Release Notes For GenBank Release 187
GBREL.TXT Genetic Sequence Data Bank
December 15 2011
NCBI-GenBank Flat File Release 187.0
Distribution Release Notes
146413798 loci, 135117731375 bases, from 146413798 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 187.0
1.2 Cutoff Date
1.3 Important Changes in Release 187.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 187.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for GenBank's web-based submission tool (BankIt) :
http://www.ncbi.nlm.nih.gov/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 187.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana, courtesy of the Bio-Mirror project:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:
http://www.bio-mirror.net/
1.2 Cutoff Date
This full release, 187.0, incorporates data available to the collaborating
databases as of December 15, 2011 at approximately 1:30am EST. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 187.0
1.3.1 Organizational changes
The total number of sequence data files increased by 38 with this release:
- the BCT division is now composed of 80 files (+3)
- the CON division is now composed of 162 files (+10)
- the ENV division is now composed of 46 files (+3)
- the EST division is now composed of 451 files (+1)
- the GSS division is now composed of 251 files (+3)
- the INV division is now composed of 32 files (+2)
- the PAT division is now composed of 173 files (+2)
- the PLN division is now composed of 52 files (+1)
- the SYN division is now composed of 7 files (+4)
- the TSA division is now composed of 51 files (+8)
- the VRT division is now composed of 25 files (+1)
The total number of 'index' files increased by 2 with this release:
- the AUT (author name) index is now composed of 92 files (+1)
- the JOU (journal name) index is now composed of 13 files (+1)
1.3.2 Project DBLINKs transitioning to BioProject
The Genome Project Database resource at the NCBI was redesigned in
recent months, culminating in the implementation of a new BioProject
resource:
http://www.ncbi.nlm.nih.gov/bioproject
An article that describes the goals of BioProject is available:
http://www.ncbi.nlm.nih.gov/books/NBK54015/
BioProject is a collaborative effort of the International Nucleotide
Sequence Database Collaboration (INSDC), and project data are exchanged
with NCBI's partner INSDC institutions, EBI and DDBJ. A BioProject
website is also available at DDBJ:
http://trace.ddbj.nig.ac.jp/bioproject/index_e.shtml
BioProjects are uniquely identified by BioProject Accession Numbers,
which utilize this format:
"PRJ"
"E" or "N" or "D"
one letter
one or more digits
Examples of valid BioProject accessions are PRJNA12521 and PRJEB1 .
With BioProject now in operation, we are preparing to implement links
from sequence records to the new resource. Previously, links to the
Genome Project Database were provided by numeric 'Project' DBLINKs .
Here's an example for a bacterial complete-genome record:
LOCUS CP002497 1110245 bp DNA linear PLN 14-NOV-2011
DEFINITION Eremothecium cymbalariae DBVPG#7215 chromosome 1, complete
sequence.
ACCESSION CP002497
VERSION CP002497.1 GI:356887709
DBLINK Project: 60715
When this link is switched to a BioProject accession, the DBLINK
line will change slightly:
LOCUS CP002497 1110245 bp DNA linear PLN 14-NOV-2011
DEFINITION Eremothecium cymbalariae DBVPG#7215 chromosome 1, complete
sequence.
ACCESSION CP002497
VERSION CP002497.1 GI:356887709
DBLINK BioProject: PRJNA60715
In the coming weeks, many millions of sequence records will gradually
be modified, to make use of the new BioProject DBLINK. They will not be
distributed via daily GenBank and RefSeq incremetal update products.
However, these new BioProject links *will* start to be seen in GenBank
and RefSeq release products as of December 2011. In addition, the new
BioProject links will become visible via NCBI's Entrez:Nucleotide
resource, as soon as the modification process begins.
1.3.3 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.4 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
103 of the GSS flatfiles in Release 187.0. Consider gbgss149.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
December 15 2011
NCBI-GenBank Flat File Release 187.0
GSS Sequences (Part 1)
87118 loci, 64000130 bases, from 87118 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "149" based on the number of files dumped from the other
system. We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.
1.4 Upcoming Changes
There are no changes scheduled for implementation in the April 2012
GenBank Release.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1724 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut74.idx - Index of the entries according to author name, part 74.
76. gbaut75.idx - Index of the entries according to author name, part 75.
77. gbaut76.idx - Index of the entries according to author name, part 76.
78. gbaut77.idx - Index of the entries according to author name, part 77.
79. gbaut78.idx - Index of the entries according to author name, part 78.
80. gbaut79.idx - Index of the entries according to author name, part 79.
81. gbaut8.idx - Index of the entries according to author name, part 8.
82. gbaut80.idx - Index of the entries according to author name, part 80.
83. gbaut81.idx - Index of the entries according to author name, part 81.
84. gbaut82.idx - Index of the entries according to author name, part 82.
85. gbaut83.idx - Index of the entries according to author name, part 83.
86. gbaut84.idx - Index of the entries according to author name, part 84.
87. gbaut85.idx - Index of the entries according to author name, part 85.
88. gbaut86.idx - Index of the entries according to author name, part 86.
89. gbaut87.idx - Index of the entries according to author name, part 87.
90. gbaut88.idx - Index of the entries according to author name, part 88.
91. gbaut89.idx - Index of the entries according to author name, part 89.
92. gbaut9.idx - Index of the entries according to author name, part 9.
93. gbaut90.idx - Index of the entries according to author name, part 90.
94. gbaut91.idx - Index of the entries according to author name, part 91.
95. gbaut92.idx - Index of the entries according to author name, part 92.
96. gbbct1.seq - Bacterial sequence entries, part 1.
97. gbbct10.seq - Bacterial sequence entries, part 10.
98. gbbct11.seq - Bacterial sequence entries, part 11.
99. gbbct12.seq - Bacterial sequence entries, part 12.
100. gbbct13.seq - Bacterial sequence entries, part 13.
101. gbbct14.seq - Bacterial sequence entries, part 14.
102. gbbct15.seq - Bacterial sequence entries, part 15.
103. gbbct16.seq - Bacterial sequence entries, part 16.
104. gbbct17.seq - Bacterial sequence entries, part 17.
105. gbbct18.seq - Bacterial sequence entries, part 18.
106. gbbct19.seq - Bacterial sequence entries, part 19.
107. gbbct2.seq - Bacterial sequence entries, part 2.
108. gbbct20.seq - Bacterial sequence entries, part 20.
109. gbbct21.seq - Bacterial sequence entries, part 21.
110. gbbct22.seq - Bacterial sequence entries, part 22.
111. gbbct23.seq - Bacterial sequence entries, part 23.
112. gbbct24.seq - Bacterial sequence entries, part 24.
113. gbbct25.seq - Bacterial sequence entries, part 25.
114. gbbct26.seq - Bacterial sequence entries, part 26.
115. gbbct27.seq - Bacterial sequence entries, part 27.
116. gbbct28.seq - Bacterial sequence entries, part 28.
117. gbbct29.seq - Bacterial sequence entries, part 29.
118. gbbct3.seq - Bacterial sequence entries, part 3.
119. gbbct30.seq - Bacterial sequence entries, part 30.
120. gbbct31.seq - Bacterial sequence entries, part 31.
121. gbbct32.seq - Bacterial sequence entries, part 32.
122. gbbct33.seq - Bacterial sequence entries, part 33.
123. gbbct34.seq - Bacterial sequence entries, part 34.
124. gbbct35.seq - Bacterial sequence entries, part 35.
125. gbbct36.seq - Bacterial sequence entries, part 36.
126. gbbct37.seq - Bacterial sequence entries, part 37.
127. gbbct38.seq - Bacterial sequence entries, part 38.
128. gbbct39.seq - Bacterial sequence entries, part 39.
129. gbbct4.seq - Bacterial sequence entries, part 4.
130. gbbct40.seq - Bacterial sequence entries, part 40.
131. gbbct41.seq - Bacterial sequence entries, part 41.
132. gbbct42.seq - Bacterial sequence entries, part 42.
133. gbbct43.seq - Bacterial sequence entries, part 43.
134. gbbct44.seq - Bacterial sequence entries, part 44.
135. gbbct45.seq - Bacterial sequence entries, part 45.
136. gbbct46.seq - Bacterial sequence entries, part 46.
137. gbbct47.seq - Bacterial sequence entries, part 47.
138. gbbct48.seq - Bacterial sequence entries, part 48.
139. gbbct49.seq - Bacterial sequence entries, part 49.
140. gbbct5.seq - Bacterial sequence entries, part 5.
141. gbbct50.seq - Bacterial sequence entries, part 50.
142. gbbct51.seq - Bacterial sequence entries, part 51.
143. gbbct52.seq - Bacterial sequence entries, part 52.
144. gbbct53.seq - Bacterial sequence entries, part 53.
