries, part 77.
290. gbcon78.seq - Constructed sequence entries, part 78.
291. gbcon79.seq - Constructed sequence entries, part 79.
292. gbcon8.seq - Constructed sequence entries, part 8.
293. gbcon80.seq - Constructed sequence entries, part 80.
294. gbcon81.seq - Constructed sequence entries, part 81.
295. gbcon82.seq - Constructed sequence entries, part 82.
296. gbcon83.seq - Constructed sequence entries, part 83.
297. gbcon84.seq - Constructed sequence entries, part 84.
298. gbcon85.seq - Constructed sequence entries, part 85.
299. gbcon86.seq - Constructed sequence entries, part 86.
300. gbcon87.seq - Constructed sequence entries, part 87.
301. gbcon88.seq - Constructed sequence entries, part 88.
302. gbcon89.seq - Constructed sequence entries, part 89.
303. gbcon9.seq - Constructed sequence entries, part 9.
304. gbcon90.seq - Constructed sequence entries, part 90.
305. gbcon91.seq - Constructed sequence entries, part 91.
306. gbcon92.seq - Constructed sequence entries, part 92.
307. gbcon93.seq - Constructed sequence entries, part 93.
308. gbcon94.seq - Constructed sequence entries, part 94.
309. gbcon95.seq - Constructed sequence entries, part 95.
310. gbcon96.seq - Constructed sequence entries, part 96.
311. gbcon97.seq - Constructed sequence entries, part 97.
312. gbcon98.seq - Constructed sequence entries, part 98.
313. gbcon99.seq - Constructed sequence entries, part 99.
314. gbdel.txt - Accession numbers of entries deleted since the previous release.
315. gbenv1.seq - Environmental sampling sequence entries, part 1.
316. gbenv10.seq - Environmental sampling sequence entries, part 10.
317. gbenv11.seq - Environmental sampling sequence entries, part 11.
318. gbenv12.seq - Environmental sampling sequence entries, part 12.
319. gbenv13.seq - Environmental sampling sequence entries, part 13.
320. gbenv14.seq - Environmental sampling sequence entries, part 14.
321. gbenv15.seq - Environmental sampling sequence entries, part 15.
322. gbenv16.seq - Environmental sampling sequence entries, part 16.
323. gbenv17.seq - Environmental sampling sequence entries, part 17.
324. gbenv18.seq - Environmental sampling sequence entries, part 18.
325. gbenv19.seq - Environmental sampling sequence entries, part 19.
326. gbenv2.seq - Environmental sampling sequence entries, part 2.
327. gbenv20.seq - Environmental sampling sequence entries, part 20.
328. gbenv21.seq - Environmental sampling sequence entries, part 21.
329. gbenv22.seq - Environmental sampling sequence entries, part 22.
330. gbenv23.seq - Environmental sampling sequence entries, part 23.
331. gbenv24.seq - Environmental sampling sequence entries, part 24.
332. gbenv25.seq - Environmental sampling sequence entries, part 25.
333. gbenv26.seq - Environmental sampling sequence entries, part 26.
334. gbenv27.seq - Environmental sampling sequence entries, part 27.
335. gbenv28.seq - Environmental sampling sequence entries, part 28.
336. gbenv29.seq - Environmental sampling sequence entries, part 29.
337. gbenv3.seq - Environmental sampling sequence entries, part 3.
338. gbenv30.seq - Environmental sampling sequence entries, part 30.
339. gbenv31.seq - Environmental sampling sequence entries, part 31.
340. gbenv32.seq - Environmental sampling sequence entries, part 32.
341. gbenv33.seq - Environmental sampling sequence entries, part 33.
342. gbenv34.seq - Environmental sampling sequence entries, part 34.
343. gbenv35.seq - Environmental sampling sequence entries, part 35.
344. gbenv36.seq - Environmental sampling sequence entries, part 36.
345. gbenv37.seq - Environmental sampling sequence entries, part 37.
346. gbenv38.seq - Environmental sampling sequence entries, part 38.
347. gbenv39.seq - Environmental sampling sequence entries, part 39.
348. gbenv4.seq - Environmental sampling sequence entries, part 4.
349. gbenv40.seq - Environmental sampling sequence entries, part 40.
350. gbenv5.seq - Environmental sampling sequence entries, part 5.
351. gbenv6.seq - Environmental sampling sequence entries, part 6.
352. gbenv7.seq - Environmental sampling sequence entries, part 7.
353. gbenv8.seq - Environmental sampling sequence entries, part 8.
354. gbenv9.seq - Environmental sampling sequence entries, part 9.
355. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
356. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
357. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
358. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
359. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
360. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
361. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
362. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
363. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
364. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
365. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
366. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
367. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
368. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
369. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
370. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
371. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
372. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
373. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
374. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
375. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
376. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
377. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
378. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
379. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
380. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
381. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
382. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
383. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
384. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
385. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
386. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
387. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
388. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
389. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
390. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
391. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
392. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
393. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
394. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
395. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
396. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
397. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
398. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
399. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
400. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
401. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
402. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
403. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
404. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
405. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
406. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
407. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
408. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
409. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
410. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
411. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
412. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
413. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
414. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
415. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
416. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
417. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
418. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
419. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
420. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
421. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
422. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
423. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
424. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
425. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
426. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
427. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
428. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
429. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
430. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
431. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
432. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
433. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
434. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
435. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
436. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
437. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
438. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
439. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
440. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
441. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
442. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
443. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
444. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
445. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
446. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
447. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
448. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
449. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
450. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
451. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
452. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
453. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
454. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
455. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
456. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
457. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
458. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
459. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
460. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
461. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
462. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
463. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
464. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
465. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
466. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
467. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
468. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
469. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
470. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
471. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
472. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
473. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
474. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
475. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
476. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
477. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
478. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
479. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
480. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
481. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
482. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
483. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
484. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
485. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
486. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
487. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
488. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
489. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
490. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
491. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
492. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
493. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
494. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
495. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
496. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
497. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
498. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
499. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
500. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
501. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
502. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
503. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
504. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
505. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
506. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
507. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
508. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
509. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
510. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
511. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
512. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
513. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
514. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
515. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
516. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
517. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
518. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
519. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
520. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
521. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
522. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
523. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
524. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
525. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
526. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
527. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
528. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
529. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
530. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
531. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
532. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
533. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
534. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
535. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
536. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
537. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
538. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
539. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
540. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
541. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
542. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
543. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
544. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
545. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
546. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
547. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
548. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
549. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
550. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
551. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
552. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
553. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
554. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
555. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
556. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
557. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
558. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
559. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
560. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
561. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
562. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
563. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
564. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
565. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
566. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
567. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
568. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
569. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
570. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
571. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
572. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
573. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
574. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
575. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
576. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
577. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
578. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
579. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
580. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
581. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
582. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
583. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
584. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
585. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
586. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
587. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
588. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
589. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
590. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
591. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
592. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
593. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
594. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
595. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
596. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
597. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
598. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
599. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
600. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
601. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
602. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
603. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
604. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
605. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
606. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
607. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
608. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
609. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
610. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
611. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
612. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
613. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
614. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
615. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
616. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
617. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
618. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
619. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
620. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
621. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
622. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
623. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
624. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
625. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
626. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
627. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
628. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
629. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
630. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
631. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
632. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
633. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
634. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
635. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
636. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
637. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
638. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
639. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
640. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
641. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
642. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
643. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
644. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
645. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
646. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
647. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
648. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
649. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
650. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
651. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
652. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
653. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
654. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
655. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
656. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
657. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
658. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
659. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
660. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
661. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
662. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
663. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
664. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
665. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
666. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
667. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
668. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
669. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
670. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
671. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
672. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
673. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
674. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
675. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
676. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
677. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
678. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
679. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
680. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
681. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
682. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
683. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
684. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
685. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
686. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
687. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
688. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
689. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
690. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
691. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
692. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
693. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
694. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
695. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
696. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
697. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
698. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
699. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
700. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
701. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
702. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
703. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
704. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
705. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
706. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
707. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
708. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
709. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
710. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
711. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
712. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
713. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
714. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
715. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
716. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
717. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
718. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
719. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
720. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
721. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
722. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
723. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
724. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
725. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
726. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
727. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
728. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
729. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
730. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
731. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
732. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
733. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
734. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
735. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
736. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
737. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
738. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
739. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
740. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
741. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
742. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
743. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
744. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
745. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
746. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
747. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
748. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
749. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
750. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
751. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
752. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
753. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
754. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
755. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
756. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
757. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
758. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
759. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
760. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
761. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
762. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
763. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
764. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
765. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
766. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
767. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
768. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
769. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
770. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
771. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
772. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
773. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
774. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
775. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
776. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
777. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
778. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
779. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
780. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
781. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
782. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
783. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
784. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
785. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
786. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
787. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
788. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
789. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
790. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
791. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
792. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
793. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
794. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
795. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
796. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
797. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
798. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
799. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
800. gbgen.idx - Index of the entries according to gene symbols.
801. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
802. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
803. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
804. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
805. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
806. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
807. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
808. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
809. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
810. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
811. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
812. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
813. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
814. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
815. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
816. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
817. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
818. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
819. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
820. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
821. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
822. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
823. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
824. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
825. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
826. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
827. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
828. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
829. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
830. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
831. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
832. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
833. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
834. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
835. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
836. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
837. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
838. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
839. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
840. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
841. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
842. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
843. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
844. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
845. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
846. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
847. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
848. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
849. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
850. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
851. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
852. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
853. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
854. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
855. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
856. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
857. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
858. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
859. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
860. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
861. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
862. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
863. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
864. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
865. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
866. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
867. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
868. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
869. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
870. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
871. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
872. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
873. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
874. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
875. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
876. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
877. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
878. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
879. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
880. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
881. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
882. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
883. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
884. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
885. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
886. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
887. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
888. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
889. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
890. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
891. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
892. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
893. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
894. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
895. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
896. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
897. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
898. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
899. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
900. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
901. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
902. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
903. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
904. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
905. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
906. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
907. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
908. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
909. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
910. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
911. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
912. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
913. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
914. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
915. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
916. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
917. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
918. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
919. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
920. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
921. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
922. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
923. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
924. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
925. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
926. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
927. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
928. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
929. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
930. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
931. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
932. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
933. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
934. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
935. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
936. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
937. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
938. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
939. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
940. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
941. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
942. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
943. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
944. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
945. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
946. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
947. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
948. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
949. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
950. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
951. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
952. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
953. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
954. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
955. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
956. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
957. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
958. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
959. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
960. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
961. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
962. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
963. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
964. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
965. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
966. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
967. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
968. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
969. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
970. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
971. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
972. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
973. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
974. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
975. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
976. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
977. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
978. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
979. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
980. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
981. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
982. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
983. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
984. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
985. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
986. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
987. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
988. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
989. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
990. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
991. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
992. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
993. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
994. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
995. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
996. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
997. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
998. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
999. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1000. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1001. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1002. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1003. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1004. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1005. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1006. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1007. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1008. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1009. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1010. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1011. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1012. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1013. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1014. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1015. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1016. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1017. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1018. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1019. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1020. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1021. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1022. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1023. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1024. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1025. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1026. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1027. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1028. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1029. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1030. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1031. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1032. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1033. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1034. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1035. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1036. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1037. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1038. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1039. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1040. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1041. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1042. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1043. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1044. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1045. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1046. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1047. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1048. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1049. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1050. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1051. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1052. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1053. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1054. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1055. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1056. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1057. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1058. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1059. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1060. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1061. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1062. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1063. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1064. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1065. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1066. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1067. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1068. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1069. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1070. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1071. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1072. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1073. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1074. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1075. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1076. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1077. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1078. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1079. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1080. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1081. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1082. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1083. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1084. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1085. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1086. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1087. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1088. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1089. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1090. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1091. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1092. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1093. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1094. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1095. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1096. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1097. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1098. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1099. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1100. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1101. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1102. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1103. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1104. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1105. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1106. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1107. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1108. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1109. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1110. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1111. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1112. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1113. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1114. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1115. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1116. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1117. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1118. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1119. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1120. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1121. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1122. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1123. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1124. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1125. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1126. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1127. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1128. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1129. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1130. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1131. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1132. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1133. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1134. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1135. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1136. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1137. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1138. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1139. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1140. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1141. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1142. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1143. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1144. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1145. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1146. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1147. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1148. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1149. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1150. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1151. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1152. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1153. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1154. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1155. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1156. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1157. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1158. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1159. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1160. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1161. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1162. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1163. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1164. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1165. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1166. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1167. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1168. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1169. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1170. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1171. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1172. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1173. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1174. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1175. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1176. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1177. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1178. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1179. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1180. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1181. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1182. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1183. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1184. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1185. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1186. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1187. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1188. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1189. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1190. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1191. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1192. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1193. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1194. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1195. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1196. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1197. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1198. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1199. gbinv1.seq - Invertebrate sequence entries, part 1.
1200. gbinv10.seq - Invertebrate sequence entries, part 10.
1201. gbinv11.seq - Invertebrate sequence entries, part 11.
1202. gbinv12.seq - Invertebrate sequence entries, part 12.
1203. gbinv13.seq - Invertebrate sequence entries, part 13.
1204. gbinv14.seq - Invertebrate sequence entries, part 14.
1205. gbinv15.seq - Invertebrate sequence entries, part 15.
1206. gbinv16.seq - Invertebrate sequence entries, part 16.
1207. gbinv17.seq - Invertebrate sequence entries, part 17.
1208. gbinv18.seq - Invertebrate sequence entries, part 18.
1209. gbinv19.seq - Invertebrate sequence entries, part 19.
1210. gbinv2.seq - Invertebrate sequence entries, part 2.
1211. gbinv20.seq - Invertebrate sequence entries, part 20.
1212. gbinv21.seq - Invertebrate sequence entries, part 21.
1213. gbinv22.seq - Invertebrate sequence entries, part 22.
1214. gbinv23.seq - Invertebrate sequence entries, part 23.
1215. gbinv24.seq - Invertebrate sequence entries, part 24.
1216. gbinv25.seq - Invertebrate sequence entries, part 25.
1217. gbinv26.seq - Invertebrate sequence entries, part 26.
1218. gbinv27.seq - Invertebrate sequence entries, part 27.
1219. gbinv28.seq - Invertebrate sequence entries, part 28.
1220. gbinv29.seq - Invertebrate sequence entries, part 29.
1221. gbinv3.seq - Invertebrate sequence entries, part 3.
1222. gbinv30.seq - Invertebrate sequence entries, part 30.
1223. gbinv4.seq - Invertebrate sequence entries, part 4.
1224. gbinv5.seq - Invertebrate sequence entries, part 5.
1225. gbinv6.seq - Invertebrate sequence entries, part 6.
1226. gbinv7.seq - Invertebrate sequence entries, part 7.
1227. gbinv8.seq - Invertebrate sequence entries, part 8.
1228. gbinv9.seq - Invertebrate sequence entries, part 9.
1229. gbjou1.idx - Index of the entries according to journal citation, part 1.
1230. gbjou10.idx - Index of the entries according to journal citation, part 10.
1231. gbjou11.idx - Index of the entries according to journal citation, part 11.
1232. gbjou12.idx - Index of the entries according to journal citation, part 12.
1233. gbjou2.idx - Index of the entries according to journal citation, part 2.
1234. gbjou3.idx - Index of the entries according to journal citation, part 3.
1235. gbjou4.idx - Index of the entries according to journal citation, part 4.
1236. gbjou5.idx - Index of the entries according to journal citation, part 5.
1237. gbjou6.idx - Index of the entries according to journal citation, part 6.
1238. gbjou7.idx - Index of the entries according to journal citation, part 7.
1239. gbjou8.idx - Index of the entries according to journal citation, part 8.
1240. gbjou9.idx - Index of the entries according to journal citation, part 9.