145. gbbct54.seq - Bacterial sequence entries, part 54.
146. gbbct55.seq - Bacterial sequence entries, part 55.
147. gbbct56.seq - Bacterial sequence entries, part 56.
148. gbbct57.seq - Bacterial sequence entries, part 57.
149. gbbct58.seq - Bacterial sequence entries, part 58.
150. gbbct59.seq - Bacterial sequence entries, part 59.
151. gbbct6.seq - Bacterial sequence entries, part 6.
152. gbbct60.seq - Bacterial sequence entries, part 60.
153. gbbct61.seq - Bacterial sequence entries, part 61.
154. gbbct62.seq - Bacterial sequence entries, part 62.
155. gbbct63.seq - Bacterial sequence entries, part 63.
156. gbbct64.seq - Bacterial sequence entries, part 64.
157. gbbct65.seq - Bacterial sequence entries, part 65.
158. gbbct66.seq - Bacterial sequence entries, part 66.
159. gbbct67.seq - Bacterial sequence entries, part 67.
160. gbbct68.seq - Bacterial sequence entries, part 68.
161. gbbct69.seq - Bacterial sequence entries, part 69.
162. gbbct7.seq - Bacterial sequence entries, part 7.
163. gbbct70.seq - Bacterial sequence entries, part 70.
164. gbbct71.seq - Bacterial sequence entries, part 71.
165. gbbct72.seq - Bacterial sequence entries, part 72.
166. gbbct73.seq - Bacterial sequence entries, part 73.
167. gbbct74.seq - Bacterial sequence entries, part 74.
168. gbbct75.seq - Bacterial sequence entries, part 75.
169. gbbct76.seq - Bacterial sequence entries, part 76.
170. gbbct77.seq - Bacterial sequence entries, part 77.
171. gbbct78.seq - Bacterial sequence entries, part 78.
172. gbbct79.seq - Bacterial sequence entries, part 79.
173. gbbct8.seq - Bacterial sequence entries, part 8.
174. gbbct80.seq - Bacterial sequence entries, part 80.
175. gbbct9.seq - Bacterial sequence entries, part 9.
176. gbchg.txt - Accession numbers of entries updated since the previous release.
177. gbcon1.seq - Constructed sequence entries, part 1.
178. gbcon10.seq - Constructed sequence entries, part 10.
179. gbcon100.seq - Constructed sequence entries, part 100.
180. gbcon101.seq - Constructed sequence entries, part 101.
181. gbcon102.seq - Constructed sequence entries, part 102.
182. gbcon103.seq - Constructed sequence entries, part 103.
183. gbcon104.seq - Constructed sequence entries, part 104.
184. gbcon105.seq - Constructed sequence entries, part 105.
185. gbcon106.seq - Constructed sequence entries, part 106.
186. gbcon107.seq - Constructed sequence entries, part 107.
187. gbcon108.seq - Constructed sequence entries, part 108.
188. gbcon109.seq - Constructed sequence entries, part 109.
189. gbcon11.seq - Constructed sequence entries, part 11.
190. gbcon110.seq - Constructed sequence entries, part 110.
191. gbcon111.seq - Constructed sequence entries, part 111.
192. gbcon112.seq - Constructed sequence entries, part 112.
193. gbcon113.seq - Constructed sequence entries, part 113.
194. gbcon114.seq - Constructed sequence entries, part 114.
195. gbcon115.seq - Constructed sequence entries, part 115.
196. gbcon116.seq - Constructed sequence entries, part 116.
197. gbcon117.seq - Constructed sequence entries, part 117.
198. gbcon118.seq - Constructed sequence entries, part 118.
199. gbcon119.seq - Constructed sequence entries, part 119.
200. gbcon12.seq - Constructed sequence entries, part 12.
201. gbcon120.seq - Constructed sequence entries, part 120.
202. gbcon121.seq - Constructed sequence entries, part 121.
203. gbcon122.seq - Constructed sequence entries, part 122.
204. gbcon123.seq - Constructed sequence entries, part 123.
205. gbcon124.seq - Constructed sequence entries, part 124.
206. gbcon125.seq - Constructed sequence entries, part 125.
207. gbcon126.seq - Constructed sequence entries, part 126.
208. gbcon127.seq - Constructed sequence entries, part 127.
209. gbcon128.seq - Constructed sequence entries, part 128.
210. gbcon129.seq - Constructed sequence entries, part 129.
211. gbcon13.seq - Constructed sequence entries, part 13.
212. gbcon130.seq - Constructed sequence entries, part 130.
213. gbcon131.seq - Constructed sequence entries, part 131.
214. gbcon132.seq - Constructed sequence entries, part 132.
215. gbcon133.seq - Constructed sequence entries, part 133.
216. gbcon134.seq - Constructed sequence entries, part 134.
217. gbcon135.seq - Constructed sequence entries, part 135.
218. gbcon136.seq - Constructed sequence entries, part 136.
219. gbcon137.seq - Constructed sequence entries, part 137.
220. gbcon138.seq - Constructed sequence entries, part 138.
221. gbcon139.seq - Constructed sequence entries, part 139.
222. gbcon14.seq - Constructed sequence entries, part 14.
223. gbcon140.seq - Constructed sequence entries, part 140.
224. gbcon141.seq - Constructed sequence entries, part 141.
225. gbcon142.seq - Constructed sequence entries, part 142.
226. gbcon143.seq - Constructed sequence entries, part 143.
227. gbcon144.seq - Constructed sequence entries, part 144.
228. gbcon145.seq - Constructed sequence entries, part 145.
229. gbcon146.seq - Constructed sequence entries, part 146.
230. gbcon147.seq - Constructed sequence entries, part 147.
231. gbcon148.seq - Constructed sequence entries, part 148.
232. gbcon149.seq - Constructed sequence entries, part 149.
233. gbcon15.seq - Constructed sequence entries, part 15.
234. gbcon150.seq - Constructed sequence entries, part 150.
235. gbcon151.seq - Constructed sequence entries, part 151.
236. gbcon152.seq - Constructed sequence entries, part 152.
237. gbcon153.seq - Constructed sequence entries, part 153.
238. gbcon154.seq - Constructed sequence entries, part 154.
239. gbcon155.seq - Constructed sequence entries, part 155.
240. gbcon156.seq - Constructed sequence entries, part 156.
241. gbcon157.seq - Constructed sequence entries, part 157.
242. gbcon158.seq - Constructed sequence entries, part 158.
243. gbcon159.seq - Constructed sequence entries, part 159.
244. gbcon16.seq - Constructed sequence entries, part 16.
245. gbcon160.seq - Constructed sequence entries, part 160.
246. gbcon161.seq - Constructed sequence entries, part 161.
247. gbcon162.seq - Constructed sequence entries, part 162.
248. gbcon17.seq - Constructed sequence entries, part 17.
249. gbcon18.seq - Constructed sequence entries, part 18.
250. gbcon19.seq - Constructed sequence entries, part 19.
251. gbcon2.seq - Constructed sequence entries, part 2.
252. gbcon20.seq - Constructed sequence entries, part 20.
253. gbcon21.seq - Constructed sequence entries, part 21.
254. gbcon22.seq - Constructed sequence entries, part 22.
255. gbcon23.seq - Constructed sequence entries, part 23.
256. gbcon24.seq - Constructed sequence entries, part 24.
257. gbcon25.seq - Constructed sequence entries, part 25.
258. gbcon26.seq - Constructed sequence entries, part 26.
259. gbcon27.seq - Constructed sequence entries, part 27.
260. gbcon28.seq - Constructed sequence entries, part 28.
261. gbcon29.seq - Constructed sequence entries, part 29.
262. gbcon3.seq - Constructed sequence entries, part 3.
263. gbcon30.seq - Constructed sequence entries, part 30.
264. gbcon31.seq - Constructed sequence entries, part 31.
265. gbcon32.seq - Constructed sequence entries, part 32.
266. gbcon33.seq - Constructed sequence entries, part 33.
267. gbcon34.seq - Constructed sequence entries, part 34.
268. gbcon35.seq - Constructed sequence entries, part 35.
269. gbcon36.seq - Constructed sequence entries, part 36.
270. gbcon37.seq - Constructed sequence entries, part 37.
271. gbcon38.seq - Constructed sequence entries, part 38.
272. gbcon39.seq - Constructed sequence entries, part 39.
273. gbcon4.seq - Constructed sequence entries, part 4.
274. gbcon40.seq - Constructed sequence entries, part 40.
275. gbcon41.seq - Constructed sequence entries, part 41.
276. gbcon42.seq - Constructed sequence entries, part 42.
277. gbcon43.seq - Constructed sequence entries, part 43.
278. gbcon44.seq - Constructed sequence entries, part 44.