1241. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1242. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1243. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1244. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1245. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1246. gbmam1.seq - Other mammalian sequence entries, part 1.
1247. gbmam2.seq - Other mammalian sequence entries, part 2.
1248. gbmam3.seq - Other mammalian sequence entries, part 3.
1249. gbmam4.seq - Other mammalian sequence entries, part 4.
1250. gbmam5.seq - Other mammalian sequence entries, part 5.
1251. gbmam6.seq - Other mammalian sequence entries, part 6.
1252. gbmam7.seq - Other mammalian sequence entries, part 7.
1253. gbnew.txt - Accession numbers of entries new since the previous release.
1254. gbpat1.seq - Patent sequence entries, part 1.
1255. gbpat10.seq - Patent sequence entries, part 10.
1256. gbpat100.seq - Patent sequence entries, part 100.
1257. gbpat101.seq - Patent sequence entries, part 101.
1258. gbpat102.seq - Patent sequence entries, part 102.
1259. gbpat103.seq - Patent sequence entries, part 103.
1260. gbpat104.seq - Patent sequence entries, part 104.
1261. gbpat105.seq - Patent sequence entries, part 105.
1262. gbpat106.seq - Patent sequence entries, part 106.
1263. gbpat107.seq - Patent sequence entries, part 107.
1264. gbpat108.seq - Patent sequence entries, part 108.
1265. gbpat109.seq - Patent sequence entries, part 109.
1266. gbpat11.seq - Patent sequence entries, part 11.
1267. gbpat110.seq - Patent sequence entries, part 110.
1268. gbpat111.seq - Patent sequence entries, part 111.
1269. gbpat112.seq - Patent sequence entries, part 112.
1270. gbpat113.seq - Patent sequence entries, part 113.
1271. gbpat114.seq - Patent sequence entries, part 114.
1272. gbpat115.seq - Patent sequence entries, part 115.
1273. gbpat116.seq - Patent sequence entries, part 116.
1274. gbpat117.seq - Patent sequence entries, part 117.
1275. gbpat118.seq - Patent sequence entries, part 118.
1276. gbpat119.seq - Patent sequence entries, part 119.
1277. gbpat12.seq - Patent sequence entries, part 12.
1278. gbpat120.seq - Patent sequence entries, part 120.
1279. gbpat121.seq - Patent sequence entries, part 121.
1280. gbpat122.seq - Patent sequence entries, part 122.
1281. gbpat123.seq - Patent sequence entries, part 123.
1282. gbpat124.seq - Patent sequence entries, part 124.
1283. gbpat125.seq - Patent sequence entries, part 125.
1284. gbpat126.seq - Patent sequence entries, part 126.
1285. gbpat127.seq - Patent sequence entries, part 127.
1286. gbpat128.seq - Patent sequence entries, part 128.
1287. gbpat129.seq - Patent sequence entries, part 129.
1288. gbpat13.seq - Patent sequence entries, part 13.
1289. gbpat130.seq - Patent sequence entries, part 130.
1290. gbpat131.seq - Patent sequence entries, part 131.
1291. gbpat132.seq - Patent sequence entries, part 132.
1292. gbpat133.seq - Patent sequence entries, part 133.
1293. gbpat134.seq - Patent sequence entries, part 134.
1294. gbpat135.seq - Patent sequence entries, part 135.
1295. gbpat136.seq - Patent sequence entries, part 136.
1296. gbpat137.seq - Patent sequence entries, part 137.
1297. gbpat138.seq - Patent sequence entries, part 138.
1298. gbpat139.seq - Patent sequence entries, part 139.
1299. gbpat14.seq - Patent sequence entries, part 14.
1300. gbpat140.seq - Patent sequence entries, part 140.
1301. gbpat141.seq - Patent sequence entries, part 141.
1302. gbpat142.seq - Patent sequence entries, part 142.
1303. gbpat143.seq - Patent sequence entries, part 143.
1304. gbpat144.seq - Patent sequence entries, part 144.
1305. gbpat145.seq - Patent sequence entries, part 145.
1306. gbpat146.seq - Patent sequence entries, part 146.
1307. gbpat147.seq - Patent sequence entries, part 147.
1308. gbpat148.seq - Patent sequence entries, part 148.
1309. gbpat149.seq - Patent sequence entries, part 149.
1310. gbpat15.seq - Patent sequence entries, part 15.
1311. gbpat150.seq - Patent sequence entries, part 150.
1312. gbpat151.seq - Patent sequence entries, part 151.
1313. gbpat152.seq - Patent sequence entries, part 152.
1314. gbpat153.seq - Patent sequence entries, part 153.
1315. gbpat154.seq - Patent sequence entries, part 154.
1316. gbpat155.seq - Patent sequence entries, part 155.
1317. gbpat156.seq - Patent sequence entries, part 156.
1318. gbpat157.seq - Patent sequence entries, part 157.
1319. gbpat158.seq - Patent sequence entries, part 158.
1320. gbpat159.seq - Patent sequence entries, part 159.
1321. gbpat16.seq - Patent sequence entries, part 16.
1322. gbpat160.seq - Patent sequence entries, part 160.
1323. gbpat161.seq - Patent sequence entries, part 161.
1324. gbpat162.seq - Patent sequence entries, part 162.
1325. gbpat163.seq - Patent sequence entries, part 163.
1326. gbpat164.seq - Patent sequence entries, part 164.
1327. gbpat17.seq - Patent sequence entries, part 17.
1328. gbpat18.seq - Patent sequence entries, part 18.
1329. gbpat19.seq - Patent sequence entries, part 19.
1330. gbpat2.seq - Patent sequence entries, part 2.
1331. gbpat20.seq - Patent sequence entries, part 20.
1332. gbpat21.seq - Patent sequence entries, part 21.
1333. gbpat22.seq - Patent sequence entries, part 22.
1334. gbpat23.seq - Patent sequence entries, part 23.
1335. gbpat24.seq - Patent sequence entries, part 24.
1336. gbpat25.seq - Patent sequence entries, part 25.
1337. gbpat26.seq - Patent sequence entries, part 26.
1338. gbpat27.seq - Patent sequence entries, part 27.
1339. gbpat28.seq - Patent sequence entries, part 28.
1340. gbpat29.seq - Patent sequence entries, part 29.
1341. gbpat3.seq - Patent sequence entries, part 3.
1342. gbpat30.seq - Patent sequence entries, part 30.
1343. gbpat31.seq - Patent sequence entries, part 31.
1344. gbpat32.seq - Patent sequence entries, part 32.
1345. gbpat33.seq - Patent sequence entries, part 33.
1346. gbpat34.seq - Patent sequence entries, part 34.
1347. gbpat35.seq - Patent sequence entries, part 35.
1348. gbpat36.seq - Patent sequence entries, part 36.
1349. gbpat37.seq - Patent sequence entries, part 37.
1350. gbpat38.seq - Patent sequence entries, part 38.
1351. gbpat39.seq - Patent sequence entries, part 39.
1352. gbpat4.seq - Patent sequence entries, part 4.
1353. gbpat40.seq - Patent sequence entries, part 40.
1354. gbpat41.seq - Patent sequence entries, part 41.
1355. gbpat42.seq - Patent sequence entries, part 42.
1356. gbpat43.seq - Patent sequence entries, part 43.
1357. gbpat44.seq - Patent sequence entries, part 44.
1358. gbpat45.seq - Patent sequence entries, part 45.
1359. gbpat46.seq - Patent sequence entries, part 46.
1360. gbpat47.seq - Patent sequence entries, part 47.
1361. gbpat48.seq - Patent sequence entries, part 48.
1362. gbpat49.seq - Patent sequence entries, part 49.
1363. gbpat5.seq - Patent sequence entries, part 5.
1364. gbpat50.seq - Patent sequence entries, part 50.
1365. gbpat51.seq - Patent sequence entries, part 51.
1366. gbpat52.seq - Patent sequence entries, part 52.
1367. gbpat53.seq - Patent sequence entries, part 53.
1368. gbpat54.seq - Patent sequence entries, part 54.
1369. gbpat55.seq - Patent sequence entries, part 55.
1370. gbpat56.seq - Patent sequence entries, part 56.
1371. gbpat57.seq - Patent sequence entries, part 57.
1372. gbpat58.seq - Patent sequence entries, part 58.
1373. gbpat59.seq - Patent sequence entries, part 59.
1374. gbpat6.seq - Patent sequence entries, part 6.
1375. gbpat60.seq - Patent sequence entries, part 60.
1376. gbpat61.seq - Patent sequence entries, part 61.
1377. gbpat62.seq - Patent sequence entries, part 62.
1378. gbpat63.seq - Patent sequence entries, part 63.
1379. gbpat64.seq - Patent sequence entries, part 64.
1380. gbpat65.seq - Patent sequence entries, part 65.
1381. gbpat66.seq - Patent sequence entries, part 66.
1382. gbpat67.seq - Patent sequence entries, part 67.
1383. gbpat68.seq - Patent sequence entries, part 68.
1384. gbpat69.seq - Patent sequence entries, part 69.
1385. gbpat7.seq - Patent sequence entries, part 7.
1386. gbpat70.seq - Patent sequence entries, part 70.
1387. gbpat71.seq - Patent sequence entries, part 71.
1388. gbpat72.seq - Patent sequence entries, part 72.
1389. gbpat73.seq - Patent sequence entries, part 73.
1390. gbpat74.seq - Patent sequence entries, part 74.
1391. gbpat75.seq - Patent sequence entries, part 75.
1392. gbpat76.seq - Patent sequence entries, part 76.
1393. gbpat77.seq - Patent sequence entries, part 77.
1394. gbpat78.seq - Patent sequence entries, part 78.
1395. gbpat79.seq - Patent sequence entries, part 79.
1396. gbpat8.seq - Patent sequence entries, part 8.
1397. gbpat80.seq - Patent sequence entries, part 80.
1398. gbpat81.seq - Patent sequence entries, part 81.
1399. gbpat82.seq - Patent sequence entries, part 82.
1400. gbpat83.seq - Patent sequence entries, part 83.
1401. gbpat84.seq - Patent sequence entries, part 84.
1402. gbpat85.seq - Patent sequence entries, part 85.
1403. gbpat86.seq - Patent sequence entries, part 86.
1404. gbpat87.seq - Patent sequence entries, part 87.
1405. gbpat88.seq - Patent sequence entries, part 88.
1406. gbpat89.seq - Patent sequence entries, part 89.
1407. gbpat9.seq - Patent sequence entries, part 9.
1408. gbpat90.seq - Patent sequence entries, part 90.
1409. gbpat91.seq - Patent sequence entries, part 91.
1410. gbpat92.seq - Patent sequence entries, part 92.
1411. gbpat93.seq - Patent sequence entries, part 93.
1412. gbpat94.seq - Patent sequence entries, part 94.
1413. gbpat95.seq - Patent sequence entries, part 95.
1414. gbpat96.seq - Patent sequence entries, part 96.
1415. gbpat97.seq - Patent sequence entries, part 97.
1416. gbpat98.seq - Patent sequence entries, part 98.
1417. gbpat99.seq - Patent sequence entries, part 99.
1418. gbphg1.seq - Phage sequence entries, part 1.
1419. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1420. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1421. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1422. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1423. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1424. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1425. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1426. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1427. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1428. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1429. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1430. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1431. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1432. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1433. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1434. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1435. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1436. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1437. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1438. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1439. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1440. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1441. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1442. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1443. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1444. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1445. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1446. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1447. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1448. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1449. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1450. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1451. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1452. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1453. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1454. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1455. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1456. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1457. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1458. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1459. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1460. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1461. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1462. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1463. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1464. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1465. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1466. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1467. gbpri1.seq - Primate sequence entries, part 1.
1468. gbpri10.seq - Primate sequence entries, part 10.
1469. gbpri11.seq - Primate sequence entries, part 11.
1470. gbpri12.seq - Primate sequence entries, part 12.
1471. gbpri13.seq - Primate sequence entries, part 13.
1472. gbpri14.seq - Primate sequence entries, part 14.
1473. gbpri15.seq - Primate sequence entries, part 15.
1474. gbpri16.seq - Primate sequence entries, part 16.
1475. gbpri17.seq - Primate sequence entries, part 17.
1476. gbpri18.seq - Primate sequence entries, part 18.
1477. gbpri19.seq - Primate sequence entries, part 19.
1478. gbpri2.seq - Primate sequence entries, part 2.
1479. gbpri20.seq - Primate sequence entries, part 20.
1480. gbpri21.seq - Primate sequence entries, part 21.
1481. gbpri22.seq - Primate sequence entries, part 22.
1482. gbpri23.seq - Primate sequence entries, part 23.
1483. gbpri24.seq - Primate sequence entries, part 24.
1484. gbpri25.seq - Primate sequence entries, part 25.
1485. gbpri26.seq - Primate sequence entries, part 26.
1486. gbpri27.seq - Primate sequence entries, part 27.
1487. gbpri28.seq - Primate sequence entries, part 28.
1488. gbpri29.seq - Primate sequence entries, part 29.
1489. gbpri3.seq - Primate sequence entries, part 3.
1490. gbpri30.seq - Primate sequence entries, part 30.
1491. gbpri31.seq - Primate sequence entries, part 31.
1492. gbpri32.seq - Primate sequence entries, part 32.
1493. gbpri33.seq - Primate sequence entries, part 33.
1494. gbpri34.seq - Primate sequence entries, part 34.
1495. gbpri35.seq - Primate sequence entries, part 35.
1496. gbpri36.seq - Primate sequence entries, part 36.
1497. gbpri37.seq - Primate sequence entries, part 37.
1498. gbpri38.seq - Primate sequence entries, part 38.
1499. gbpri39.seq - Primate sequence entries, part 39.
1500. gbpri4.seq - Primate sequence entries, part 4.
1501. gbpri40.seq - Primate sequence entries, part 40.
1502. gbpri41.seq - Primate sequence entries, part 41.
1503. gbpri42.seq - Primate sequence entries, part 42.
1504. gbpri5.seq - Primate sequence entries, part 5.
1505. gbpri6.seq - Primate sequence entries, part 6.
1506. gbpri7.seq - Primate sequence entries, part 7.
1507. gbpri8.seq - Primate sequence entries, part 8.
1508. gbpri9.seq - Primate sequence entries, part 9.
1509. gbrel.txt - Release notes (this document).
1510. gbrod1.seq - Rodent sequence entries, part 1.
1511. gbrod10.seq - Rodent sequence entries, part 10.
1512. gbrod11.seq - Rodent sequence entries, part 11.
1513. gbrod12.seq - Rodent sequence entries, part 12.
1514. gbrod13.seq - Rodent sequence entries, part 13.
1515. gbrod14.seq - Rodent sequence entries, part 14.
1516. gbrod15.seq - Rodent sequence entries, part 15.
1517. gbrod16.seq - Rodent sequence entries, part 16.
1518. gbrod17.seq - Rodent sequence entries, part 17.
1519. gbrod18.seq - Rodent sequence entries, part 18.
1520. gbrod19.seq - Rodent sequence entries, part 19.
1521. gbrod2.seq - Rodent sequence entries, part 2.
1522. gbrod20.seq - Rodent sequence entries, part 20.
1523. gbrod21.seq - Rodent sequence entries, part 21.
1524. gbrod22.seq - Rodent sequence entries, part 22.
1525. gbrod23.seq - Rodent sequence entries, part 23.
1526. gbrod24.seq - Rodent sequence entries, part 24.
1527. gbrod25.seq - Rodent sequence entries, part 25.
1528. gbrod26.seq - Rodent sequence entries, part 26.
1529. gbrod27.seq - Rodent sequence entries, part 27.
1530. gbrod28.seq - Rodent sequence entries, part 28.
1531. gbrod29.seq - Rodent sequence entries, part 29.
1532. gbrod3.seq - Rodent sequence entries, part 3.
1533. gbrod4.seq - Rodent sequence entries, part 4.
1534. gbrod5.seq - Rodent sequence entries, part 5.
1535. gbrod6.seq - Rodent sequence entries, part 6.
1536. gbrod7.seq - Rodent sequence entries, part 7.
1537. gbrod8.seq - Rodent sequence entries, part 8.
1538. gbrod9.seq - Rodent sequence entries, part 9.
1539. gbsdr1.txt - Short directory of the data bank, part 1.
1540. gbsdr2.txt - Short directory of the data bank, part 2.
1541. gbsdr3.txt - Short directory of the data bank, part 3.
1542. gbsec.idx - Index of the entries according to secondary accession number.
1543. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1544. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1545. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1546. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1547. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1548. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1549. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1550. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1551. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1552. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1553. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1554. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1555. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1556. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1557. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1558. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1559. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1560. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1561. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1562. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1563. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1564. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1565. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1566. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1567. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1568. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1569. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1570. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1571. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1572. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1573. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1574. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1575. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1576. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1577. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1578. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1579. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1580. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1581. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1582. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1583. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1584. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1585. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1586. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1587. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1588. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1589. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1590. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1591. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1592. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1593. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1594. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1595. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1596. gbuna1.seq - Unannotated sequence entries, part 1.
1597. gbvrl1.seq - Viral sequence entries, part 1.
1598. gbvrl10.seq - Viral sequence entries, part 10.
1599. gbvrl11.seq - Viral sequence entries, part 11.
1600. gbvrl12.seq - Viral sequence entries, part 12.
1601. gbvrl13.seq - Viral sequence entries, part 13.
1602. gbvrl14.seq - Viral sequence entries, part 14.
1603. gbvrl15.seq - Viral sequence entries, part 15.
1604. gbvrl16.seq - Viral sequence entries, part 16.
1605. gbvrl17.seq - Viral sequence entries, part 17.
1606. gbvrl18.seq - Viral sequence entries, part 18.
1607. gbvrl2.seq - Viral sequence entries, part 2.
1608. gbvrl3.seq - Viral sequence entries, part 3.
1609. gbvrl4.seq - Viral sequence entries, part 4.
1610. gbvrl5.seq - Viral sequence entries, part 5.
1611. gbvrl6.seq - Viral sequence entries, part 6.
1612. gbvrl7.seq - Viral sequence entries, part 7.
1613. gbvrl8.seq - Viral sequence entries, part 8.
1614. gbvrl9.seq - Viral sequence entries, part 9.
1615. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1616. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1617. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1618. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1619. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1620. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1621. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1622. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1623. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1624. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1625. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1626. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1627. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1628. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1629. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1630. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1631. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1632. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1633. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1634. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1635. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1636. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1637. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1638. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 184.0 flatfiles require roughly 506 GB (sequence
files only) or 543 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1744585798 gbacc1.idx
2305583775 gbacc2.idx
793808175 gbacc3.idx
184373159 gbaut1.idx
184525575 gbaut10.idx
228396590 gbaut11.idx
183776782 gbaut12.idx
185229802 gbaut13.idx
183753662 gbaut14.idx
196420235 gbaut15.idx
239591371 gbaut16.idx
183679887 gbaut17.idx
235561927 gbaut18.idx
183777852 gbaut19.idx
215028881 gbaut2.idx
188226875 gbaut20.idx
249272155 gbaut21.idx
210753027 gbaut22.idx
184256904 gbaut23.idx
209942860 gbaut24.idx
183885531 gbaut25.idx
187104119 gbaut26.idx
184141290 gbaut27.idx
184127620 gbaut28.idx
184221514 gbaut29.idx
208006023 gbaut3.idx
183837398 gbaut30.idx
189760007 gbaut31.idx
185903720 gbaut32.idx
185549787 gbaut33.idx
241909374 gbaut34.idx
185069539 gbaut35.idx
210393203 gbaut36.idx
185787981 gbaut37.idx
185522868 gbaut38.idx
184116366 gbaut39.idx
183932287 gbaut4.idx
197890955 gbaut40.idx
196441218 gbaut41.idx
184675043 gbaut42.idx
185520617 gbaut43.idx
185324316 gbaut44.idx
184195507 gbaut45.idx
245503486 gbaut46.idx
209535984 gbaut47.idx
188245912 gbaut48.idx
219285229 gbaut49.idx
199782531 gbaut5.idx
184193058 gbaut50.idx
187205705 gbaut51.idx
192287700 gbaut52.idx
185860218 gbaut53.idx
205547020 gbaut54.idx
184086175 gbaut55.idx
185104779 gbaut56.idx
184065939 gbaut57.idx
184710298 gbaut58.idx
183820420 gbaut59.idx
188416935 gbaut6.idx
184465849 gbaut60.idx
189526462 gbaut61.idx
255533694 gbaut62.idx
184927794 gbaut63.idx
183831045 gbaut64.idx
201868105 gbaut65.idx
184162734 gbaut66.idx
185560065 gbaut67.idx
183778703 gbaut68.idx
219245755 gbaut69.idx
183938906 gbaut7.idx
217081533 gbaut70.idx
211291998 gbaut71.idx
183857052 gbaut72.idx
185549647 gbaut73.idx
183976985 gbaut74.idx
183964236 gbaut75.idx
194758704 gbaut76.idx
183739413 gbaut77.idx
210945311 gbaut78.idx
196031235 gbaut79.idx
185585482 gbaut8.idx
197217280 gbaut80.idx
245223968 gbaut81.idx
186000546 gbaut82.idx
184009548 gbaut83.idx
183787831 gbaut84.idx
185378662 gbaut85.idx
184575339 gbaut86.idx
189509006 gbaut87.idx
103022657 gbaut88.idx
184069411 gbaut9.idx
244435676 gbbct1.seq
249634003 gbbct10.seq
245177103 gbbct11.seq
213157070 gbbct12.seq
243124731 gbbct13.seq
249864964 gbbct14.seq
245549914 gbbct15.seq
248696898 gbbct16.seq
247986940 gbbct17.seq
249284896 gbbct18.seq
247284383 gbbct19.seq
248910307 gbbct2.seq
239678256 gbbct20.seq
217808759 gbbct21.seq
242806493 gbbct22.seq
241491847 gbbct23.seq
248678554 gbbct24.seq
247892628 gbbct25.seq
249390239 gbbct26.seq
244188289 gbbct27.seq
247135774 gbbct28.seq
249999671 gbbct29.seq
249285281 gbbct3.seq
249760572 gbbct30.seq
249791977 gbbct31.seq
242939806 gbbct32.seq
243142050 gbbct33.seq
149253431 gbbct34.seq
243879336 gbbct35.seq
246112207 gbbct36.seq
246758272 gbbct37.seq
244987919 gbbct38.seq
247971314 gbbct39.seq
249960430 gbbct4.seq
249448502 gbbct40.seq
244563567 gbbct41.seq
245404165 gbbct42.seq
249009345 gbbct43.seq
248344094 gbbct44.seq
233311074 gbbct45.seq
42209814 gbbct46.seq
245564828 gbbct47.seq
239384024 gbbct48.seq
247999958 gbbct49.seq
165629355 gbbct5.seq
247353060 gbbct50.seq
248649010 gbbct51.seq
231242719 gbbct52.seq
245388315 gbbct53.seq
243082648 gbbct54.seq
247320412 gbbct55.seq
242484526 gbbct56.seq
6881041 gbbct57.seq
14090959 gbbct58.seq
23156612 gbbct59.seq
242131627 gbbct6.seq
45089017 gbbct60.seq
87756290 gbbct61.seq
169947444 gbbct62.seq
250000166 gbbct63.seq
249998743 gbbct64.seq
247817902 gbbct65.seq
249165800 gbbct66.seq
247988089 gbbct67.seq
247693790 gbbct68.seq
249999904 gbbct69.seq
247969547 gbbct7.seq
249998410 gbbct70.seq
250000246 gbbct71.seq
219910865 gbbct72.seq
248625850 gbbct8.seq
241464028 gbbct9.seq
39773770 gbchg.txt
249999249 gbcon1.seq
249996514 gbcon10.seq
249995660 gbcon100.seq
249998605 gbcon101.seq
249998936 gbcon102.seq
250000223 gbcon103.seq
156342446 gbcon104.seq
249996812 gbcon105.seq
249993767 gbcon106.seq
249992301 gbcon107.seq
249998322 gbcon108.seq
71615782 gbcon109.seq
249998969 gbcon11.seq
249997862 gbcon110.seq
249998650 gbcon111.seq
208522809 gbcon112.seq
250000256 gbcon113.seq
250000098 gbcon114.seq
249995503 gbcon115.seq
249706533 gbcon116.seq
163127783 gbcon117.seq
249779275 gbcon118.seq
249998717 gbcon119.seq
248683455 gbcon12.seq
105265679 gbcon120.seq
249997002 gbcon121.seq
249998975 gbcon122.seq
249999596 gbcon123.seq
249668049 gbcon124.seq
26282865 gbcon125.seq
249999604 gbcon126.seq
249838518 gbcon127.seq
249924254 gbcon128.seq
249999929 gbcon129.seq
247344551 gbcon13.seq
249998814 gbcon130.seq
218016237 gbcon131.seq
249999839 gbcon132.seq
249985338 gbcon133.seq
249819716 gbcon134.seq
249993762 gbcon135.seq
249999846 gbcon136.seq
248313325 gbcon137.seq
250000042 gbcon138.seq
249556201 gbcon139.seq
249998806 gbcon14.seq
103932155 gbcon140.seq
249184635 gbcon141.seq
249999310 gbcon142.seq
249999305 gbcon143.seq
249990998 gbcon144.seq
249997627 gbcon145.seq
249995212 gbcon146.seq
249987113 gbcon147.seq
158061339 gbcon148.seq
21084201 gbcon149.seq
60349545 gbcon15.seq
249821933 gbcon16.seq
249996499 gbcon17.seq
155322820 gbcon18.seq
250000142 gbcon19.seq
248150040 gbcon2.seq
248022413 gbcon20.seq
122899685 gbcon21.seq
249998506 gbcon22.seq
120044016 gbcon23.seq
249996870 gbcon24.seq
249774546 gbcon25.seq
249999078 gbcon26.seq
249996506 gbcon27.seq
201045147 gbcon28.seq
249999800 gbcon29.seq
249834404 gbcon3.seq
249997309 gbcon30.seq
249999857 gbcon31.seq
249999952 gbcon32.seq
247968337 gbcon33.seq
234568834 gbcon34.seq
249999237 gbcon35.seq
249996869 gbcon36.seq
249995921 gbcon37.seq
249996351 gbcon38.seq
249999450 gbcon39.seq
249977151 gbcon4.seq
249997210 gbcon40.seq
61183731 gbcon41.seq
249997486 gbcon42.seq
249994070 gbcon43.seq
249999391 gbcon44.seq
249997743 gbcon45.seq
249994859 gbcon46.seq
43089049 gbcon47.seq
249993995 gbcon48.seq
249996310 gbcon49.seq
249993232 gbcon5.seq
249994442 gbcon50.seq
249997248 gbcon51.seq
250000078 gbcon52.seq
36404971 gbcon53.seq
249993185 gbcon54.seq
249998119 gbcon55.seq
249995170 gbcon56.seq
249998154 gbcon57.seq
249998078 gbcon58.seq
152679523 gbcon59.seq
249991519 gbcon6.seq
249999955 gbcon60.seq
249999066 gbcon61.seq
249997558 gbcon62.seq
249998625 gbcon63.seq
183609322 gbcon64.seq
249999870 gbcon65.seq
249997967 gbcon66.seq
249997138 gbcon67.seq
249995207 gbcon68.seq
245488804 gbcon69.seq
249996976 gbcon7.seq
250000182 gbcon70.seq
249998695 gbcon71.seq
249998372 gbcon72.seq
249996966 gbcon73.seq
250000007 gbcon74.seq