279. gbcon45.seq - Constructed sequence entries, part 45.
280. gbcon46.seq - Constructed sequence entries, part 46.
281. gbcon47.seq - Constructed sequence entries, part 47.
282. gbcon48.seq - Constructed sequence entries, part 48.
283. gbcon49.seq - Constructed sequence entries, part 49.
284. gbcon5.seq - Constructed sequence entries, part 5.
285. gbcon50.seq - Constructed sequence entries, part 50.
286. gbcon51.seq - Constructed sequence entries, part 51.
287. gbcon52.seq - Constructed sequence entries, part 52.
288. gbcon53.seq - Constructed sequence entries, part 53.
289. gbcon54.seq - Constructed sequence entries, part 54.
290. gbcon55.seq - Constructed sequence entries, part 55.
291. gbcon56.seq - Constructed sequence entries, part 56.
292. gbcon57.seq - Constructed sequence entries, part 57.
293. gbcon58.seq - Constructed sequence entries, part 58.
294. gbcon59.seq - Constructed sequence entries, part 59.
295. gbcon6.seq - Constructed sequence entries, part 6.
296. gbcon60.seq - Constructed sequence entries, part 60.
297. gbcon61.seq - Constructed sequence entries, part 61.
298. gbcon62.seq - Constructed sequence entries, part 62.
299. gbcon63.seq - Constructed sequence entries, part 63.
300. gbcon64.seq - Constructed sequence entries, part 64.
301. gbcon65.seq - Constructed sequence entries, part 65.
302. gbcon66.seq - Constructed sequence entries, part 66.
303. gbcon67.seq - Constructed sequence entries, part 67.
304. gbcon68.seq - Constructed sequence entries, part 68.
305. gbcon69.seq - Constructed sequence entries, part 69.
306. gbcon7.seq - Constructed sequence entries, part 7.
307. gbcon70.seq - Constructed sequence entries, part 70.
308. gbcon71.seq - Constructed sequence entries, part 71.
309. gbcon72.seq - Constructed sequence entries, part 72.
310. gbcon73.seq - Constructed sequence entries, part 73.
311. gbcon74.seq - Constructed sequence entries, part 74.
312. gbcon75.seq - Constructed sequence entries, part 75.
313. gbcon76.seq - Constructed sequence entries, part 76.
314. gbcon77.seq - Constructed sequence entries, part 77.
315. gbcon78.seq - Constructed sequence entries, part 78.
316. gbcon79.seq - Constructed sequence entries, part 79.
317. gbcon8.seq - Constructed sequence entries, part 8.
318. gbcon80.seq - Constructed sequence entries, part 80.
319. gbcon81.seq - Constructed sequence entries, part 81.
320. gbcon82.seq - Constructed sequence entries, part 82.
321. gbcon83.seq - Constructed sequence entries, part 83.
322. gbcon84.seq - Constructed sequence entries, part 84.
323. gbcon85.seq - Constructed sequence entries, part 85.
324. gbcon86.seq - Constructed sequence entries, part 86.
325. gbcon87.seq - Constructed sequence entries, part 87.
326. gbcon88.seq - Constructed sequence entries, part 88.
327. gbcon89.seq - Constructed sequence entries, part 89.
328. gbcon9.seq - Constructed sequence entries, part 9.
329. gbcon90.seq - Constructed sequence entries, part 90.
330. gbcon91.seq - Constructed sequence entries, part 91.
331. gbcon92.seq - Constructed sequence entries, part 92.
332. gbcon93.seq - Constructed sequence entries, part 93.
333. gbcon94.seq - Constructed sequence entries, part 94.
334. gbcon95.seq - Constructed sequence entries, part 95.
335. gbcon96.seq - Constructed sequence entries, part 96.
336. gbcon97.seq - Constructed sequence entries, part 97.
337. gbcon98.seq - Constructed sequence entries, part 98.
338. gbcon99.seq - Constructed sequence entries, part 99.
339. gbdel.txt - Accession numbers of entries deleted since the previous release.
340. gbenv1.seq - Environmental sampling sequence entries, part 1.
341. gbenv10.seq - Environmental sampling sequence entries, part 10.
342. gbenv11.seq - Environmental sampling sequence entries, part 11.
343. gbenv12.seq - Environmental sampling sequence entries, part 12.
344. gbenv13.seq - Environmental sampling sequence entries, part 13.
345. gbenv14.seq - Environmental sampling sequence entries, part 14.
346. gbenv15.seq - Environmental sampling sequence entries, part 15.
347. gbenv16.seq - Environmental sampling sequence entries, part 16.
348. gbenv17.seq - Environmental sampling sequence entries, part 17.
349. gbenv18.seq - Environmental sampling sequence entries, part 18.
350. gbenv19.seq - Environmental sampling sequence entries, part 19.
351. gbenv2.seq - Environmental sampling sequence entries, part 2.
352. gbenv20.seq - Environmental sampling sequence entries, part 20.
353. gbenv21.seq - Environmental sampling sequence entries, part 21.
354. gbenv22.seq - Environmental sampling sequence entries, part 22.
355. gbenv23.seq - Environmental sampling sequence entries, part 23.
356. gbenv24.seq - Environmental sampling sequence entries, part 24.
357. gbenv25.seq - Environmental sampling sequence entries, part 25.
358. gbenv26.seq - Environmental sampling sequence entries, part 26.
359. gbenv27.seq - Environmental sampling sequence entries, part 27.
360. gbenv28.seq - Environmental sampling sequence entries, part 28.
361. gbenv29.seq - Environmental sampling sequence entries, part 29.
362. gbenv3.seq - Environmental sampling sequence entries, part 3.
363. gbenv30.seq - Environmental sampling sequence entries, part 30.
364. gbenv31.seq - Environmental sampling sequence entries, part 31.
365. gbenv32.seq - Environmental sampling sequence entries, part 32.
366. gbenv33.seq - Environmental sampling sequence entries, part 33.
367. gbenv34.seq - Environmental sampling sequence entries, part 34.
368. gbenv35.seq - Environmental sampling sequence entries, part 35.
369. gbenv36.seq - Environmental sampling sequence entries, part 36.
370. gbenv37.seq - Environmental sampling sequence entries, part 37.
371. gbenv38.seq - Environmental sampling sequence entries, part 38.
372. gbenv39.seq - Environmental sampling sequence entries, part 39.
373. gbenv4.seq - Environmental sampling sequence entries, part 4.
374. gbenv40.seq - Environmental sampling sequence entries, part 40.
375. gbenv41.seq - Environmental sampling sequence entries, part 41.
376. gbenv42.seq - Environmental sampling sequence entries, part 42.
377. gbenv43.seq - Environmental sampling sequence entries, part 43.
378. gbenv44.seq - Environmental sampling sequence entries, part 44.
379. gbenv45.seq - Environmental sampling sequence entries, part 45.
380. gbenv46.seq - Environmental sampling sequence entries, part 46.
381. gbenv5.seq - Environmental sampling sequence entries, part 5.
382. gbenv6.seq - Environmental sampling sequence entries, part 6.
383. gbenv7.seq - Environmental sampling sequence entries, part 7.
384. gbenv8.seq - Environmental sampling sequence entries, part 8.
385. gbenv9.seq - Environmental sampling sequence entries, part 9.
386. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
387. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
388. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
389. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
390. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
391. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
392. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
393. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
394. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
395. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
396. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
397. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
398. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
399. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
400. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
401. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
402. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
403. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
404. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
405. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
406. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
407. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
408. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
409. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
410. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
411. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
412. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
413. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
414. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
415. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
416. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
417. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
418. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
419. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
420. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
421. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
422. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
423. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
424. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
425. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
426. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
427. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
428. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
429. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
430. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
431. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
432. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
433. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
434. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
435. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
436. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
437. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
438. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
439. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
440. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
441. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
442. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
443. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
444. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
445. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
446. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
447. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
448. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
449. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
450. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
451. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
452. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
453. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
454. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
455. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
456. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
457. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
458. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
459. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
460. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
461. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
462. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
463. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
464. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
465. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
466. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
467. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
468. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
469. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
470. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
471. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
472. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
473. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
474. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
475. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
476. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
477. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
478. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
479. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
480. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
481. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
482. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
483. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
484. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
485. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
486. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
487. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
488. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
489. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
490. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
491. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
492. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
493. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
494. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
495. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
496. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
497. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
498. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
499. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
500. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
501. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
502. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
503. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
504. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
505. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
506. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
507. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
508. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
509. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
510. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
511. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
512. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
513. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
514. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
515. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
516. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
517. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
518. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
519. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
520. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
521. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
522. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
523. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
524. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
525. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
526. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
527. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
528. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
529. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
530. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
531. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
532. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
533. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
534. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
535. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
536. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
537. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
538. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
539. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
540. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
541. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
542. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
543. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
544. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
545. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
546. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
547. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
548. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
549. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
550. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
551. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
552. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
553. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
554. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
555. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
556. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
557. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
558. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
559. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
560. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
561. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
562. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
563. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
564. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
565. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
566. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
567. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
568. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
569. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
570. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
571. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
572. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
573. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
574. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
575. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
576. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
577. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
578. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
579. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
580. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
581. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
582. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
583. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
584. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
585. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
586. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
587. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
588. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
589. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
590. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
591. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
592. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
593. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
594. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
595. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
596. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
597. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
598. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
599. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
600. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
601. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
602. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
603. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
604. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
605. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
606. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
607. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
608. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
609. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
610. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
611. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
612. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
613. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
614. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
615. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
616. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
617. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
618. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
619. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
620. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
621. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
622. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
623. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
624. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
625. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
626. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
627. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
628. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
629. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
630. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
631. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
632. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
633. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
634. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
635. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
636. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
637. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
638. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
639. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
640. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
641. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
642. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
643. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
644. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
645. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
646. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
647. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
648. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
649. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
650. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
651. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
652. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
653. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
654. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
655. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
656. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
657. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
658. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
659. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
660. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
661. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
662. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
663. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
664. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
665. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
666. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
667. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
668. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
669. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
670. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
671. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
672. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
673. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
674. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
675. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
676. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
677. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
678. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
679. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
680. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
681. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
682. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
683. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
684. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
685. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
686. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
687. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
688. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
689. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
690. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
691. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
692. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
693. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
694. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
695. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
696. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
697. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
698. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
699. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
700. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
701. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
702. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
703. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
704. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
705. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
706. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
707. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
708. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
709. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
710. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
711. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
712. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
713. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
714. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
715. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
716. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
717. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
718. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
719. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
720. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
721. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
722. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
723. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
724. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
725. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
726. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
727. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
728. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
729. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
730. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
731. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
732. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
733. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
734. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
735. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
736. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
737. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
738. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
739. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
740. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
741. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
742. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
743. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
744. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
745. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
746. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
747. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
748. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
749. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
750. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
751. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
752. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
753. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
754. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
755. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
756. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
757. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
758. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
759. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
760. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
761. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
762. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
763. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
764. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
765. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
766. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
767. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
768. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
769. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
770. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
771. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
772. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
773. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
774. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
775. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
776. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
777. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
778. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
779. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
780. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
781. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
782. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
783. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
784. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
785. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
786. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
787. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
788. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
789. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
790. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
791. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
792. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
793. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
794. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
795. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
796. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
797. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
798. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
799. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
800. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
801. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
802. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
803. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
804. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
805. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
806. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
807. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
808. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
809. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
810. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
811. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
812. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
813. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
814. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
815. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
816. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
817. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
818. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
819. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
820. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
821. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
822. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
823. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
824. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
825. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
826. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
827. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
828. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
829. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
830. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
831. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
832. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
833. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
834. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
835. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
836. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
837. gbgen.idx - Index of the entries according to gene symbols.
838. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
839. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
840. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
841. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
842. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
843. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
844. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
845. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
846. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
847. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
848. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
849. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
850. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
851. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
852. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
853. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
854. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
855. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
856. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
857. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
858. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
859. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
860. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
861. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
862. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
863. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
864. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
865. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
866. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
867. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
868. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
869. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
870. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
871. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
872. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
873. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
874. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
875. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
876. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
877. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
878. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
879. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
880. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
881. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
882. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
883. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
884. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
885. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
886. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
887. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
888. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
889. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
890. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
891. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
892. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
893. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
894. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
895. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
896. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
897. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
898. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
899. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
900. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
901. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
902. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
903. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
904. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
905. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
906. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
907. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
908. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
909. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
910. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
911. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
912. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
913. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
914. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
915. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
916. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
917. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
918. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
919. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
920. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
921. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
922. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
923. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
924. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
925. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
926. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
927. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
928. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
929. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
930. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
931. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
932. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
933. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
934. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
935. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
936. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
937. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
938. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
939. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
940. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
941. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
942. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
943. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
944. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
945. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
946. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
947. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
948. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
949. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
950. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
951. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
952. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
953. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
954. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
955. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
956. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
957. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
958. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
959. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
960. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
961. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
962. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
963. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
964. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
965. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
966. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
967. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
968. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
969. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
970. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
971. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
972. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
973. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
974. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
975. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
976. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
977. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
978. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
979. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
980. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
981. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
982. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
983. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
984. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
985. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
986. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
987. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
988. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
989. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
990. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
991. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
992. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
993. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
994. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
995. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
996. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
997. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
998. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
999. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1000. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1001. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1002. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1003. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1004. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1005. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1006. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1007. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1008. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1009. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1010. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1011. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1012. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1013. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1014. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1015. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1016. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1017. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1018. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1019. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1020. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1021. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1022. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1023. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1024. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1025. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1026. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1027. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1028. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1029. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1030. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1031. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1032. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1033. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1034. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1035. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1036. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1037. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1038. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1039. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1040. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1041. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1042. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1043. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1044. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1045. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1046. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1047. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1048. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1049. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1050. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1051. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1052. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1053. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1054. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1055. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1056. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1057. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1058. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1059. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1060. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1061. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1062. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1063. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1064. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1065. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1066. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1067. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1068. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1069. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1070. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1071. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1072. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1073. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1074. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1075. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1076. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1077. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1078. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1079. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1080. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1081. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1082. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1083. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1084. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1085. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1086. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1087. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1088. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1089. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1090. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1091. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1092. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1093. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1094. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1095. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1096. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1097. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1098. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1099. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1100. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1101. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1102. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1103. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1104. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1105. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1106. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1107. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1108. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1109. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1110. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1111. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1112. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1113. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1114. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1115. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1116. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1117. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1118. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1119. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1120. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1121. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1122. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1123. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1124. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1125. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1126. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1127. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1128. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1129. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1130. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1131. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1132. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1133. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1134. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1135. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1136. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1137. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1138. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1139. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1140. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1141. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1142. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1143. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1144. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1145. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1146. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1147. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1148. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1149. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1150. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1151. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1152. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1153. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1154. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1155. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1156. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1157. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1158. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1159. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1160. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1161. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1162. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1163. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1164. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1165. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1166. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1167. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1168. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1169. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1170. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1171. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1172. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1173. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1174. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1175. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1176. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1177. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1178. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1179. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1180. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1181. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1182. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1183. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1184. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1185. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1186. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1187. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1188. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1189. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1190. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1191. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1192. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1193. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1194. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1195. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1196. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1197. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1198. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1199. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1200. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1201. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1202. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1203. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1204. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1205. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1206. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1207. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1208. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1209. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1210. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1211. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1212. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1213. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1214. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1215. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1216. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1217. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1218. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1219. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1220. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1221. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1222. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1223. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1224. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1225. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1226. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1227. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1228. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1229. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1230. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1231. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1232. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1233. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1234. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1235. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1236. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1237. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1238. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1239. gbinv1.seq - Invertebrate sequence entries, part 1.
1240. gbinv10.seq - Invertebrate sequence entries, part 10.
1241. gbinv11.seq - Invertebrate sequence entries, part 11.
1242. gbinv12.seq - Invertebrate sequence entries, part 12.
1243. gbinv13.seq - Invertebrate sequence entries, part 13.
1244. gbinv14.seq - Invertebrate sequence entries, part 14.
1245. gbinv15.seq - Invertebrate sequence entries, part 15.
1246. gbinv16.seq - Invertebrate sequence entries, part 16.
1247. gbinv17.seq - Invertebrate sequence entries, part 17.
1248. gbinv18.seq - Invertebrate sequence entries, part 18.
1249. gbinv19.seq - Invertebrate sequence entries, part 19.
1250. gbinv2.seq - Invertebrate sequence entries, part 2.
1251. gbinv20.seq - Invertebrate sequence entries, part 20.
1252. gbinv21.seq - Invertebrate sequence entries, part 21.
1253. gbinv22.seq - Invertebrate sequence entries, part 22.
1254. gbinv23.seq - Invertebrate sequence entries, part 23.
1255. gbinv24.seq - Invertebrate sequence entries, part 24.
1256. gbinv25.seq - Invertebrate sequence entries, part 25.
1257. gbinv26.seq - Invertebrate sequence entries, part 26.
1258. gbinv27.seq - Invertebrate sequence entries, part 27.
1259. gbinv28.seq - Invertebrate sequence entries, part 28.
1260. gbinv29.seq - Invertebrate sequence entries, part 29.
1261. gbinv3.seq - Invertebrate sequence entries, part 3.
1262. gbinv30.seq - Invertebrate sequence entries, part 30.
1263. gbinv31.seq - Invertebrate sequence entries, part 31.
1264. gbinv32.seq - Invertebrate sequence entries, part 32.
1265. gbinv4.seq - Invertebrate sequence entries, part 4.
1266. gbinv5.seq - Invertebrate sequence entries, part 5.
1267. gbinv6.seq - Invertebrate sequence entries, part 6.
1268. gbinv7.seq - Invertebrate sequence entries, part 7.
1269. gbinv8.seq - Invertebrate sequence entries, part 8.
1270. gbinv9.seq - Invertebrate sequence entries, part 9.
1271. gbjou1.idx - Index of the entries according to journal citation, part 1.
1272. gbjou10.idx - Index of the entries according to journal citation, part 10.
1273. gbjou11.idx - Index of the entries according to journal citation, part 11.
1274. gbjou12.idx - Index of the entries according to journal citation, part 12.
1275. gbjou13.idx - Index of the entries according to journal citation, part 13.
1276. gbjou2.idx - Index of the entries according to journal citation, part 2.
1277. gbjou3.idx - Index of the entries according to journal citation, part 3.
1278. gbjou4.idx - Index of the entries according to journal citation, part 4.
1279. gbjou5.idx - Index of the entries according to journal citation, part 5.
1280. gbjou6.idx - Index of the entries according to journal citation, part 6.
1281. gbjou7.idx - Index of the entries according to journal citation, part 7.
1282. gbjou8.idx - Index of the entries according to journal citation, part 8.
1283. gbjou9.idx - Index of the entries according to journal citation, part 9.
1284. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1285. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1286. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1287. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1288. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1289. gbkey6.idx - Index of the entries according to keyword phrase, part 6.
1290. gbmam1.seq - Other mammalian sequence entries, part 1.
1291. gbmam2.seq - Other mammalian sequence entries, part 2.
1292. gbmam3.seq - Other mammalian sequence entries, part 3.
1293. gbmam4.seq - Other mammalian sequence entries, part 4.
1294. gbmam5.seq - Other mammalian sequence entries, part 5.
1295. gbmam6.seq - Other mammalian sequence entries, part 6.
1296. gbmam7.seq - Other mammalian sequence entries, part 7.
1297. gbnew.txt - Accession numbers of entries new since the previous release.
1298. gbpat1.seq - Patent sequence entries, part 1.
1299. gbpat10.seq - Patent sequence entries, part 10.
1300. gbpat100.seq - Patent sequence entries, part 100.
1301. gbpat101.seq - Patent sequence entries, part 101.
1302. gbpat102.seq - Patent sequence entries, part 102.
1303. gbpat103.seq - Patent sequence entries, part 103.
1304. gbpat104.seq - Patent sequence entries, part 104.
1305. gbpat105.seq - Patent sequence entries, part 105.
1306. gbpat106.seq - Patent sequence entries, part 106.
1307. gbpat107.seq - Patent sequence entries, part 107.
1308. gbpat108.seq - Patent sequence entries, part 108.
1309. gbpat109.seq - Patent sequence entries, part 109.
1310. gbpat11.seq - Patent sequence entries, part 11.
1311. gbpat110.seq - Patent sequence entries, part 110.
1312. gbpat111.seq - Patent sequence entries, part 111.
1313. gbpat112.seq - Patent sequence entries, part 112.
1314. gbpat113.seq - Patent sequence entries, part 113.
1315. gbpat114.seq - Patent sequence entries, part 114.
1316. gbpat115.seq - Patent sequence entries, part 115.
1317. gbpat116.seq - Patent sequence entries, part 116.
1318. gbpat117.seq - Patent sequence entries, part 117.
1319. gbpat118.seq - Patent sequence entries, part 118.
1320. gbpat119.seq - Patent sequence entries, part 119.
1321. gbpat12.seq - Patent sequence entries, part 12.
1322. gbpat120.seq - Patent sequence entries, part 120.
1323. gbpat121.seq - Patent sequence entries, part 121.
1324. gbpat122.seq - Patent sequence entries, part 122.
1325. gbpat123.seq - Patent sequence entries, part 123.
1326. gbpat124.seq - Patent sequence entries, part 124.
1327. gbpat125.seq - Patent sequence entries, part 125.
1328. gbpat126.seq - Patent sequence entries, part 126.
1329. gbpat127.seq - Patent sequence entries, part 127.
1330. gbpat128.seq - Patent sequence entries, part 128.
1331. gbpat129.seq - Patent sequence entries, part 129.
1332. gbpat13.seq - Patent sequence entries, part 13.
1333. gbpat130.seq - Patent sequence entries, part 130.
1334. gbpat131.seq - Patent sequence entries, part 131.
1335. gbpat132.seq - Patent sequence entries, part 132.
1336. gbpat133.seq - Patent sequence entries, part 133.
1337. gbpat134.seq - Patent sequence entries, part 134.
1338. gbpat135.seq - Patent sequence entries, part 135.
1339. gbpat136.seq - Patent sequence entries, part 136.
1340. gbpat137.seq - Patent sequence entries, part 137.
1341. gbpat138.seq - Patent sequence entries, part 138.
1342. gbpat139.seq - Patent sequence entries, part 139.
1343. gbpat14.seq - Patent sequence entries, part 14.
1344. gbpat140.seq - Patent sequence entries, part 140.
1345. gbpat141.seq - Patent sequence entries, part 141.
1346. gbpat142.seq - Patent sequence entries, part 142.
1347. gbpat143.seq - Patent sequence entries, part 143.
1348. gbpat144.seq - Patent sequence entries, part 144.
1349. gbpat145.seq - Patent sequence entries, part 145.
1350. gbpat146.seq - Patent sequence entries, part 146.
1351. gbpat147.seq - Patent sequence entries, part 147.
1352. gbpat148.seq - Patent sequence entries, part 148.
1353. gbpat149.seq - Patent sequence entries, part 149.
1354. gbpat15.seq - Patent sequence entries, part 15.
1355. gbpat150.seq - Patent sequence entries, part 150.
1356. gbpat151.seq - Patent sequence entries, part 151.
1357. gbpat152.seq - Patent sequence entries, part 152.
1358. gbpat153.seq - Patent sequence entries, part 153.
1359. gbpat154.seq - Patent sequence entries, part 154.
1360. gbpat155.seq - Patent sequence entries, part 155.
1361. gbpat156.seq - Patent sequence entries, part 156.
1362. gbpat157.seq - Patent sequence entries, part 157.
1363. gbpat158.seq - Patent sequence entries, part 158.
1364. gbpat159.seq - Patent sequence entries, part 159.
1365. gbpat16.seq - Patent sequence entries, part 16.
1366. gbpat160.seq - Patent sequence entries, part 160.
1367. gbpat161.seq - Patent sequence entries, part 161.
1368. gbpat162.seq - Patent sequence entries, part 162.
1369. gbpat163.seq - Patent sequence entries, part 163.
1370. gbpat164.seq - Patent sequence entries, part 164.
1371. gbpat165.seq - Patent sequence entries, part 165.
1372. gbpat166.seq - Patent sequence entries, part 166.
1373. gbpat167.seq - Patent sequence entries, part 167.
1374. gbpat168.seq - Patent sequence entries, part 168.
1375. gbpat169.seq - Patent sequence entries, part 169.
1376. gbpat17.seq - Patent sequence entries, part 17.
1377. gbpat170.seq - Patent sequence entries, part 170.
1378. gbpat171.seq - Patent sequence entries, part 171.
1379. gbpat172.seq - Patent sequence entries, part 172.
1380. gbpat173.seq - Patent sequence entries, part 173.
1381. gbpat18.seq - Patent sequence entries, part 18.
1382. gbpat19.seq - Patent sequence entries, part 19.
1383. gbpat2.seq - Patent sequence entries, part 2.
1384. gbpat20.seq - Patent sequence entries, part 20.
1385. gbpat21.seq - Patent sequence entries, part 21.
1386. gbpat22.seq - Patent sequence entries, part 22.
1387. gbpat23.seq - Patent sequence entries, part 23.
1388. gbpat24.seq - Patent sequence entries, part 24.
1389. gbpat25.seq - Patent sequence entries, part 25.
1390. gbpat26.seq - Patent sequence entries, part 26.
1391. gbpat27.seq - Patent sequence entries, part 27.
1392. gbpat28.seq - Patent sequence entries, part 28.
1393. gbpat29.seq - Patent sequence entries, part 29.
1394. gbpat3.seq - Patent sequence entries, part 3.
1395. gbpat30.seq - Patent sequence entries, part 30.
1396. gbpat31.seq - Patent sequence entries, part 31.
1397. gbpat32.seq - Patent sequence entries, part 32.