96627683 gbcon75.seq
249993448 gbcon76.seq
249995119 gbcon77.seq
249997383 gbcon78.seq
249995948 gbcon79.seq
1609283 gbcon8.seq
249999042 gbcon80.seq
62682749 gbcon81.seq
249997771 gbcon82.seq
249996653 gbcon83.seq
249999445 gbcon84.seq
249999590 gbcon85.seq
249998149 gbcon86.seq
21674116 gbcon87.seq
249998140 gbcon88.seq
249997503 gbcon89.seq
249997708 gbcon9.seq
249996940 gbcon90.seq
249995720 gbcon91.seq
197881888 gbcon92.seq
249993974 gbcon93.seq
249996060 gbcon94.seq
249999726 gbcon95.seq
249998645 gbcon96.seq
249996901 gbcon97.seq
133265984 gbcon98.seq
249994222 gbcon99.seq
1962170 gbdel.txt
249999877 gbenv1.seq
249999127 gbenv10.seq
52921709 gbenv11.seq
249999384 gbenv12.seq
249999044 gbenv13.seq
249998276 gbenv14.seq
249998107 gbenv15.seq
249999400 gbenv16.seq
249996627 gbenv17.seq
224401793 gbenv18.seq
249999614 gbenv19.seq
249998771 gbenv2.seq
250000199 gbenv20.seq
250000225 gbenv21.seq
250000001 gbenv22.seq
126816814 gbenv23.seq
249999737 gbenv24.seq
249999544 gbenv25.seq
249998971 gbenv26.seq
249999094 gbenv27.seq
249999469 gbenv28.seq
77124601 gbenv29.seq
249997481 gbenv3.seq
249998069 gbenv30.seq
249995998 gbenv31.seq
249998733 gbenv32.seq
249998623 gbenv33.seq
114090066 gbenv34.seq
249999257 gbenv35.seq
249998393 gbenv36.seq
249999509 gbenv37.seq
249999375 gbenv38.seq
249998190 gbenv39.seq
249998802 gbenv4.seq
114712432 gbenv40.seq
249999253 gbenv5.seq
163362868 gbenv6.seq
249998988 gbenv7.seq
249997718 gbenv8.seq
249999549 gbenv9.seq
524292008 gbest1.seq
524290121 gbest10.seq
524289473 gbest100.seq
524291194 gbest101.seq
524290705 gbest102.seq
524289530 gbest103.seq
355895480 gbest104.seq
524291053 gbest105.seq
524290540 gbest106.seq
497384462 gbest107.seq
388467303 gbest108.seq
387586957 gbest109.seq
524289121 gbest11.seq
383137103 gbest110.seq
384254099 gbest111.seq
384329608 gbest112.seq
381682912 gbest113.seq
391882873 gbest114.seq
387827426 gbest115.seq
386113420 gbest116.seq
384277010 gbest117.seq
411766482 gbest118.seq
524289447 gbest119.seq
524290795 gbest12.seq
524288954 gbest120.seq
524291702 gbest121.seq
524289404 gbest122.seq
524292066 gbest123.seq
464355782 gbest124.seq
524291080 gbest125.seq
524291183 gbest126.seq
524289144 gbest127.seq
524289798 gbest128.seq
524289466 gbest129.seq
156673626 gbest13.seq
524289858 gbest130.seq
524290242 gbest131.seq
524289918 gbest132.seq
524291108 gbest133.seq
524290031 gbest134.seq
524290555 gbest135.seq
524288939 gbest136.seq
272993637 gbest137.seq
524290385 gbest138.seq
524289283 gbest139.seq
524289575 gbest14.seq
524289755 gbest140.seq
524289462 gbest141.seq
524291658 gbest142.seq
524290434 gbest143.seq
524290148 gbest144.seq
524291996 gbest145.seq
524291299 gbest146.seq
524291451 gbest147.seq
524290210 gbest148.seq
524292180 gbest149.seq
524289177 gbest15.seq
524291181 gbest150.seq
477418254 gbest151.seq
524290283 gbest152.seq
524289929 gbest153.seq
524290844 gbest154.seq
524289027 gbest155.seq
524290690 gbest156.seq
524289239 gbest157.seq
524293077 gbest158.seq
524288936 gbest159.seq
524289434 gbest16.seq
499451197 gbest160.seq
524290756 gbest161.seq
524290260 gbest162.seq
524290335 gbest163.seq
244185744 gbest164.seq
524291229 gbest165.seq
524289302 gbest166.seq
524290366 gbest167.seq
524290635 gbest168.seq
524289065 gbest169.seq
524290723 gbest17.seq
524292896 gbest170.seq
524289962 gbest171.seq
524290257 gbest172.seq
524291475 gbest173.seq
524290335 gbest174.seq
524291664 gbest175.seq
524294404 gbest176.seq
524288756 gbest177.seq
99711849 gbest178.seq
524290053 gbest179.seq
524289098 gbest18.seq
524289908 gbest180.seq
524288820 gbest181.seq
524289436 gbest182.seq
524291717 gbest183.seq
524289828 gbest184.seq
524289839 gbest185.seq
524290988 gbest186.seq
524290587 gbest187.seq
524292517 gbest188.seq
524289364 gbest189.seq
524291796 gbest19.seq
524289357 gbest190.seq
457287312 gbest191.seq
524291908 gbest192.seq
524294182 gbest193.seq
524290912 gbest194.seq
524288832 gbest195.seq
524295936 gbest196.seq
524290833 gbest197.seq
524290429 gbest198.seq
524289684 gbest199.seq
524289694 gbest2.seq
524288736 gbest20.seq
524288861 gbest200.seq
524290274 gbest201.seq
524290882 gbest202.seq
524290219 gbest203.seq
524289680 gbest204.seq
96657532 gbest205.seq
524290582 gbest206.seq
524289800 gbest207.seq
524288898 gbest208.seq
524289220 gbest209.seq
524289255 gbest21.seq
524289702 gbest210.seq
524290395 gbest211.seq
524288970 gbest212.seq
524289238 gbest213.seq
524289699 gbest214.seq
524290025 gbest215.seq
428858965 gbest216.seq
524292312 gbest217.seq
524290823 gbest218.seq
524289581 gbest219.seq
511752444 gbest22.seq
524289362 gbest220.seq
524291110 gbest221.seq
524291469 gbest222.seq
524291966 gbest223.seq
524290001 gbest224.seq
524290569 gbest225.seq
524292431 gbest226.seq
524291516 gbest227.seq
524290556 gbest228.seq
524289992 gbest229.seq
500415838 gbest23.seq
374816979 gbest230.seq
524290419 gbest231.seq
524292023 gbest232.seq
524290299 gbest233.seq
524290719 gbest234.seq
524290974 gbest235.seq
524289211 gbest236.seq
524291370 gbest237.seq
524290774 gbest238.seq
524289057 gbest239.seq
509312736 gbest24.seq
524289952 gbest240.seq
524289100 gbest241.seq
524290256 gbest242.seq
524289812 gbest243.seq
524291098 gbest244.seq
45257507 gbest245.seq
524290847 gbest246.seq
524290983 gbest247.seq
524289154 gbest248.seq
524290595 gbest249.seq
320401330 gbest25.seq
524289061 gbest250.seq
524289687 gbest251.seq
524289661 gbest252.seq
524291677 gbest253.seq
524289536 gbest254.seq
524292249 gbest255.seq
524290943 gbest256.seq
239399070 gbest257.seq
524290160 gbest258.seq
524288973 gbest259.seq
524290613 gbest26.seq
524289499 gbest260.seq
524291085 gbest261.seq
524288758 gbest262.seq
524289118 gbest263.seq
524290899 gbest264.seq
524289270 gbest265.seq
524288860 gbest266.seq
524290199 gbest267.seq
288487884 gbest268.seq
524290200 gbest269.seq
524289817 gbest27.seq
524289655 gbest270.seq
524288901 gbest271.seq
524290460 gbest272.seq
524290950 gbest273.seq
524291723 gbest274.seq
524291444 gbest275.seq
524291049 gbest276.seq
524290570 gbest277.seq
524289579 gbest278.seq
524289567 gbest279.seq
524290576 gbest28.seq
295023248 gbest280.seq
524289732 gbest281.seq
524290854 gbest282.seq
524290336 gbest283.seq
524288803 gbest284.seq
524290454 gbest285.seq
524291145 gbest286.seq
524288751 gbest287.seq
524291430 gbest288.seq
524289392 gbest289.seq
524289334 gbest29.seq
524291418 gbest290.seq
524289169 gbest291.seq
229998897 gbest292.seq
524289566 gbest293.seq
524290600 gbest294.seq
524290637 gbest295.seq
524289091 gbest296.seq
524290617 gbest297.seq
524290786 gbest298.seq
524290072 gbest299.seq
497701912 gbest3.seq
524291411 gbest30.seq
524289993 gbest300.seq
479534122 gbest301.seq
485199296 gbest302.seq
486544620 gbest303.seq
313975983 gbest304.seq
524288914 gbest305.seq
524289430 gbest306.seq
524289983 gbest307.seq
524291152 gbest308.seq
524290282 gbest309.seq
524289379 gbest31.seq
524290541 gbest310.seq
524288930 gbest311.seq
524291231 gbest312.seq
524291250 gbest313.seq
524291265 gbest314.seq
524290094 gbest315.seq
524288889 gbest316.seq
503962422 gbest317.seq
524288982 gbest318.seq
524289890 gbest319.seq
524290914 gbest32.seq
524289511 gbest320.seq
524292144 gbest321.seq
524292072 gbest322.seq
524291498 gbest323.seq
524290192 gbest324.seq
524291977 gbest325.seq
524289756 gbest326.seq
524292099 gbest327.seq
524289573 gbest328.seq
524292097 gbest329.seq
524289377 gbest33.seq
524289000 gbest330.seq
265935598 gbest331.seq
524291210 gbest332.seq
524289128 gbest333.seq
524289370 gbest334.seq
524293366 gbest335.seq
524291045 gbest336.seq
524290194 gbest337.seq
524292117 gbest338.seq
524289878 gbest339.seq
519112548 gbest34.seq
524290542 gbest340.seq
524291404 gbest341.seq
524290002 gbest342.seq
524288925 gbest343.seq
524288732 gbest344.seq
341016054 gbest345.seq
524290081 gbest346.seq
524290692 gbest347.seq
524290338 gbest348.seq
524291764 gbest349.seq
492709808 gbest35.seq
524289542 gbest350.seq
524289838 gbest351.seq
524292697 gbest352.seq
524288878 gbest353.seq
524292119 gbest354.seq
524292032 gbest355.seq
524290475 gbest356.seq
524289491 gbest357.seq
524289694 gbest358.seq
502728352 gbest359.seq
494453282 gbest36.seq
524289914 gbest360.seq
524288950 gbest361.seq
524290852 gbest362.seq
524290860 gbest363.seq
524288888 gbest364.seq
524290765 gbest365.seq
524289559 gbest366.seq
524289519 gbest367.seq
524290337 gbest368.seq
524289273 gbest369.seq
493351895 gbest37.seq
524289854 gbest370.seq
10698765 gbest371.seq
524293044 gbest372.seq
524290306 gbest373.seq
491193296 gbest374.seq
524288893 gbest375.seq
524289275 gbest376.seq
524288938 gbest377.seq
524289334 gbest378.seq
524290297 gbest379.seq
487989331 gbest38.seq
524290619 gbest380.seq
524290003 gbest381.seq
434431337 gbest382.seq
524291809 gbest383.seq
524289242 gbest384.seq
524288990 gbest385.seq
524289777 gbest386.seq
524289846 gbest387.seq
524290918 gbest388.seq
524290513 gbest389.seq
493321514 gbest39.seq
524288867 gbest390.seq
524288778 gbest391.seq
524292092 gbest392.seq
524290451 gbest393.seq
524291346 gbest394.seq
212091178 gbest395.seq
524290064 gbest396.seq
524289397 gbest397.seq
524290159 gbest398.seq
524291035 gbest399.seq
524288944 gbest4.seq
113414773 gbest40.seq
524289671 gbest400.seq
524290040 gbest401.seq
524289655 gbest402.seq
524290525 gbest403.seq
524289386 gbest404.seq
524288939 gbest405.seq
524290832 gbest406.seq
524290072 gbest407.seq
463530242 gbest408.seq
524290995 gbest409.seq
524290880 gbest41.seq
524290906 gbest410.seq
524288879 gbest411.seq
524289527 gbest412.seq
524291809 gbest413.seq
524290129 gbest414.seq
524290478 gbest415.seq
524291164 gbest416.seq
524292714 gbest417.seq
524289969 gbest418.seq
524291154 gbest419.seq
524292268 gbest42.seq
524290032 gbest420.seq
524289760 gbest421.seq
524291859 gbest422.seq
155553427 gbest423.seq
524290991 gbest424.seq
524291097 gbest425.seq
524291383 gbest426.seq
524289678 gbest427.seq
524289164 gbest428.seq
524291584 gbest429.seq
524289990 gbest43.seq
524289481 gbest430.seq
524290101 gbest431.seq
524289848 gbest432.seq
524291008 gbest433.seq
524289311 gbest434.seq
524289333 gbest435.seq
217796253 gbest436.seq
524289207 gbest437.seq
524288869 gbest438.seq
524290759 gbest439.seq
524288988 gbest44.seq
524289709 gbest440.seq
524290435 gbest441.seq
524291060 gbest442.seq
524289172 gbest443.seq
524289982 gbest444.seq
60184772 gbest445.seq
524290658 gbest45.seq
524288845 gbest46.seq
524289123 gbest47.seq
524289436 gbest48.seq
524289748 gbest49.seq
524289625 gbest5.seq
524289890 gbest50.seq
524291850 gbest51.seq
524290597 gbest52.seq
524291261 gbest53.seq
272068884 gbest54.seq
524291144 gbest55.seq
524290818 gbest56.seq
524291908 gbest57.seq
524291081 gbest58.seq
524291678 gbest59.seq
524288762 gbest6.seq
524292209 gbest60.seq
524291507 gbest61.seq
524289150 gbest62.seq
524291761 gbest63.seq
524289276 gbest64.seq
524291181 gbest65.seq
524292615 gbest66.seq
464737740 gbest67.seq
524290473 gbest68.seq
524289458 gbest69.seq
524292257 gbest7.seq
524291062 gbest70.seq
524289828 gbest71.seq
524289375 gbest72.seq
524290343 gbest73.seq
524289878 gbest74.seq
524291258 gbest75.seq
524290111 gbest76.seq
524291654 gbest77.seq
524289345 gbest78.seq
524290253 gbest79.seq
524289253 gbest8.seq
204010212 gbest80.seq
524289535 gbest81.seq
524290774 gbest82.seq
524289969 gbest83.seq
524289114 gbest84.seq
524292008 gbest85.seq
524291274 gbest86.seq
524289505 gbest87.seq
524291711 gbest88.seq
524292145 gbest89.seq
524291518 gbest9.seq
524290843 gbest90.seq
524292149 gbest91.seq
448520661 gbest92.seq
524289420 gbest93.seq
524292516 gbest94.seq
524289074 gbest95.seq
524289287 gbest96.seq
524290631 gbest97.seq
524290221 gbest98.seq
524290454 gbest99.seq
159004539 gbgen.idx
524291296 gbgss1.seq
524291442 gbgss10.seq
524292593 gbgss100.seq
524289703 gbgss101.seq
524291138 gbgss102.seq
524290642 gbgss103.seq
413690581 gbgss104.seq
524290849 gbgss105.seq
524290737 gbgss106.seq
524290652 gbgss107.seq
524290428 gbgss108.seq
524289801 gbgss109.seq
524292161 gbgss11.seq
524290704 gbgss110.seq
524290354 gbgss111.seq
524288843 gbgss112.seq
524290376 gbgss113.seq
524290223 gbgss114.seq
524291222 gbgss115.seq
55466571 gbgss116.seq
524289667 gbgss117.seq
524288912 gbgss118.seq
524291610 gbgss119.seq
524289997 gbgss12.seq
524288966 gbgss120.seq
524289281 gbgss121.seq
524291002 gbgss122.seq
524291088 gbgss123.seq
524290117 gbgss124.seq
524289105 gbgss125.seq
524290798 gbgss126.seq
524289417 gbgss127.seq
524291668 gbgss128.seq
234347164 gbgss129.seq
524289269 gbgss13.seq
524288857 gbgss130.seq
524290772 gbgss131.seq
524290752 gbgss132.seq
524289619 gbgss133.seq
524289444 gbgss134.seq
524289783 gbgss135.seq
524291175 gbgss136.seq
524289612 gbgss137.seq
524289682 gbgss138.seq
515994577 gbgss139.seq
524292326 gbgss14.seq
516001972 gbgss140.seq
84811264 gbgss141.seq
524289677 gbgss142.seq
524289037 gbgss143.seq
233296092 gbgss144.seq
249998289 gbgss145.seq
249999820 gbgss146.seq
249999194 gbgss147.seq
250000011 gbgss148.seq
28487295 gbgss149.seq
524292107 gbgss15.seq
249997137 gbgss150.seq
250000033 gbgss151.seq
249998542 gbgss152.seq
249998333 gbgss153.seq
224919493 gbgss154.seq
249998415 gbgss155.seq
249998761 gbgss156.seq
249998880 gbgss157.seq
249997750 gbgss158.seq
189046598 gbgss159.seq
524289973 gbgss16.seq
249999433 gbgss160.seq
249998390 gbgss161.seq
249999267 gbgss162.seq
249998392 gbgss163.seq
249998723 gbgss164.seq
76677866 gbgss165.seq
249997579 gbgss166.seq
2077145 gbgss167.seq
79542394 gbgss168.seq
249999009 gbgss169.seq
524289030 gbgss17.seq
250000259 gbgss170.seq
87380505 gbgss171.seq
249999685 gbgss172.seq
249998355 gbgss173.seq
249998984 gbgss174.seq
202719103 gbgss175.seq
249999232 gbgss176.seq
249999013 gbgss177.seq
249998851 gbgss178.seq
246250899 gbgss179.seq
524289291 gbgss18.seq
249999268 gbgss180.seq
249997406 gbgss181.seq
249999279 gbgss182.seq
243520281 gbgss183.seq
249999336 gbgss184.seq
249997150 gbgss185.seq
249998209 gbgss186.seq
249997376 gbgss187.seq
122294651 gbgss188.seq
249998013 gbgss189.seq
314779838 gbgss19.seq
250000031 gbgss190.seq
249999974 gbgss191.seq
249998152 gbgss192.seq
94058788 gbgss193.seq
249998892 gbgss194.seq
249999850 gbgss195.seq
249998239 gbgss196.seq
249999582 gbgss197.seq
171078309 gbgss198.seq
249999236 gbgss199.seq
524290030 gbgss2.seq
524288952 gbgss20.seq
249997993 gbgss200.seq
249998006 gbgss201.seq
249999353 gbgss202.seq
95926739 gbgss203.seq
249999461 gbgss204.seq
249999350 gbgss205.seq
249998406 gbgss206.seq
249998619 gbgss207.seq
249999398 gbgss208.seq
249999995 gbgss209.seq
524289034 gbgss21.seq
17245248 gbgss210.seq
249999424 gbgss211.seq
249999963 gbgss212.seq
249997369 gbgss213.seq
43648880 gbgss214.seq
52862187 gbgss215.seq
249997605 gbgss216.seq
249998837 gbgss217.seq
249998038 gbgss218.seq
249998260 gbgss219.seq
524291398 gbgss22.seq
30266487 gbgss220.seq
249997466 gbgss221.seq
249997580 gbgss222.seq
249998996 gbgss223.seq
249999984 gbgss224.seq
28042636 gbgss225.seq
249997655 gbgss226.seq
249998570 gbgss227.seq
249999046 gbgss228.seq
250000051 gbgss229.seq
524291130 gbgss23.seq
249998160 gbgss230.seq
249998166 gbgss231.seq
178904694 gbgss232.seq
249999812 gbgss233.seq
249998926 gbgss234.seq
249999095 gbgss235.seq
220154622 gbgss236.seq
250000034 gbgss237.seq
249997956 gbgss238.seq
250000074 gbgss239.seq
524291392 gbgss24.seq
249998729 gbgss240.seq
195288113 gbgss241.seq
249999561 gbgss242.seq
249998751 gbgss243.seq
249999600 gbgss244.seq
249999029 gbgss245.seq
249999714 gbgss246.seq
16550601 gbgss247.seq
524290581 gbgss25.seq
524289330 gbgss26.seq
524289646 gbgss27.seq
524292079 gbgss28.seq
524289825 gbgss29.seq
524291456 gbgss3.seq
524290682 gbgss30.seq
39016581 gbgss31.seq
524290022 gbgss32.seq
524290380 gbgss33.seq
524290510 gbgss34.seq
524289912 gbgss35.seq
524291284 gbgss36.seq
524290416 gbgss37.seq
524289394 gbgss38.seq
509111345 gbgss39.seq
524289321 gbgss4.seq
524292915 gbgss40.seq
524291774 gbgss41.seq
524289856 gbgss42.seq
28766945 gbgss43.seq
524288942 gbgss44.seq
524289151 gbgss45.seq
524291004 gbgss46.seq
524290935 gbgss47.seq
209349659 gbgss48.seq
524291863 gbgss49.seq
168340015 gbgss5.seq
524291582 gbgss50.seq
524290401 gbgss51.seq
524290464 gbgss52.seq
524290548 gbgss53.seq
524290213 gbgss54.seq
524289963 gbgss55.seq
524289945 gbgss56.seq
524290863 gbgss57.seq
524291284 gbgss58.seq
524290900 gbgss59.seq
524290951 gbgss6.seq
5856233 gbgss60.seq
524291834 gbgss61.seq
524290410 gbgss62.seq
524289010 gbgss63.seq
456972183 gbgss64.seq
524291037 gbgss65.seq
524291022 gbgss66.seq
524290625 gbgss67.seq
524289969 gbgss68.seq
524289927 gbgss69.seq
524290958 gbgss7.seq
524291431 gbgss70.seq
524291342 gbgss71.seq
524290946 gbgss72.seq
524289514 gbgss73.seq
524288792 gbgss74.seq
524289875 gbgss75.seq
524289789 gbgss76.seq
32025220 gbgss77.seq
524289945 gbgss78.seq
524291935 gbgss79.seq
524292289 gbgss8.seq
524289482 gbgss80.seq
524290066 gbgss81.seq
524289701 gbgss82.seq
524291196 gbgss83.seq
524290880 gbgss84.seq
524289902 gbgss85.seq
524291820 gbgss86.seq
524289216 gbgss87.seq
524290299 gbgss88.seq
369802312 gbgss89.seq
524290754 gbgss9.seq
524292172 gbgss90.seq
524291677 gbgss91.seq
524291807 gbgss92.seq
524292003 gbgss93.seq
524289134 gbgss94.seq
524289592 gbgss95.seq
524289866 gbgss96.seq
524291875 gbgss97.seq
524291048 gbgss98.seq
524291620 gbgss99.seq
249992912 gbhtc1.seq
249998856 gbhtc10.seq
249999002 gbhtc11.seq
79453856 gbhtc12.seq
249998828 gbhtc13.seq
249999492 gbhtc14.seq
60864263 gbhtc15.seq
249992681 gbhtc2.seq
249996913 gbhtc3.seq
249991889 gbhtc4.seq
249985674 gbhtc5.seq
249997743 gbhtc6.seq
249996123 gbhtc7.seq
83873876 gbhtc8.seq
249999621 gbhtc9.seq
249904748 gbhtg1.seq
249863408 gbhtg10.seq
249917503 gbhtg100.seq
249825680 gbhtg101.seq
249884880 gbhtg102.seq
249914920 gbhtg103.seq
5504377 gbhtg104.seq
249493570 gbhtg105.seq
249906711 gbhtg106.seq
249802366 gbhtg107.seq
249927339 gbhtg108.seq
249969806 gbhtg109.seq
1107147 gbhtg11.seq
249886695 gbhtg110.seq
249979070 gbhtg111.seq
249738901 gbhtg112.seq
249971341 gbhtg113.seq
135273309 gbhtg114.seq
249974240 gbhtg115.seq
249957856 gbhtg116.seq
249971769 gbhtg117.seq
249933365 gbhtg118.seq
249934502 gbhtg119.seq
249658387 gbhtg12.seq
56361781 gbhtg120.seq
249966899 gbhtg121.seq
249781560 gbhtg122.seq
249950401 gbhtg123.seq
249920865 gbhtg124.seq
249795533 gbhtg125.seq
144610325 gbhtg126.seq
249917701 gbhtg127.seq
249779904 gbhtg128.seq
249839664 gbhtg129.seq
249699749 gbhtg13.seq
249881938 gbhtg130.seq
249974266 gbhtg131.seq
249692111 gbhtg132.seq
249984575 gbhtg133.seq
249804411 gbhtg134.seq
249829371 gbhtg135.seq
6125701 gbhtg136.seq
249765870 gbhtg14.seq
249760883 gbhtg15.seq
249872612 gbhtg16.seq
249845979 gbhtg17.seq
249699084 gbhtg18.seq
249902187 gbhtg19.seq
249994630 gbhtg2.seq
249996789 gbhtg20.seq
237247303 gbhtg21.seq
249760624 gbhtg22.seq
249868408 gbhtg23.seq
249987789 gbhtg24.seq
249921752 gbhtg25.seq
249761207 gbhtg26.seq
249891641 gbhtg27.seq
249956307 gbhtg28.seq
249848514 gbhtg29.seq
249950135 gbhtg3.seq
249992987 gbhtg30.seq
225324756 gbhtg31.seq
249827828 gbhtg32.seq
249924803 gbhtg33.seq
249929437 gbhtg34.seq
249919058 gbhtg35.seq
249852033 gbhtg36.seq
249814604 gbhtg37.seq
249767419 gbhtg38.seq
249627604 gbhtg39.seq
249984089 gbhtg4.seq
249839800 gbhtg40.seq
224338811 gbhtg41.seq
249998331 gbhtg42.seq
249936527 gbhtg43.seq
249894895 gbhtg44.seq
249909173 gbhtg45.seq
250000253 gbhtg46.seq
249478757 gbhtg47.seq
249731618 gbhtg48.seq
249737498 gbhtg49.seq
249882044 gbhtg5.seq
249913135 gbhtg50.seq
236749582 gbhtg51.seq
249784840 gbhtg52.seq
249916972 gbhtg53.seq
249931672 gbhtg54.seq
249971361 gbhtg55.seq
249934905 gbhtg56.seq
18928260 gbhtg57.seq
249846592 gbhtg58.seq
250000116 gbhtg59.seq
249898460 gbhtg6.seq
249917026 gbhtg60.seq
249939524 gbhtg61.seq
227541388 gbhtg62.seq
249902652 gbhtg63.seq
249986757 gbhtg64.seq
249918193 gbhtg65.seq
249883760 gbhtg66.seq
249966605 gbhtg67.seq
16805116 gbhtg68.seq
249960711 gbhtg69.seq
249933725 gbhtg7.seq
249973591 gbhtg70.seq
249953795 gbhtg71.seq
249936542 gbhtg72.seq
225956317 gbhtg73.seq
249814083 gbhtg74.seq
249953172 gbhtg75.seq
249844720 gbhtg76.seq
249976422 gbhtg77.seq
245029378 gbhtg78.seq
249883367 gbhtg79.seq
249933567 gbhtg8.seq
249988504 gbhtg80.seq
249985054 gbhtg81.seq
249923601 gbhtg82.seq
216520297 gbhtg83.seq
249912287 gbhtg84.seq
249753930 gbhtg85.seq
249833379 gbhtg86.seq
249821739 gbhtg87.seq
221421599 gbhtg88.seq
249843050 gbhtg89.seq
249923766 gbhtg9.seq
249970890 gbhtg90.seq
249817508 gbhtg91.seq
249995281 gbhtg92.seq
212086188 gbhtg93.seq
249819427 gbhtg94.seq
249984776 gbhtg95.seq
249786991 gbhtg96.seq
249842265 gbhtg97.seq
169279701 gbhtg98.seq
249744688 gbhtg99.seq
249975649 gbinv1.seq
249998497 gbinv10.seq
159608888 gbinv11.seq
249998061 gbinv12.seq
249999944 gbinv13.seq
249993237 gbinv14.seq
142097929 gbinv15.seq
247564683 gbinv16.seq
249927786 gbinv17.seq
249993408 gbinv18.seq
247888188 gbinv19.seq
249989384 gbinv2.seq
249996920 gbinv20.seq
249998377 gbinv21.seq
249999007 gbinv22.seq
129228728 gbinv23.seq
249997659 gbinv24.seq
249998522 gbinv25.seq
249998326 gbinv26.seq
249997290 gbinv27.seq
249999021 gbinv28.seq
249995408 gbinv29.seq
223356339 gbinv3.seq
109561142 gbinv30.seq
249998319 gbinv4.seq
250000005 gbinv5.seq
249998312 gbinv6.seq
212454102 gbinv7.seq
249997648 gbinv8.seq
249997951 gbinv9.seq
144439520 gbjou1.idx
263488954 gbjou10.idx
217035997 gbjou11.idx
9332606 gbjou12.idx
194968190 gbjou2.idx
142011534 gbjou3.idx
260097317 gbjou4.idx
268908301 gbjou5.idx
278963118 gbjou6.idx
273469269 gbjou7.idx
302435587 gbjou8.idx
294051201 gbjou9.idx
315994625 gbkey1.idx
179965997 gbkey2.idx
199564226 gbkey3.idx
279117246 gbkey4.idx
135662815 gbkey5.idx
249948586 gbmam1.seq
249998556 gbmam2.seq
249930114 gbmam3.seq
249998403 gbmam4.seq
249998009 gbmam5.seq
249999805 gbmam6.seq
89328623 gbmam7.seq
80217546 gbnew.txt
249999737 gbpat1.seq
249999443 gbpat10.seq
249999793 gbpat100.seq
149112469 gbpat101.seq
249999880 gbpat102.seq
249999565 gbpat103.seq
249929731 gbpat104.seq
249824879 gbpat105.seq
249998856 gbpat106.seq
192934308 gbpat107.seq
249999808 gbpat108.seq
249999627 gbpat109.seq
179524671 gbpat11.seq
249999287 gbpat110.seq
80117336 gbpat111.seq
249999537 gbpat112.seq
249999264 gbpat113.seq
249980515 gbpat114.seq
249999878 gbpat115.seq
249849703 gbpat116.seq
66835452 gbpat117.seq
249999441 gbpat118.seq
249999845 gbpat119.seq
249999327 gbpat12.seq
249999888 gbpat120.seq
249999095 gbpat121.seq
160256390 gbpat122.seq
249999974 gbpat123.seq
249999633 gbpat124.seq
234784218 gbpat125.seq
249991591 gbpat126.seq
249970935 gbpat127.seq
249999681 gbpat128.seq
249997397 gbpat129.seq
249995349 gbpat13.seq
249997452 gbpat130.seq
249996753 gbpat131.seq
250000045 gbpat132.seq
249999866 gbpat133.seq
49825422 gbpat134.seq
250000124 gbpat135.seq
249999983 gbpat136.seq
250000132 gbpat137.seq
86031991 gbpat138.seq
249999922 gbpat139.seq
249999709 gbpat14.seq
249999621 gbpat140.seq
250000060 gbpat141.seq
63529069 gbpat142.seq
249998134 gbpat143.seq
249996113 gbpat144.seq
249999931 gbpat145.seq
249999808 gbpat146.seq
250000003 gbpat147.seq
249997374 gbpat148.seq
222093634 gbpat149.seq
249996499 gbpat15.seq
250000249 gbpat150.seq
249999893 gbpat151.seq
249999893 gbpat152.seq
220539897 gbpat153.seq
249999753 gbpat154.seq
249998760 gbpat155.seq
249999466 gbpat156.seq
11331927 gbpat157.seq
249997013 gbpat158.seq
249997795 gbpat159.seq
249999171 gbpat16.seq
249999486 gbpat160.seq
249905267 gbpat161.seq
249999814 gbpat162.seq
249999930 gbpat163.seq
8794991 gbpat164.seq
65866387 gbpat17.seq
250000027 gbpat18.seq
249999801 gbpat19.seq
249999883 gbpat2.seq
249999076 gbpat20.seq
249995026 gbpat21.seq
185815053 gbpat22.seq
249999667 gbpat23.seq
249837974 gbpat24.seq
249999411 gbpat25.seq
250000091 gbpat26.seq
71180933 gbpat27.seq
249983485 gbpat28.seq
249999685 gbpat29.seq
250000133 gbpat3.seq
249997897 gbpat30.seq
249999652 gbpat31.seq
249998555 gbpat32.seq
180165298 gbpat33.seq
249997844 gbpat34.seq
249999933 gbpat35.seq
249999058 gbpat36.seq
249999871 gbpat37.seq
130526044 gbpat38.seq
249995253 gbpat39.seq
249998802 gbpat4.seq
249979830 gbpat40.seq
249999229 gbpat41.seq
249999035 gbpat42.seq
250000221 gbpat43.seq
249813658 gbpat44.seq
249999190 gbpat45.seq
249999707 gbpat46.seq
171260250 gbpat47.seq
249999855 gbpat48.seq
249998527 gbpat49.seq
71788701 gbpat5.seq
249999531 gbpat50.seq
250000197 gbpat51.seq
222934467 gbpat52.seq
249999057 gbpat53.seq
249999815 gbpat54.seq
250000246 gbpat55.seq
164688772 gbpat56.seq
249881382 gbpat57.seq
249999652 gbpat58.seq
249998856 gbpat59.seq
249999527 gbpat6.seq
249999026 gbpat60.seq
134923851 gbpat61.seq
249998246 gbpat62.seq
249999978 gbpat63.seq
249999690 gbpat64.seq
249998210 gbpat65.seq
249999753 gbpat66.seq
249999455 gbpat67.seq
144886744 gbpat68.seq
250000113 gbpat69.seq
249999790 gbpat7.seq
249999899 gbpat70.seq
249998837 gbpat71.seq
244402927 gbpat72.seq
248968678 gbpat73.seq
244459261 gbpat74.seq
247875799 gbpat75.seq
249999937 gbpat76.seq
160624439 gbpat77.seq
250000121 gbpat78.seq
249999657 gbpat79.seq
249996454 gbpat8.seq
249999470 gbpat80.seq
249999644 gbpat81.seq