1398. gbpat33.seq - Patent sequence entries, part 33.
1399. gbpat34.seq - Patent sequence entries, part 34.
1400. gbpat35.seq - Patent sequence entries, part 35.
1401. gbpat36.seq - Patent sequence entries, part 36.
1402. gbpat37.seq - Patent sequence entries, part 37.
1403. gbpat38.seq - Patent sequence entries, part 38.
1404. gbpat39.seq - Patent sequence entries, part 39.
1405. gbpat4.seq - Patent sequence entries, part 4.
1406. gbpat40.seq - Patent sequence entries, part 40.
1407. gbpat41.seq - Patent sequence entries, part 41.
1408. gbpat42.seq - Patent sequence entries, part 42.
1409. gbpat43.seq - Patent sequence entries, part 43.
1410. gbpat44.seq - Patent sequence entries, part 44.
1411. gbpat45.seq - Patent sequence entries, part 45.
1412. gbpat46.seq - Patent sequence entries, part 46.
1413. gbpat47.seq - Patent sequence entries, part 47.
1414. gbpat48.seq - Patent sequence entries, part 48.
1415. gbpat49.seq - Patent sequence entries, part 49.
1416. gbpat5.seq - Patent sequence entries, part 5.
1417. gbpat50.seq - Patent sequence entries, part 50.
1418. gbpat51.seq - Patent sequence entries, part 51.
1419. gbpat52.seq - Patent sequence entries, part 52.
1420. gbpat53.seq - Patent sequence entries, part 53.
1421. gbpat54.seq - Patent sequence entries, part 54.
1422. gbpat55.seq - Patent sequence entries, part 55.
1423. gbpat56.seq - Patent sequence entries, part 56.
1424. gbpat57.seq - Patent sequence entries, part 57.
1425. gbpat58.seq - Patent sequence entries, part 58.
1426. gbpat59.seq - Patent sequence entries, part 59.
1427. gbpat6.seq - Patent sequence entries, part 6.
1428. gbpat60.seq - Patent sequence entries, part 60.
1429. gbpat61.seq - Patent sequence entries, part 61.
1430. gbpat62.seq - Patent sequence entries, part 62.
1431. gbpat63.seq - Patent sequence entries, part 63.
1432. gbpat64.seq - Patent sequence entries, part 64.
1433. gbpat65.seq - Patent sequence entries, part 65.
1434. gbpat66.seq - Patent sequence entries, part 66.
1435. gbpat67.seq - Patent sequence entries, part 67.
1436. gbpat68.seq - Patent sequence entries, part 68.
1437. gbpat69.seq - Patent sequence entries, part 69.
1438. gbpat7.seq - Patent sequence entries, part 7.
1439. gbpat70.seq - Patent sequence entries, part 70.
1440. gbpat71.seq - Patent sequence entries, part 71.
1441. gbpat72.seq - Patent sequence entries, part 72.
1442. gbpat73.seq - Patent sequence entries, part 73.
1443. gbpat74.seq - Patent sequence entries, part 74.
1444. gbpat75.seq - Patent sequence entries, part 75.
1445. gbpat76.seq - Patent sequence entries, part 76.
1446. gbpat77.seq - Patent sequence entries, part 77.
1447. gbpat78.seq - Patent sequence entries, part 78.
1448. gbpat79.seq - Patent sequence entries, part 79.
1449. gbpat8.seq - Patent sequence entries, part 8.
1450. gbpat80.seq - Patent sequence entries, part 80.
1451. gbpat81.seq - Patent sequence entries, part 81.
1452. gbpat82.seq - Patent sequence entries, part 82.
1453. gbpat83.seq - Patent sequence entries, part 83.
1454. gbpat84.seq - Patent sequence entries, part 84.
1455. gbpat85.seq - Patent sequence entries, part 85.
1456. gbpat86.seq - Patent sequence entries, part 86.
1457. gbpat87.seq - Patent sequence entries, part 87.
1458. gbpat88.seq - Patent sequence entries, part 88.
1459. gbpat89.seq - Patent sequence entries, part 89.
1460. gbpat9.seq - Patent sequence entries, part 9.
1461. gbpat90.seq - Patent sequence entries, part 90.
1462. gbpat91.seq - Patent sequence entries, part 91.
1463. gbpat92.seq - Patent sequence entries, part 92.
1464. gbpat93.seq - Patent sequence entries, part 93.
1465. gbpat94.seq - Patent sequence entries, part 94.
1466. gbpat95.seq - Patent sequence entries, part 95.
1467. gbpat96.seq - Patent sequence entries, part 96.
1468. gbpat97.seq - Patent sequence entries, part 97.
1469. gbpat98.seq - Patent sequence entries, part 98.
1470. gbpat99.seq - Patent sequence entries, part 99.
1471. gbphg1.seq - Phage sequence entries, part 1.
1472. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1473. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1474. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1475. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1476. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1477. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1478. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1479. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1480. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1481. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1482. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1483. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1484. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1485. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1486. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1487. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1488. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1489. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1490. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1491. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1492. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1493. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1494. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1495. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1496. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1497. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1498. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1499. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1500. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1501. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1502. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1503. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1504. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1505. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1506. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1507. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1508. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1509. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1510. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1511. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1512. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1513. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1514. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1515. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1516. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1517. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1518. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1519. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1520. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1521. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1522. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1523. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1524. gbpri1.seq - Primate sequence entries, part 1.
1525. gbpri10.seq - Primate sequence entries, part 10.
1526. gbpri11.seq - Primate sequence entries, part 11.
1527. gbpri12.seq - Primate sequence entries, part 12.
1528. gbpri13.seq - Primate sequence entries, part 13.
1529. gbpri14.seq - Primate sequence entries, part 14.
1530. gbpri15.seq - Primate sequence entries, part 15.
1531. gbpri16.seq - Primate sequence entries, part 16.
1532. gbpri17.seq - Primate sequence entries, part 17.
1533. gbpri18.seq - Primate sequence entries, part 18.
1534. gbpri19.seq - Primate sequence entries, part 19.
1535. gbpri2.seq - Primate sequence entries, part 2.
1536. gbpri20.seq - Primate sequence entries, part 20.
1537. gbpri21.seq - Primate sequence entries, part 21.
1538. gbpri22.seq - Primate sequence entries, part 22.
1539. gbpri23.seq - Primate sequence entries, part 23.
1540. gbpri24.seq - Primate sequence entries, part 24.
1541. gbpri25.seq - Primate sequence entries, part 25.
1542. gbpri26.seq - Primate sequence entries, part 26.
1543. gbpri27.seq - Primate sequence entries, part 27.
1544. gbpri28.seq - Primate sequence entries, part 28.
1545. gbpri29.seq - Primate sequence entries, part 29.
1546. gbpri3.seq - Primate sequence entries, part 3.
1547. gbpri30.seq - Primate sequence entries, part 30.
1548. gbpri31.seq - Primate sequence entries, part 31.
1549. gbpri32.seq - Primate sequence entries, part 32.
1550. gbpri33.seq - Primate sequence entries, part 33.
1551. gbpri34.seq - Primate sequence entries, part 34.
1552. gbpri35.seq - Primate sequence entries, part 35.
1553. gbpri36.seq - Primate sequence entries, part 36.
1554. gbpri37.seq - Primate sequence entries, part 37.
1555. gbpri38.seq - Primate sequence entries, part 38.
1556. gbpri39.seq - Primate sequence entries, part 39.
1557. gbpri4.seq - Primate sequence entries, part 4.
1558. gbpri40.seq - Primate sequence entries, part 40.
1559. gbpri41.seq - Primate sequence entries, part 41.
1560. gbpri42.seq - Primate sequence entries, part 42.
1561. gbpri43.seq - Primate sequence entries, part 43.
1562. gbpri44.seq - Primate sequence entries, part 44.
1563. gbpri5.seq - Primate sequence entries, part 5.
1564. gbpri6.seq - Primate sequence entries, part 6.
1565. gbpri7.seq - Primate sequence entries, part 7.
1566. gbpri8.seq - Primate sequence entries, part 8.
1567. gbpri9.seq - Primate sequence entries, part 9.
1568. gbrel.txt - Release notes (this document).
1569. gbrod1.seq - Rodent sequence entries, part 1.
1570. gbrod10.seq - Rodent sequence entries, part 10.
1571. gbrod11.seq - Rodent sequence entries, part 11.
1572. gbrod12.seq - Rodent sequence entries, part 12.
1573. gbrod13.seq - Rodent sequence entries, part 13.
1574. gbrod14.seq - Rodent sequence entries, part 14.
1575. gbrod15.seq - Rodent sequence entries, part 15.
1576. gbrod16.seq - Rodent sequence entries, part 16.