249999823 gbpat82.seq
249999342 gbpat83.seq
93329421 gbpat84.seq
249153671 gbpat85.seq
249998903 gbpat86.seq
250000182 gbpat87.seq
249999344 gbpat88.seq
249999504 gbpat89.seq
249997995 gbpat9.seq
249998993 gbpat90.seq
145287217 gbpat91.seq
249999016 gbpat92.seq
249998980 gbpat93.seq
249999939 gbpat94.seq
250000257 gbpat95.seq
196964910 gbpat96.seq
249999051 gbpat97.seq
249998995 gbpat98.seq
249999064 gbpat99.seq
133889827 gbphg1.seq
249999553 gbpln1.seq
249993376 gbpln10.seq
249994594 gbpln11.seq
249885016 gbpln12.seq
214287486 gbpln13.seq
249998215 gbpln14.seq
249985349 gbpln15.seq
249996352 gbpln16.seq
249408418 gbpln17.seq
249980127 gbpln18.seq
249606502 gbpln19.seq
249998800 gbpln2.seq
249997413 gbpln20.seq
32429297 gbpln21.seq
249998035 gbpln22.seq
97520053 gbpln23.seq
249998630 gbpln24.seq
249997382 gbpln25.seq
247086229 gbpln26.seq
195754294 gbpln27.seq
247675171 gbpln28.seq
248393733 gbpln29.seq
249938067 gbpln3.seq
249999306 gbpln30.seq
249999636 gbpln31.seq
249998924 gbpln32.seq
96193793 gbpln33.seq
249998604 gbpln34.seq
249999760 gbpln35.seq
249999374 gbpln36.seq
249895573 gbpln37.seq
112428086 gbpln38.seq
249999616 gbpln39.seq
249856198 gbpln4.seq
249997602 gbpln40.seq
249997908 gbpln41.seq
249941176 gbpln42.seq
242692694 gbpln43.seq
249998417 gbpln44.seq
249999447 gbpln45.seq
249999656 gbpln46.seq
249999466 gbpln47.seq
181430390 gbpln48.seq
249917311 gbpln5.seq
249510533 gbpln6.seq
249980320 gbpln7.seq
129976479 gbpln8.seq
249998104 gbpln9.seq
148950419 gbpri1.seq
249865688 gbpri10.seq
127325880 gbpri11.seq
249962747 gbpri12.seq
249896480 gbpri13.seq
249896770 gbpri14.seq
249947119 gbpri15.seq
249902427 gbpri16.seq
249853720 gbpri17.seq
249795954 gbpri18.seq
249857339 gbpri19.seq
249858560 gbpri2.seq
249966588 gbpri20.seq
249904105 gbpri21.seq
199921494 gbpri22.seq
179365263 gbpri23.seq
249996873 gbpri24.seq
206003648 gbpri25.seq
249813409 gbpri26.seq
249931747 gbpri27.seq
249985513 gbpri28.seq
249932528 gbpri29.seq
249761366 gbpri3.seq
249827018 gbpri30.seq
249979716 gbpri31.seq
249791846 gbpri32.seq
249998672 gbpri33.seq
85927953 gbpri34.seq
249993971 gbpri35.seq
249993798 gbpri36.seq
249976728 gbpri37.seq
249992459 gbpri38.seq
250000162 gbpri39.seq
249860679 gbpri4.seq
175862490 gbpri40.seq
249999674 gbpri41.seq
200435448 gbpri42.seq
249912180 gbpri5.seq
249946672 gbpri6.seq
249851316 gbpri7.seq
249923382 gbpri8.seq
249886895 gbpri9.seq
300648 gbrel.txt
249840408 gbrod1.seq
249952616 gbrod10.seq
60961015 gbrod11.seq
249871284 gbrod12.seq
249784533 gbrod13.seq
249992872 gbrod14.seq
249651633 gbrod15.seq
249953778 gbrod16.seq
249886642 gbrod17.seq
249831745 gbrod18.seq
223628852 gbrod19.seq
249941906 gbrod2.seq
249687397 gbrod20.seq
249816207 gbrod21.seq
227955389 gbrod22.seq
249999880 gbrod23.seq
249991809 gbrod24.seq
249839571 gbrod25.seq
249814218 gbrod26.seq
249999589 gbrod27.seq
249999623 gbrod28.seq
134715339 gbrod29.seq
249786577 gbrod3.seq
249743057 gbrod4.seq
249987585 gbrod5.seq
249985583 gbrod6.seq
249746791 gbrod7.seq
249760313 gbrod8.seq
249867062 gbrod9.seq
3575852370 gbsdr1.txt
5599361247 gbsdr2.txt
2586789021 gbsdr3.txt
149054696 gbsec.idx
249997033 gbsts1.seq
249997368 gbsts10.seq
210872286 gbsts11.seq
249996524 gbsts12.seq
249999993 gbsts13.seq
249998580 gbsts14.seq
249998056 gbsts15.seq
22922975 gbsts16.seq
249999107 gbsts17.seq
249997856 gbsts18.seq
250000230 gbsts19.seq
249998336 gbsts2.seq
146205836 gbsts20.seq
249999523 gbsts3.seq
249996467 gbsts4.seq
38698462 gbsts5.seq
249997411 gbsts6.seq
249997774 gbsts7.seq
249997192 gbsts8.seq
249996997 gbsts9.seq
249999461 gbsyn1.seq
249996480 gbsyn2.seq
30632416 gbsyn3.seq
249999766 gbtsa1.seq
243632786 gbtsa10.seq
249997835 gbtsa11.seq
249999221 gbtsa12.seq
249999134 gbtsa13.seq
249998282 gbtsa14.seq
167230959 gbtsa15.seq
249998694 gbtsa16.seq
249998042 gbtsa17.seq
249998579 gbtsa18.seq
250000159 gbtsa19.seq
249998185 gbtsa2.seq
93761497 gbtsa20.seq
249998605 gbtsa21.seq
249999182 gbtsa22.seq
249997042 gbtsa23.seq
249999495 gbtsa24.seq
103257235 gbtsa25.seq
249999367 gbtsa26.seq
250000160 gbtsa27.seq
249999704 gbtsa28.seq
249998402 gbtsa29.seq
249999791 gbtsa3.seq
16245355 gbtsa30.seq
249998820 gbtsa4.seq
82943435 gbtsa5.seq
249999101 gbtsa6.seq
249998558 gbtsa7.seq
250000063 gbtsa8.seq
249998408 gbtsa9.seq
486530 gbuna1.seq
249996930 gbvrl1.seq
249998458 gbvrl10.seq
37701157 gbvrl11.seq
249997947 gbvrl12.seq
249998980 gbvrl13.seq
249998823 gbvrl14.seq
249998979 gbvrl15.seq
249999945 gbvrl16.seq
249999954 gbvrl17.seq
103193489 gbvrl18.seq
249998770 gbvrl2.seq
249999838 gbvrl3.seq
249998326 gbvrl4.seq
173248746 gbvrl5.seq
249999766 gbvrl6.seq
249999850 gbvrl7.seq
249998287 gbvrl8.seq
249999575 gbvrl9.seq
249702338 gbvrt1.seq
249855727 gbvrt10.seq
249950363 gbvrt11.seq
185412106 gbvrt12.seq
249995062 gbvrt13.seq
249948900 gbvrt14.seq
249862622 gbvrt15.seq
249998300 gbvrt16.seq
249998311 gbvrt17.seq
249997581 gbvrt18.seq
95970738 gbvrt19.seq
249996978 gbvrt2.seq
249978853 gbvrt20.seq
249998822 gbvrt21.seq
250000056 gbvrt22.seq
249997384 gbvrt23.seq
37539965 gbvrt24.seq
249804768 gbvrt3.seq
249993473 gbvrt4.seq
81539769 gbvrt5.seq
249996058 gbvrt6.seq
249996561 gbvrt7.seq
249951682 gbvrt8.seq
249975416 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 57868 87999564
BCT10 61 117892388
BCT11 120 115665846
BCT12 16131 89851177
BCT13 53938 85393265
BCT14 93 110189094
BCT15 151 93915681
BCT16 61 112455059
BCT17 52 112042350
BCT18 46 114233015
BCT19 58 114976109
BCT2 79 110915939
BCT20 66 108817610
BCT21 36 96325907
BCT22 40 106881287
BCT23 58 105533856
BCT24 74 111675186
BCT25 55 110045255
BCT26 63 106845575
BCT27 55 109391288
BCT28 52 108559385
BCT29 46 110496749
BCT3 55 112957780
BCT30 95 109522868
BCT31 59 110966729
BCT32 67 108616570
BCT33 123 106326491
BCT34 35 64734494
BCT35 202 109105476
BCT36 51 109861512
BCT37 41 108044754
BCT38 53 106012438
BCT39 58 108356780
BCT4 1695 109790801
BCT40 47 111678360
BCT41 84 106541161
BCT42 48 107804860
BCT43 56 108200690
BCT44 74 108235330
BCT45 89 103751179
BCT46 3 19351707
BCT47 67 107603750
BCT48 60 101650984
BCT49 47 106810333
BCT5 36668 60774727
BCT50 58 106248224
BCT51 57 110408706
BCT52 49 100887372
BCT53 40 103040731
BCT54 69 108722619
BCT55 227 104020950
BCT56 426 93880787
BCT57 1589 2511823
BCT58 3179 5215895
BCT59 6347 7901828
BCT6 39039 82659238
BCT60 12648 15076611
BCT61 25628 27748212
BCT62 50524 53976025
BCT63 76551 77435779
BCT64 71912 77219978
BCT65 8274 95944425
BCT66 5238 104231813
BCT67 2963 109148933
BCT68 173 121167011
BCT69 12464 107226504
BCT7 5533 96145966
BCT70 87813 70082482
BCT71 77776 79734313
BCT72 41760 80013880
BCT8 13866 89679026
BCT9 6715 95967872
ENV1 93809 72055863
ENV10 82991 87020013
ENV11 19073 16784927
ENV12 84894 80972564
ENV13 120708 43404632
ENV14 88775 78252990
ENV15 96751 67974930
ENV16 96478 63158106
ENV17 86986 71162249
ENV18 57891 78165337
ENV19 69532 85606513
ENV2 87781 70438827
ENV20 94305 72060603
ENV21 128620 31367039
ENV22 123354 29532069
ENV23 63056 14104745
ENV24 123225 49908858
ENV25 98576 67524378
ENV26 120518 57220263
ENV27 140039 51733043
ENV28 100671 64906038
ENV29 26471 25182836
ENV3 92138 76003209
ENV30 71058 96548027
ENV31 95283 69110297
ENV32 108351 43155100
ENV33 86683 70753171
ENV34 51257 28261502
ENV35 112132 47684503
ENV36 104995 60436423
ENV37 77746 88467262
ENV38 70411 95649981
ENV39 95534 67328221
ENV4 77986 85266222
ENV40 46119 29114143
ENV5 93093 80642586
ENV6 69596 39376221
ENV7 131791 31268854
ENV8 86960 71051171
ENV9 93953 73218646
EST1 158932 61578479
EST10 167474 72175818
EST100 226242 140246726
EST101 227611 115480092
EST102 201381 104747807
EST103 171804 101004881
EST104 102136 80258286
EST105 165129 110876586
EST106 168479 110411595
EST107 116979 68034525
EST108 63862 23524265
EST109 64110 22728823
EST11 169519 73967719
EST110 64334 23423852
EST111 64294 27229289
EST112 64310 21909415
EST113 65711 25951956
EST114 63772 27851479
EST115 64287 26251017
EST116 64524 26960420
EST117 64245 25130351
EST118 61224 38061977
EST119 162258 77041045
EST12 166830 70071306
EST120 174890 86182700
EST121 158356 92880226
EST122 149630 95735188
EST123 153459 89563495
EST124 126147 78380533
EST125 202981 99396916
EST126 153457 79462145
EST127 158034 84359330
EST128 155594 89073775
EST129 149671 79525719
EST13 72718 34892939
EST130 174606 101477814
EST131 200144 116340383
EST132 182346 99491444
EST133 162808 84303979
EST134 158376 80382256
EST135 146304 89303609
EST136 142026 85584918
EST137 93527 49245874
EST138 188163 107244964
EST139 232229 101981184
EST14 217651 109271608
EST140 152936 89657549
EST141 168238 91530760
EST142 146978 87189366
EST143 137588 86847873
EST144 157593 95363296
EST145 146219 76533496
EST146 123462 64407246
EST147 121770 65835257
EST148 129198 54534999
EST149 127613 50728665
EST15 168587 105333694
EST150 128330 51062564
EST151 119677 45521332
EST152 171986 86430334
EST153 180120 80439385
EST154 154652 109509674
EST155 211711 129313137
EST156 215417 119836578
EST157 174374 93015187
EST158 147083 111956571
EST159 134267 83214809
EST16 178924 112370151
EST160 157154 97888824
EST161 149749 80064762
EST162 142410 81979467
EST163 168525 94464916
EST164 72521 43368942
EST165 154665 96054210
EST166 188742 105985555
EST167 142786 78197488
EST168 135318 71833323
EST169 168658 94073647
EST17 195339 112911344
EST170 179414 103159775
EST171 150825 94205146
EST172 171509 83647523
EST173 130013 86659069
EST174 183038 107939927
EST175 164540 93004024
EST176 112197 66457662
EST177 164153 93659447
EST178 34085 21483956
EST179 169059 101124782
EST18 190569 121501907
EST180 181509 127722112
EST181 148912 106516949
EST182 190661 99288938
EST183 152807 115931499
EST184 144007 86850521
EST185 145430 82982109
EST186 177747 71902674
EST187 149456 84355930
EST188 155114 97049904
EST189 162588 99760556
EST19 159265 114057604
EST190 142258 88351966
EST191 162350 94428817
EST192 133731 89930790
EST193 131190 88371690
EST194 145029 89344881
EST195 134001 89297062
EST196 123920 87002971
EST197 173305 92470487
EST198 173992 95868586
EST199 173450 96322633
EST2 161860 61550624
EST20 187058 99421404
EST200 171169 96064787
EST201 168255 94202121
EST202 172251 95874272
EST203 173459 95043222
EST204 174008 95565513
EST205 32233 17534410
EST206 191227 103858647
EST207 202331 106570886
EST208 174713 105328784
EST209 183797 103921186
EST21 217117 106462571
EST210 197120 118558493
EST211 195593 116489265
EST212 182869 121394518
EST213 174204 105007302
EST214 214299 146884559
EST215 237560 107488677
EST216 139124 108029211
EST217 150565 101297591
EST218 146701 90947330
EST219 206034 111631974
EST22 198695 65860008
EST220 171814 113686510
EST221 99875 91365298
EST222 142711 110418596
EST223 160863 94617232
EST224 145624 106223024
EST225 216467 100676095
EST226 144137 101915534
EST227 137853 96878906
EST228 140437 100755932
EST229 121104 86082198
EST23 140922 40078873
EST230 95805 61686268
EST231 141422 91717040
EST232 133066 98067561
EST233 137716 98123377
EST234 123939 84425383
EST235 132794 86788995
EST236 158087 116669566
EST237 143328 117077284
EST238 133633 113051730
EST239 154944 95483104
EST24 103789 28103816
EST240 177912 112819931
EST241 146319 92388094
EST242 179493 112570962
EST243 164530 122404886
EST244 140464 104138577
EST245 11705 9500689
EST246 164693 100597463
EST247 231282 97020604
EST248 152021 113246958
EST249 179419 65087767
EST25 121796 51015487
EST250 216990 50007314
EST251 212361 82234935
EST252 171164 131302317
EST253 165245 101375460
EST254 169210 107799020
EST255 164301 111357063
EST256 166656 117173515
EST257 86629 44453365
EST258 187512 98332328
EST259 176381 111583866
EST26 213567 97258803
EST260 165323 109202259
EST261 233184 110653173
EST262 278267 120118401
EST263 183353 111837668
EST264 187454 36843044
EST265 259314 124364773
EST266 151663 94583792
EST267 161054 105005877
EST268 96494 56244218
EST269 174016 118526642
EST27 219253 110171680
EST270 183485 98654593
EST271 172344 113472160
EST272 182182 105397664
EST273 207950 36613608
EST274 190872 56178112
EST275 185643 105860375
EST276 187424 118286598
EST277 173051 113343606
EST278 179931 102631036
EST279 156426 104367755
EST28 190323 88450994
EST280 111516 37313275
EST281 129555 81585185
EST282 132940 85982390
EST283 156239 100459712
EST284 259869 27441140
EST285 263840 24257669
EST286 146343 106020945
EST287 168767 109367714
EST288 161509 102904660
EST289 155909 91010941
EST29 157926 68874306
EST290 264419 32074529
EST291 165084 108392677
EST292 73969 42948433
EST293 184832 111067401
EST294 149333 91164816
EST295 195312 109640168
EST296 164260 114832022
EST297 162091 104387601
EST298 189125 113894357
EST299 179374 100267217
EST3 153644 54437600
EST30 171504 69596093
EST300 181442 103313526
EST301 188346 64338770
EST302 187450 69747936
EST303 187275 70834548
EST304 122473 47083480
EST305 187165 91816749
EST306 182049 133320602
EST307 149687 86290360
EST308 154216 90751159
EST309 128797 100374966
EST31 149159 63314614
EST310 157127 97918248
EST311 172529 98498655
EST312 155612 98074379
EST313 169533 97150928
EST314 158495 105996654
EST315 145080 101554644
EST316 165232 106396705
EST317 154049 113701600
EST318 182352 153683681
EST319 172875 94163560
EST32 168250 76099748
EST320 134252 85114473
EST321 144113 99222681
EST322 140714 93904056
EST323 139828 91385264
EST324 145668 101535241
EST325 151004 101274766
EST326 179186 106331072
EST327 149680 86806219
EST328 151775 86259602
EST329 155050 112493356
EST33 174123 66771010
EST330 158742 94856521
EST331 74761 49707976
EST332 139390 87217577
EST333 153677 95410475
EST334 205437 106064885
EST335 114387 62904518
EST336 103270 65681916
EST337 132595 88707193
EST338 138913 87899067
EST339 122870 75659148
EST34 122424 42971214
EST340 217072 83001433
EST341 182055 85862918
EST342 157164 95454744
EST343 177906 108830271
EST344 151011 90200367
EST345 83517 54926174
EST346 134781 90089544
EST347 146868 95491506
EST348 186721 116635577
EST349 158549 90451852
EST35 97395 29886072
EST350 174785 100209117
EST351 175935 129652055
EST352 80735 48870466
EST353 86623 48668343
EST354 145949 84235584
EST355 131101 77330770
EST356 158106 41728790
EST357 158949 31632436
EST358 157290 50558200
EST359 182715 119111357
EST36 97796 30593215
EST360 247436 114257674
EST361 250785 114853872
EST362 175599 99401219
EST363 142319 92326415
EST364 137895 86156989
EST365 156678 93385778
EST366 195449 120079464
EST367 222300 58913708
EST368 185769 113372399
EST369 212661 121452946
EST37 96710 29344141
EST370 144239 69700517
EST371 4166 1880704
EST372 192226 120602385
EST373 165815 104820800
EST374 163028 124834549
EST375 180776 147165632
EST376 156976 90019826
EST377 198342 111515365
EST378 189864 106827241
EST379 187404 111439512
EST38 98631 29841320
EST380 209048 133722977
EST381 208662 126032853
EST382 174580 129817457
EST383 202422 151469056
EST384 188201 103652327
EST385 171451 50596792
EST386 165336 13125001
EST387 155665 18283686
EST388 158495 32720105
EST389 158488 32733827
EST39 99466 31211469
EST390 155742 49971771
EST391 158359 92838382
EST392 177073 117246021
EST393 167499 104925078
EST394 162835 108373683
EST395 58434 37011347
EST396 141615 98809186
EST397 147165 102057191
EST398 159625 101558205
EST399 155052 112409777
EST4 170812 67108330
EST40 23473 5987285
EST400 165184 101083942
EST401 173262 49565196
EST402 166902 45086243
EST403 158149 108040045
EST404 159443 103419492
EST405 171339 110025038
EST406 144300 86146807
EST407 194474 115930786
EST408 135256 94234264
EST409 133831 91274717
EST41 100925 53085613
EST410 140192 91581582
EST411 153285 92661118
EST412 171377 95973814
EST413 177856 98574177
EST414 152606 91760874
EST415 177087 108941181
EST416 141344 88562266
EST417 103160 72967315
EST418 99701 67955367
EST419 120010 72942519
EST42 119775 50954107
EST420 143693 84116749
EST421 129995 79398405
EST422 138073 92071602
EST423 43497 23077956
EST424 150359 91687699
EST425 164836 88361253
EST426 193427 115200586
EST427 123880 80044910
EST428 193082 107425652
EST429 167228 73026626
EST43 164285 85729653
EST430 151155 86137672
EST431 173739 112882113
EST432 172767 94219563
EST433 136125 92746040
EST434 178831 72956813
EST435 187473 80916049
EST436 85708 35840197
EST437 205860 87010336
EST438 213237 116482767
EST439 183916 114424286
EST44 166519 67567635
EST440 175104 108782851
EST441 149036 102167111
EST442 149675 95705436
EST443 168367 58806444
EST444 158501 62468094
EST445 23862 7375741
EST45 166232 87668208
EST46 170516 87030468
EST47 162175 87651846
EST48 162709 82183452
EST49 157539 91107785
EST5 168996 66194437
EST50 161286 90953835
EST51 158819 98458800
EST52 157153 69409609
EST53 150561 82911356
EST54 81506 49855975
EST55 167810 67437990
EST56 160478 76559548
EST57 169036 93244265
EST58 156511 101556332
EST59 157518 100126737
EST6 171504 66930687
EST60 163279 100734063
EST61 160644 106131678
EST62 172742 73908709
EST63 173098 101006837
EST64 151292 80215211
EST65 151220 84186361
EST66 158892 99316107
EST67 137479 78915258
EST68 143240 84922517
EST69 196186 109253618
EST7 169775 72697086
EST70 198126 103953949
EST71 211365 118555009
EST72 192281 113476242
EST73 193706 114094453
EST74 160342 86278224
EST75 133181 62204678
EST76 137021 68781156
EST77 158506 108081737
EST78 155586 85626440
EST79 144511 78802218
EST8 179411 72878020
EST80 55934 37684094
EST81 182786 94238257
EST82 211431 123438760
EST83 213918 114879198
EST84 209610 98597600
EST85 208703 91048217
EST86 148593 90296846
EST87 144385 83799968
EST88 162629 81147372
EST89 159993 80847510
EST9 168509 69274895
EST90 152211 103118766
EST91 152437 99421204
EST92 133249 75476526
EST93 152415 115351352
EST94 141961 104565652
EST95 145449 105524103
EST96 139304 88076011
EST97 153213 86334490
EST98 174567 107209432
EST99 243917 149475955
GSS1 200065 87618868
GSS10 132040 60283372
GSS100 145362 114337340
GSS101 141643 116113759
GSS102 143263 116656493
GSS103 167238 128921102
GSS104 149783 82569304
GSS105 191527 120854119
GSS106 167754 112128998
GSS107 197330 115526115
GSS108 205012 134790946
GSS109 209809 138230024
GSS11 137026 73963307
GSS110 207577 140850185
GSS111 206236 142442852
GSS112 205252 143735676
GSS113 205173 143941544
GSS114 202120 146640193
GSS115 182320 139878966
GSS116 18374 10853427
GSS117 132848 84052151
GSS118 169611 80019194
GSS119 185717 80451589
GSS12 147892 75892162
GSS120 170455 148555237
GSS121 178389 121690874
GSS122 184689 149588588
GSS123 191663 124231606
GSS124 187042 137242702
GSS125 191042 125969607
GSS126 189842 96322354
GSS127 166122 152379462
GSS128 164222 116013846
GSS129 74198 50089663
GSS13 145409 68614697
GSS130 171037 155484916
GSS131 172774 154164468
GSS132 172083 155542955
GSS133 173759 154345682
GSS134 174370 152390350
GSS135 183822 145923124
GSS136 179510 145497392
GSS137 163809 112574762
GSS138 221300 81367276
GSS139 265738 40935252
GSS14 169811 84778686
GSS140 265734 40946510
GSS141 43700 6697365
GSS142 259296 57807938
GSS143 241895 68223975
GSS144 89187 49159213
GSS145 87117 64024027
GSS146 83555 62806406
GSS147 103687 48624686
GSS148 68564 58466330
GSS149 7626 6989548
GSS15 161103 97665015
GSS150 68591 57924394
GSS151 69224 56650935
GSS152 69460 56187403
GSS153 71202 55998401
GSS154 68561 51865315
GSS155 75915 58209304
GSS156 87237 74898207
GSS157 81830 44609896
GSS158 92677 45029689
GSS159 63209 47603494
GSS16 172837 87031541
GSS160 77435 61351403
GSS161 69655 58699293
GSS162 67711 62706526
GSS163 62009 53369632
GSS164 95592 42925428
GSS165 21061 4909542
GSS166 112938 70877522
GSS167 822 559311
GSS168 23226 28867035
GSS169 109043 70652585
GSS17 183525 113506663
GSS170 84533 34668223
GSS171 35815 22222733
GSS172 103304 62490220
GSS173 102329 63761256
GSS174 104268 67656826
GSS175 82099 41276456
GSS176 83102 54651503
GSS177 95673 61335435
GSS178 107323 78547443
GSS179 106375 76684757
GSS18 192359 114303278
GSS180 106058 79947480
GSS181 103996 80016519
GSS182 76374 51039123
GSS183 104572 63292187
GSS184 109868 66415305
GSS185 106205 59313311
GSS186 68379 37446344
GSS187 69561 38732329
GSS188 37157 17778905
GSS189 85481 46023427
GSS19 114051 52089836
GSS190 97119 55907586
GSS191 94982 49597190
GSS192 96286 55922591
GSS193 42132 23615490
GSS194 114638 43642267
GSS195 117085 39368203
GSS196 108676 55514545
GSS197 101471 78372335
GSS198 67717 43620427
GSS199 95891 36542252
GSS2 182294 92190805
GSS20 181789 101771260
GSS200 95417 37268709
GSS201 96671 35161518
GSS202 94285 39167432
GSS203 37736 17626556
GSS204 103939 66277823
GSS205 94551 61190929
GSS206 95128 60357048
GSS207 94773 60868501
GSS208 75675 70017159
GSS209 75117 74330280
GSS21 166208 114173594
GSS210 4473 7127270
GSS211 83736 28233267
GSS212 84219 27346468
GSS213 84926 25909272
GSS214 14851 4422302
GSS215 16547 7508221
GSS216 92648 59635081
GSS217 84624 52490775
GSS218 94061 50735685
GSS219 88579 48354065
GSS22 169506 97609042
GSS220 10731 5841916
GSS221 90648 56882510
GSS222 89662 61882079
GSS223 88553 63641206
GSS224 89283 62505584
GSS225 9890 7129098
GSS226 87995 63795538
GSS227 90217 62488977
GSS228 94638 59913510
GSS229 74308 63032786
GSS23 187251 126687349
GSS230 84243 78882674
GSS231 83029 80585163
GSS232 70505 52672246
GSS233 117650 64297121
GSS234 108874 55446727
GSS235 107533 52125503
GSS236 96658 43251344
GSS237 109801 49060015
GSS238 98194 46325477
GSS239 73059 72225597
GSS24 194057 130219707
GSS240 76682 71142435
GSS241 72980 46435649
GSS242 94787 57200301
GSS243 93517 59081345
GSS244 93900 58510429
GSS245 94714 57307691
GSS246 94279 58016121
GSS247 6701 3333254
GSS25 177481 105207105
GSS26 185884 107785085
GSS27 170583 151385030
GSS28 190501 146251023
GSS29 151128 106428647
GSS3 174947 87827485
GSS30 192461 132146551
GSS31 13682 8806511
GSS32 196017 127304082
GSS33 216657 116234308
GSS34 218576 113599632
GSS35 219719 112026888
GSS36 213961 121893034
GSS37 198561 156434502
GSS38 194991 146802828
GSS39 197249 73382791
GSS4 167154 85100946
GSS40 185072 97679213
GSS41 189780 125956632
GSS42 170343 158772213
GSS43 9065 5893881
GSS44 183999 100320381
GSS45 173031 121666603
GSS46 185089 124654949
GSS47 190835 122398659
GSS48 70734 62565384
GSS49 171799 101963548
GSS5 53442 31615955
GSS50 167647 103037030
GSS51 167798 102616122
GSS52 184194 121477291
GSS53 184774 116632196
GSS54 181686 122485290
GSS55 187531 113994336
GSS56 189392 134519036
GSS57 178947 104938173
GSS58 195715 120562907
GSS59 179925 133347062
GSS6 161617 84471320
GSS60 1898 1718384
GSS61 172927 139004649
GSS62 161633 111556933
GSS63 161679 111560086
GSS64 158740 107545551
GSS65 156768 129062324
GSS66 170185 142553826
GSS67 179844 117096102
GSS68 204956 127989095
GSS69 193312 110751728
GSS7 165323 79361698
GSS70 244049 126053657
GSS71 160164 106280071
GSS72 159390 119843139
GSS73 162663 124539223
GSS74 162628 124600532
GSS75 175121 108963120
GSS76 190291 140108442
GSS77 12971 7538114
GSS78 199135 126616367
GSS79 170370 111603100
GSS8 165782 88979927
GSS80 200718 131518447
GSS81 214948 86011305
GSS82 187080 100057507
GSS83 131104 91989085
GSS84 146939 117974637
GSS85 139562 116979023
GSS86 142823 114217730
GSS87 143960 119802766
GSS88 141946 115786817
GSS89 104815 87300351
GSS9 137999 67157686
GSS90 149425 122240891
GSS91 147663 117692857
GSS92 143995 113064403
GSS93 142869 115422868
GSS94 144203 119656289
GSS95 148069 121684067
GSS96 147696 117745472
GSS97 146077 121054040
GSS98 146145 120923099
GSS99 146569 120073651
HTC1 25057 27045808
HTC10 64111 67397424
HTC11 74630 76211206
HTC12 21349 31170896
HTC13 66997 61008541
HTC14 68335 69516000
HTC15 22003 15289999
HTC2 16086 36243320
HTC3 16029 36627693
HTC4 16251 35560357
HTC5 15980 40344457
HTC6 16068 37474845
HTC7 53834 31477922
HTC8 31137 19451907
HTC9 62290 77331613
HTG1 1318 188771164
HTG10 1298 186333849
HTG100 990 189440077
HTG101 996 189310369
HTG102 985 189405998
HTG103 1161 190529146
HTG104 30 4187142
HTG105 1090 189522880
HTG106 1040 189758928
HTG107 1394 191388699
HTG108 1301 190943512
HTG109 1620 191205597
HTG11 6 837687
HTG110 1385 191892180
HTG111 1292 192301514
HTG112 1297 189651930
HTG113 1060 185653516
HTG114 629 101857856
HTG115 1513 182381556
HTG116 992 192258010
HTG117 929 180600602
HTG118 1076 193795486
HTG119 1103 193114123
HTG12 1451 183826000
HTG120 232 43675540
HTG121 1029 189547972
HTG122 1053 192637550
HTG123 1165 192104964
HTG124 1082 193002672
HTG125 1079 192982070
HTG126 636 111615589
HTG127 1121 192664147
HTG128 1081 192356827
HTG129 1078 192401949
HTG13 875 191579912
HTG130 1135 192146132
HTG131 1039 192291101
HTG132 1074 192029023
HTG133 1056 192460538
HTG134 1141 191368556
HTG135 1280 187597174
HTG136 64 4636333
HTG14 753 192058598
HTG15 745 191952430
HTG16 786 192030578
HTG17 798 191870220
HTG18 774 191882457
HTG19 2069 170825721
HTG2 2470 186037380
HTG20 1096 187418197
HTG21 888 180107836
HTG22 785 191651644
HTG23 928 190141652
HTG24 907 190491600
HTG25 811 191323929
HTG26 784 191771279
HTG27 874 191079273
HTG28 896 190511648
HTG29 939 189964220
HTG3 2513 185208586
HTG30 911 190941779
HTG31 841 171449145
HTG32 875 191097680
HTG33 968 189503995