1577. gbrod17.seq - Rodent sequence entries, part 17.
1578. gbrod18.seq - Rodent sequence entries, part 18.
1579. gbrod19.seq - Rodent sequence entries, part 19.
1580. gbrod2.seq - Rodent sequence entries, part 2.
1581. gbrod20.seq - Rodent sequence entries, part 20.
1582. gbrod21.seq - Rodent sequence entries, part 21.
1583. gbrod22.seq - Rodent sequence entries, part 22.
1584. gbrod23.seq - Rodent sequence entries, part 23.
1585. gbrod24.seq - Rodent sequence entries, part 24.
1586. gbrod25.seq - Rodent sequence entries, part 25.
1587. gbrod26.seq - Rodent sequence entries, part 26.
1588. gbrod27.seq - Rodent sequence entries, part 27.
1589. gbrod28.seq - Rodent sequence entries, part 28.
1590. gbrod29.seq - Rodent sequence entries, part 29.
1591. gbrod3.seq - Rodent sequence entries, part 3.
1592. gbrod4.seq - Rodent sequence entries, part 4.
1593. gbrod5.seq - Rodent sequence entries, part 5.
1594. gbrod6.seq - Rodent sequence entries, part 6.
1595. gbrod7.seq - Rodent sequence entries, part 7.
1596. gbrod8.seq - Rodent sequence entries, part 8.
1597. gbrod9.seq - Rodent sequence entries, part 9.
1598. gbsdr1.txt - Short directory of the data bank, part 1.
1599. gbsdr2.txt - Short directory of the data bank, part 2.
1600. gbsdr3.txt - Short directory of the data bank, part 3.
1601. gbsec.idx - Index of the entries according to secondary accession number.
1602. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1603. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1604. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1605. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1606. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1607. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1608. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1609. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1610. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1611. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1612. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1613. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1614. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1615. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1616. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1617. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1618. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1619. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1620. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1621. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1622. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1623. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1624. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1625. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
1626. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
1627. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
1628. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
1629. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1630. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1631. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1632. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1633. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1634. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1635. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1636. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1637. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1638. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1639. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1640. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1641. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1642. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1643. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1644. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1645. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1646. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1647. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1648. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1649. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1650. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1651. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1652. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1653. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
1654. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
1655. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
1656. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
1657. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
1658. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
1659. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
1660. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
1661. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
1662. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1663. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
1664. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
1665. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
1666. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
1667. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
1668. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
1669. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
1670. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
1671. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
1672. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
1673. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1674. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
1675. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
1676. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1677. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1678. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1679. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1680. gbuna1.seq - Unannotated sequence entries, part 1.
1681. gbvrl1.seq - Viral sequence entries, part 1.
1682. gbvrl10.seq - Viral sequence entries, part 10.
1683. gbvrl11.seq - Viral sequence entries, part 11.
1684. gbvrl12.seq - Viral sequence entries, part 12.
1685. gbvrl13.seq - Viral sequence entries, part 13.
1686. gbvrl14.seq - Viral sequence entries, part 14.
1687. gbvrl15.seq - Viral sequence entries, part 15.
1688. gbvrl16.seq - Viral sequence entries, part 16.
1689. gbvrl17.seq - Viral sequence entries, part 17.
1690. gbvrl18.seq - Viral sequence entries, part 18.
1691. gbvrl19.seq - Viral sequence entries, part 19.
1692. gbvrl2.seq - Viral sequence entries, part 2.
1693. gbvrl3.seq - Viral sequence entries, part 3.
1694. gbvrl4.seq - Viral sequence entries, part 4.
1695. gbvrl5.seq - Viral sequence entries, part 5.
1696. gbvrl6.seq - Viral sequence entries, part 6.
1697. gbvrl7.seq - Viral sequence entries, part 7.
1698. gbvrl8.seq - Viral sequence entries, part 8.
1699. gbvrl9.seq - Viral sequence entries, part 9.
1700. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1701. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1702. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1703. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1704. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1705. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1706. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1707. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1708. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1709. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1710. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1711. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1712. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1713. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1714. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1715. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1716. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1717. gbvrt25.seq - Other vertebrate sequence entries, part 25.
1718. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1719. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1720. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1721. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1722. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1723. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1724. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 187.0 flatfiles require roughly 528 GB (sequence
files only) or 568 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1885314357 gbacc1.idx
2348466384 gbacc2.idx
818340573 gbacc3.idx
189647747 gbaut1.idx
185640298 gbaut10.idx
251523367 gbaut11.idx
183827472 gbaut12.idx
184951564 gbaut13.idx
184409753 gbaut14.idx
183804670 gbaut15.idx
192246434 gbaut16.idx
185667840 gbaut17.idx