HTG34 884 191025385
HTG35 868 191276405
HTG36 825 191697068
HTG37 949 189868158
HTG38 949 190351720
HTG39 940 190045229
HTG4 2550 188439001
HTG40 1049 189067496
HTG41 1089 167518469
HTG42 1257 188188838
HTG43 1169 188132191
HTG44 1150 188026157
HTG45 1118 191332771
HTG46 1269 190703866
HTG47 1174 190717160
HTG48 1130 191137302
HTG49 1047 191184441
HTG5 1283 185453274
HTG50 1024 189658759
HTG51 1054 180030553
HTG52 969 190090757
HTG53 1106 190158225
HTG54 1046 190278289
HTG55 1014 189831932
HTG56 969 189155086
HTG57 82 14402517
HTG58 1010 189344282
HTG59 1031 190037155
HTG6 1273 185124562
HTG60 1072 187359162
HTG61 1129 188210893
HTG62 997 172674612
HTG63 1086 189585086
HTG64 1065 189567157
HTG65 1169 188828767
HTG66 1178 187478964
HTG67 1283 184490539
HTG68 95 12336833
HTG69 1221 185314622
HTG7 1276 185375030
HTG70 1239 184674446
HTG71 1244 184625496
HTG72 1183 187658245
HTG73 1023 170809051
HTG74 1118 188295824
HTG75 1103 190843621
HTG76 1136 190816822
HTG77 1182 190887841
HTG78 1099 186602762
HTG79 1171 190202119
HTG8 1459 184608562
HTG80 1115 190062476
HTG81 1214 189987246
HTG82 1120 189706900
HTG83 958 164506501
HTG84 1228 188383308
HTG85 1251 187687552
HTG86 1142 189936537
HTG87 1145 189669894
HTG88 981 168316109
HTG89 1183 189859637
HTG9 1200 186916809
HTG90 1104 190250569
HTG91 1145 190090446
HTG92 1104 190500681
HTG93 981 161863115
HTG94 1056 190715130
HTG95 1159 191053096
HTG96 1034 189071731
HTG97 1070 189559758
HTG98 690 128563367
HTG99 1018 189641315
INV1 94105 48358518
INV10 83888 65316908
INV11 53165 42301869
INV12 85016 66304270
INV13 80889 67010964
INV14 78399 68053388
INV15 43271 39803712
INV16 8168 145023213
INV17 320 155148771
INV18 28268 118189299
INV19 14190 140156143
INV2 13509 166390856
INV20 35502 121146294
INV21 78229 57051000
INV22 73818 62927787
INV23 36784 23995121
INV24 78033 56695694
INV25 73916 49072741
INV26 74865 50627615
INV27 72441 49494854
INV28 71903 47573166
INV29 56277 73100531
INV3 1429 154345747
INV30 9422 48274498
INV4 10911 132549432
INV5 76746 74818709
INV6 56481 86936780
INV7 43549 79487453
INV8 80631 71824074
INV9 59388 86021212
MAM1 14817 162818538
MAM2 23857 152410734
MAM3 55148 88433877
MAM4 17690 170595231
MAM5 78768 74315662
MAM6 56656 114247092
MAM7 28068 23424555
PAT1 222548 70116882
PAT10 124490 102559093
PAT100 178185 3385515
PAT101 132610 2848492
PAT102 342935 8573375
PAT103 188806 88519660
PAT104 111348 132068608
PAT105 3850 194703659
PAT106 131292 110979300
PAT107 158599 54826034
PAT108 224731 34113482
PAT109 250080 15844362
PAT11 98582 64113569
PAT110 180680 63680037
PAT111 51647 26043244
PAT112 114191 110462189
PAT113 137703 83280548
PAT114 164155 99346275
PAT115 158877 103325984
PAT116 137417 114988187
PAT117 42311 27994848
PAT118 193712 81686401
PAT119 150217 108404022
PAT12 142065 62828791
PAT120 356051 11379688
PAT121 257211 57607099
PAT122 138161 48226925
PAT123 322021 22795469
PAT124 155639 102753887
PAT125 132727 110696284
PAT126 128341 121313309
PAT127 21664 184390005
PAT128 144888 112900567
PAT129 171997 96403773
PAT13 105888 59875034
PAT130 44618 171217879
PAT131 32863 178783372
PAT132 101779 136605525
PAT133 185919 90675669
PAT134 40991 10533134
PAT135 203659 47736667
PAT136 277827 9628431
PAT137 220409 46465135
PAT138 106723 2881242
PAT139 270386 21672571
PAT14 103650 50160806
PAT140 186752 61240505
PAT141 109806 106057338
PAT142 47510 9549213
PAT143 87299 88249520
PAT144 78465 95588128
PAT145 145203 77694924
PAT146 167502 71382965
PAT147 121478 92946121
PAT148 102970 85396699
PAT149 165555 45999641
PAT15 121150 53321659
PAT150 270022 5130418
PAT151 269978 5129582
PAT152 269978 5129582
PAT153 237888 4519872
PAT154 269396 5118524
PAT155 235715 25782943
PAT156 204520 46982479
PAT157 11012 386670
PAT158 165317 74871979
PAT159 91688 126658582
PAT16 113145 61277722
PAT160 172595 71660689
PAT161 176373 73735662
PAT162 90005 126442546
PAT163 161045 78412777
PAT164 5451 2786631
PAT17 39141 16227175
PAT18 146771 52594264
PAT19 153705 78039102
PAT2 194541 84646269
PAT20 104995 118172564
PAT21 133550 95503155
PAT22 84598 79322013
PAT23 123566 103406367
PAT24 119412 105655419
PAT25 145492 86671235
PAT26 175170 64298181
PAT27 71360 1784000
PAT28 102171 77387698
PAT29 93958 87647590
PAT3 171983 95895053
PAT30 119942 61671615
PAT31 96648 78966734
PAT32 128385 55032969
PAT33 92206 51116228
PAT34 111299 78151838
PAT35 138103 29119101
PAT36 158499 24085905
PAT37 114684 49015396
PAT38 44863 54579873
PAT39 95734 83197609
PAT4 153735 106065154
PAT40 100230 70978875
PAT41 136206 39303264
PAT42 143780 35446924
PAT43 123733 64747040
PAT44 104353 81197501
PAT45 93445 74211542
PAT46 113255 66591457
PAT47 65218 54831902
PAT48 135193 108001084
PAT49 167081 97032398
PAT5 57193 23949203
PAT50 116397 127555645
PAT51 196343 76722711
PAT52 80302 127991032
PAT53 27631 180872621
PAT54 185408 93066629
PAT55 274259 6856475
PAT56 129447 31627433
PAT57 161320 77719729
PAT58 92812 89404206
PAT59 106517 74781811
PAT6 170642 91909261
PAT60 122361 64031080
PAT61 67425 30297598
PAT62 70750 109767817
PAT63 87947 82758966
PAT64 92971 78937516
PAT65 93166 72441718
PAT66 93384 75085880
PAT67 115775 60531183
PAT68 102736 9941783
PAT69 175933 10547809
PAT7 154786 88238970
PAT70 171510 10872561
PAT71 171496 10866737
PAT72 99859 86225043
PAT73 99 196466297
PAT74 67 192869889
PAT75 103 195600591
PAT76 1137 196318757
PAT77 97599 5772236
PAT78 151009 9636510
PAT79 151022 9621259
PAT8 131210 96924023
PAT80 151024 9622125
PAT81 151021 9620837
PAT82 94633 88060720
PAT83 93691 93465245
PAT84 34070 33980300
PAT85 83459 93185861
PAT86 15570 180450165
PAT87 164903 19209995
PAT88 178944 3399936
PAT89 177434 3371246
PAT9 129398 101135301
PAT90 175304 3330776
PAT91 101387 1926353
PAT92 169171 12412246
PAT93 178699 3395281
PAT94 178691 3395129
PAT95 178677 3394863
PAT96 140780 2674820
PAT97 178683 3394977
PAT98 178342 3388498
PAT99 178198 3385762
PHG1 6010 54287813
PLN1 59893 93478848
PLN10 37384 49321439
PLN11 40299 65748766
PLN12 22455 124054133
PLN13 21102 99347489
PLN14 17578 144865462
PLN15 17634 146278605
PLN16 17564 146392665
PLN17 24586 128622194
PLN18 6000 149205408
PLN19 1266 170315035
PLN2 32516 124586090
PLN20 14362 155620121
PLN21 6893 8116708
PLN22 67273 69787754
PLN23 29373 31550432
PLN24 77010 76401076
PLN25 65434 81419582
PLN26 41006 115887323
PLN27 32 71904925
PLN28 828 90039722
PLN29 24837 128290004
PLN3 1364 179434193
PLN30 22393 130882948
PLN31 77409 75365215
PLN32 99030 57861332
PLN33 27175 28515711
PLN34 80705 71328623
PLN35 78006 75876424
PLN36 80042 70388776
PLN37 81922 75966126
PLN38 47486 24741812
PLN39 101386 57355746
PLN4 1861 186095662
PLN40 80556 70099451
PLN41 45787 99189301
PLN42 17616 144051825
PLN43 61498 91644320
PLN44 82026 72182691
PLN45 78515 71898437
PLN46 84035 62141119
PLN47 75812 73927711
PLN48 37694 67061947
PLN5 1844 194307946
PLN6 1797 192283335
PLN7 58435 93138241
PLN8 39967 38104243
PLN9 73118 75865576
PRI1 23016 59646733
PRI10 1278 179364533
PRI11 760 92321122
PRI12 1278 179183454
PRI13 1451 177770436
PRI14 1589 180081042
PRI15 1591 181937113
PRI16 1285 191720215
PRI17 1137 193649117
PRI18 1098 194157243
PRI19 1165 193624176
PRI2 18071 149564618
PRI20 1751 191797566
PRI21 2705 189576657
PRI22 21110 117963601
PRI23 32189 85194360
PRI24 61520 78165289
PRI25 30701 68932580
PRI26 6591 166738065
PRI27 2118 180651014
PRI28 1602 181630351
PRI29 2026 181733036
PRI3 1434 175236111
PRI30 1967 180488471
PRI31 13163 154018852
PRI32 1296 183210240
PRI33 43528 104497904
PRI34 21723 27586271
PRI35 32189 63608729
PRI36 20251 117460287
PRI37 18661 146846887
PRI38 66810 86782670
PRI39 49678 89403265
PRI4 1286 185640768
PRI40 38730 71447417
PRI41 56809 86902576
PRI42 44847 82692307
PRI5 1320 184150058
PRI6 1182 180046846
PRI7 1247 181145824
PRI8 1214 178287408
PRI9 1362 174588443
ROD1 32234 140799970
ROD10 987 181481529
ROD11 232 44057446
ROD12 1034 185475616
ROD13 940 182704112
ROD14 1040 189324025
ROD15 950 180306408
ROD16 967 182057152
ROD17 991 185812687
ROD18 1190 190433525
ROD19 16848 137787519
ROD2 915 175393752
ROD20 20213 148416187
ROD21 1135 182126583
ROD22 1067 166443935
ROD23 13615 162601089
ROD24 38730 69919496
ROD25 21989 103762409
ROD26 1519 187646657
ROD27 133914 37772022
ROD28 84400 70219346
ROD29 37777 42828777
ROD3 905 173299235
ROD4 900 173792415
ROD5 923 174315076
ROD6 966 178209811
ROD7 968 179457909
ROD8 979 181267813
ROD9 994 181774273
STS1 85281 36762778
STS10 57907 44419975
STS11 48899 37494991
STS12 57924 43637361
STS13 64508 42945539
STS14 94031 34249403
STS15 104277 26529909
STS16 9476 2568271
STS17 103611 27476228
STS18 86930 34448685
STS19 99734 33367534
STS2 84353 49850244
STS20 54198 20560211
STS3 67110 26414958
STS4 76828 36949991
STS5 8356 4902803
STS6 54259 31650966
STS7 54162 31838227
STS8 54316 31957697
STS9 55727 37775857
SYN1 44165 73396773
SYN2 48685 68947579
SYN3 5842 10961296
TSA1 120497 38242009
TSA10 114745 46902618
TSA11 86486 70566494
TSA12 121991 38853496
TSA13 134868 35825115
TSA14 60971 79702835
TSA15 39395 53450233
TSA16 88109 76513628
TSA17 105624 51396283
TSA18 103747 54301544
TSA19 107474 46456288
TSA2 113528 41669914
TSA20 31302 21267476
TSA21 69303 60110081
TSA22 91420 63773811
TSA23 82796 86084394
TSA24 90673 68550984
TSA25 37158 30293914
TSA26 118273 46635529
TSA27 90618 69209954
TSA28 94274 69902690
TSA29 93641 71486117
TSA3 110398 41017904
TSA30 6422 3949605
TSA4 110951 45737363
TSA5 43154 10919402
TSA6 112617 59544561
TSA7 95600 66338635
TSA8 105789 68711723
TSA9 106966 66829062
UNA1 239 125912
VRL1 68929 68423438
VRL10 55870 73247652
VRL11 9424 11321394
VRL12 62663 71300528
VRL13 58322 72592353
VRL14 62724 65431464
VRL15 59581 72969504
VRL16 58363 71484601
VRL17 58937 75344007
VRL18 29705 27525261
VRL2 73813 64007445
VRL3 69467 61217254
VRL4 68065 70354123
VRL5 44835 46897999
VRL6 48308 77572131
VRL7 56023 71496840
VRL8 63404 71384181
VRL9 66789 68756692
VRT1 37747 129977466
VRT10 1256 189217442
VRT11 8274 177839690
VRT12 3993 136596069
VRT13 13095 170781188
VRT14 5353 182590497
VRT15 3933 185932353
VRT16 37736 134386262
VRT17 79862 68489713
VRT18 78479 66474161
VRT19 29983 24362251
VRT2 6878 185291420
VRT20 69550 80551884
VRT21 49822 116403022
VRT22 75854 63478254
VRT23 76543 60322130
VRT24 11400 10789674
VRT3 66895 85202097
VRT4 12596 164092518
VRT5 27001 21326854
VRT6 73007 66822336
VRT7 31734 63524549
VRT8 30670 111983994
VRT9 1203 190000786
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 184.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:
Entries Bases Species
19212713 15779269456 Homo sapiens
9058978 9032978610 Mus musculus
2186632 6501046598 Rattus norvegicus
2199019 5381035749 Bos taurus
3925973 5054346444 Zea mays
3221535 4797711307 Sus scrofa
1705068 3127769453 Danio rerio
228264 1352945341 Strongylocentrotus purpuratus
1342034 1250435330 Oryza sativa Japonica Group
1770154 1194814175 Nicotiana tabacum
1424323 1147234009 Xenopus (Silurana) tropicalis
2320917 1136991872 Arabidopsis thaliana
1223998 1058262648 Drosophila melanogaster
214215 1002723209 Pan troglodytes
1454123 944022415 Canis lupus familiaris
662423 915245634 Vitis vinifera
811468 895067303 Gallus gallus
1890104 894979019 Glycine max
82695 827070417 Macaca mulatta
738269 760148243 Solanum lycopersicum
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
October 15 2010
NCBI-GenBank Flat File Release 184.0
Bacterial Sequences (Part 1)
51396 loci, 92682287 bases, from 51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
or 2010.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA).
Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
DBLINK Project:18787
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK Project:100,200,300
DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:
http://www.ncbi.nlm.nih.gov/genomes/static/gprj_help.html#introduction
As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 184.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Michel Eschenbrenner, Irene Fang,
Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Leigh Riley, Gert Roosen, Susan Schafer,
Ruth Timme, Beverly Underwood, Melissa Wright, and Linda Yankie
Data Management and Preparation
Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
WonHee Jang, Jonathan Kans, Leonid Khotomliansky, Michael Kimelman,
Jim Ostell, Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov
Database Administration
Slava Khotomliansky, Igor Lozitskiy, Ben Slade, Constantin Vasilyev
User Support
Peter Cooper, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