216036305 gbaut18.idx
188974587 gbaut19.idx
229765820 gbaut2.idx
186462869 gbaut20.idx
183882167 gbaut21.idx
241893742 gbaut22.idx
212636146 gbaut23.idx
184087751 gbaut24.idx
183945891 gbaut25.idx
184103562 gbaut26.idx
184289699 gbaut27.idx
205039115 gbaut28.idx
183856274 gbaut29.idx
213373844 gbaut3.idx
208893616 gbaut30.idx
218148499 gbaut31.idx
188941175 gbaut32.idx
186248146 gbaut33.idx
183920026 gbaut34.idx
184351906 gbaut35.idx
187317090 gbaut36.idx
185609179 gbaut37.idx
184352250 gbaut38.idx
214170960 gbaut39.idx
185979001 gbaut4.idx
192308684 gbaut40.idx
239937873 gbaut41.idx
188783739 gbaut42.idx
255807628 gbaut43.idx
188551618 gbaut44.idx
188102011 gbaut45.idx
191917498 gbaut46.idx
185507579 gbaut47.idx
187526684 gbaut48.idx
221280975 gbaut49.idx
222363855 gbaut5.idx
186766676 gbaut50.idx
237437427 gbaut51.idx
190225211 gbaut52.idx
184708340 gbaut53.idx
198024663 gbaut54.idx
201061893 gbaut55.idx
185752370 gbaut56.idx
187996553 gbaut57.idx
184480753 gbaut58.idx
184337087 gbaut59.idx
190583089 gbaut6.idx
202159695 gbaut60.idx
190131169 gbaut61.idx
193537970 gbaut62.idx
186138293 gbaut63.idx
184196134 gbaut64.idx
184468958 gbaut65.idx
189998229 gbaut66.idx
187421074 gbaut67.idx
184207269 gbaut68.idx
189412636 gbaut69.idx
188580082 gbaut7.idx
184454523 gbaut70.idx
184266285 gbaut71.idx
211226963 gbaut72.idx
186782286 gbaut73.idx
252781414 gbaut74.idx
186232811 gbaut75.idx
183867824 gbaut76.idx
193632794 gbaut77.idx
183937577 gbaut78.idx
222509144 gbaut79.idx
192499267 gbaut8.idx
184517685 gbaut80.idx
227993581 gbaut81.idx
186256692 gbaut82.idx
183917550 gbaut83.idx
219566450 gbaut84.idx
185768946 gbaut85.idx
234322792 gbaut86.idx
189349379 gbaut87.idx
184997018 gbaut88.idx
221496171 gbaut89.idx
185556373 gbaut9.idx
185210771 gbaut90.idx
188986307 gbaut91.idx
4836236 gbaut92.idx
249998257 gbbct1.seq
244870852 gbbct10.seq
244670109 gbbct11.seq
233186943 gbbct12.seq
181029776 gbbct13.seq
243154484 gbbct14.seq
249783374 gbbct15.seq
245549495 gbbct16.seq
248627303 gbbct17.seq
248243605 gbbct18.seq
249284493 gbbct19.seq
241573761 gbbct2.seq
246200092 gbbct20.seq
245694910 gbbct21.seq
217808117 gbbct22.seq
242805577 gbbct23.seq
241842491 gbbct24.seq
248678252 gbbct25.seq
247877026 gbbct26.seq
249389374 gbbct27.seq
244187726 gbbct28.seq
247338634 gbbct29.seq
245705438 gbbct3.seq
249998777 gbbct30.seq
249762927 gbbct31.seq
249793005 gbbct32.seq
242888185 gbbct33.seq
241626506 gbbct34.seq
160069561 gbbct35.seq
243876217 gbbct36.seq
246112415 gbbct37.seq
242768541 gbbct38.seq
239637661 gbbct39.seq
249922202 gbbct4.seq
247212204 gbbct40.seq
246864528 gbbct41.seq
245872905 gbbct42.seq
244941420 gbbct43.seq
248038663 gbbct44.seq
248283284 gbbct45.seq
242735276 gbbct46.seq
151250627 gbbct47.seq
245585570 gbbct48.seq
246901681 gbbct49.seq
195288570 gbbct5.seq
246601717 gbbct50.seq
248689953 gbbct51.seq
244125814 gbbct52.seq
247213624 gbbct53.seq
242491398 gbbct54.seq
248435631 gbbct55.seq
245180929 gbbct56.seq
246497885 gbbct57.seq
237283737 gbbct58.seq
243462109 gbbct59.seq
242135162 gbbct6.seq
245461104 gbbct60.seq
155036575 gbbct61.seq
6887454 gbbct62.seq
14095594 gbbct63.seq
23196864 gbbct64.seq
45093380 gbbct65.seq
87762917 gbbct66.seq
169987454 gbbct67.seq
249998411 gbbct68.seq
249998155 gbbct69.seq
247366927 gbbct7.seq
249300404 gbbct70.seq
239273292 gbbct71.seq
248568950 gbbct72.seq
244248095 gbbct73.seq
246595163 gbbct74.seq
249922987 gbbct75.seq
33696381 gbbct76.seq
249999457 gbbct77.seq
249999907 gbbct78.seq
249997250 gbbct79.seq
247177589 gbbct8.seq
58332290 gbbct80.seq
244872818 gbbct9.seq
23989770 gbchg.txt
249999408 gbcon1.seq
249997306 gbcon10.seq
249998605 gbcon100.seq
249998936 gbcon101.seq
250000223 gbcon102.seq
156342446 gbcon103.seq
249996812 gbcon104.seq
249993767 gbcon105.seq
249992301 gbcon106.seq
249998322 gbcon107.seq
71615782 gbcon108.seq
249997862 gbcon109.seq
248094953 gbcon11.seq
249998650 gbcon110.seq
208522809 gbcon111.seq
250000256 gbcon112.seq
250000098 gbcon113.seq
249995503 gbcon114.seq
249706532 gbcon115.seq
149768887 gbcon116.seq
249914315 gbcon117.seq
249999874 gbcon118.seq
179997601 gbcon119.seq
249733770 gbcon12.seq
249997285 gbcon120.seq
250000110 gbcon121.seq
249999490 gbcon122.seq
249844519 gbcon123.seq
71431703 gbcon124.seq
249821967 gbcon125.seq
249803005 gbcon126.seq
249760241 gbcon127.seq
249998122 gbcon128.seq
249995228 gbcon129.seq
248741698 gbcon13.seq
249998722 gbcon130.seq
41196963 gbcon131.seq
249978699 gbcon132.seq
249998490 gbcon133.seq
249993348 gbcon134.seq
249999880 gbcon135.seq
249912502 gbcon136.seq
249948624 gbcon137.seq
249955490 gbcon138.seq
233498172 gbcon139.seq
242279394 gbcon14.seq
246632492 gbcon140.seq
247088480 gbcon141.seq
249512645 gbcon142.seq
249979552 gbcon143.seq
108787117 gbcon144.seq
249999086 gbcon145.seq
249861094 gbcon146.seq
249995663 gbcon147.seq
249972969 gbcon148.seq
249998239 gbcon149.seq
249992857 gbcon15.seq
249990486 gbcon150.seq
249995058 gbcon151.seq
249997325 gbcon152.seq
89770593 gbcon153.seq
249965787 gbcon154.seq
249998091 gbcon155.seq
249999198 gbcon156.seq
249988455 gbcon157.seq
249997989 gbcon158.seq
249902725 gbcon159.seq
250000201 gbcon16.seq
249998453 gbcon160.seq
176467042 gbcon161.seq
18856067 gbcon162.seq
194312210 gbcon17.seq
250000143 gbcon18.seq
247343830 gbcon19.seq
249951066 gbcon2.seq
122899681 gbcon20.seq
249998352 gbcon21.seq
120044016 gbcon22.seq
249996870 gbcon23.seq
249725403 gbcon24.seq
249997830 gbcon25.seq
249998324 gbcon26.seq
186471703 gbcon27.seq
249999799 gbcon28.seq
249997310 gbcon29.seq
248161967 gbcon3.seq
249999856 gbcon30.seq
249999952 gbcon31.seq
247968421 gbcon32.seq
232566446 gbcon33.seq
249999237 gbcon34.seq
249996869 gbcon35.seq
249995921 gbcon36.seq
249996351 gbcon37.seq
249999450 gbcon38.seq
249997210 gbcon39.seq
248979371 gbcon4.seq
61183731 gbcon40.seq
249997486 gbcon41.seq
249994070 gbcon42.seq
249999391 gbcon43.seq
249997743 gbcon44.seq
249994859 gbcon45.seq
43089049 gbcon46.seq
249993995 gbcon47.seq
249996310 gbcon48.seq
249994442 gbcon49.seq
249999847 gbcon5.seq
249997248 gbcon50.seq
250000078 gbcon51.seq
36404971 gbcon52.seq
249993185 gbcon53.seq
249998119 gbcon54.seq
249995170 gbcon55.seq
249998154 gbcon56.seq
249998078 gbcon57.seq
152679523 gbcon58.seq
249999955 gbcon59.seq
249993464 gbcon6.seq
249999066 gbcon60.seq
249997558 gbcon61.seq
249998625 gbcon62.seq
183609322 gbcon63.seq
249999870 gbcon64.seq
249997967 gbcon65.seq
249997138 gbcon66.seq
249995207 gbcon67.seq
245488804 gbcon68.seq
250000182 gbcon69.seq
231273459 gbcon7.seq
249998695 gbcon70.seq
249998372 gbcon71.seq
249996966 gbcon72.seq
250000007 gbcon73.seq
96627683 gbcon74.seq
249993448 gbcon75.seq
249995119 gbcon76.seq
249997383 gbcon77.seq
249995948 gbcon78.seq
249999042 gbcon79.seq
249997708 gbcon8.seq
62682749 gbcon80.seq
249997771 gbcon81.seq
249996653 gbcon82.seq
249999445 gbcon83.seq
249999590 gbcon84.seq
249998149 gbcon85.seq
21674116 gbcon86.seq
249998140 gbcon87.seq
249997503 gbcon88.seq
249996940 gbcon89.seq
249996514 gbcon9.seq
249995720 gbcon90.seq
197881888 gbcon91.seq
249993974 gbcon92.seq
249996060 gbcon93.seq
249999726 gbcon94.seq
249998645 gbcon95.seq
249996901 gbcon96.seq
133265984 gbcon97.seq
249994222 gbcon98.seq
249995659 gbcon99.seq
490277 gbdel.txt
249999505 gbenv1.seq
249999234 gbenv10.seq
55949411 gbenv11.seq
249996628 gbenv12.seq
249999695 gbenv13.seq
249999231 gbenv14.seq
249998919 gbenv15.seq
249997516 gbenv16.seq
249999827 gbenv17.seq
249997983 gbenv18.seq
2959488 gbenv19.seq
249997290 gbenv2.seq
249999805 gbenv20.seq
249999753 gbenv21.seq
250000074 gbenv22.seq
249999944 gbenv23.seq
128034581 gbenv24.seq
249999646 gbenv25.seq
249998286 gbenv26.seq
249998656 gbenv27.seq
249999332 gbenv28.seq
249999168 gbenv29.seq
249997602 gbenv3.seq
104629850 gbenv30.seq
249998069 gbenv31.seq
249997176 gbenv32.seq
249998334 gbenv33.seq
249996672 gbenv34.seq
134285230 gbenv35.seq
249999798 gbenv36.seq
249998209 gbenv37.seq
249998110 gbenv38.seq
249997289 gbenv39.seq
249999245 gbenv4.seq
120995166 gbenv40.seq
249999972 gbenv41.seq
249999727 gbenv42.seq
249998516 gbenv43.seq
249997332 gbenv44.seq
250000053 gbenv45.seq
730326 gbenv46.seq
249998493 gbenv5.seq
204121471 gbenv6.seq
249998535 gbenv7.seq
249998988 gbenv8.seq
249998993 gbenv9.seq
524292008 gbest1.seq
524289074 gbest10.seq
524289941 gbest100.seq
524291337 gbest101.seq
524289859 gbest102.seq
524290377 gbest103.seq
356067172 gbest104.seq
524290444 gbest105.seq
524289882 gbest106.seq
498295264 gbest107.seq
388468596 gbest108.seq
387567407 gbest109.seq
524290873 gbest11.seq
383140776 gbest110.seq
384246085 gbest111.seq
384330199 gbest112.seq
381683980 gbest113.seq
391864302 gbest114.seq
387826689 gbest115.seq
386125537 gbest116.seq
384279666 gbest117.seq
411713195 gbest118.seq
524290061 gbest119.seq
524291034 gbest12.seq
524289592 gbest120.seq
524290024 gbest121.seq
524288922 gbest122.seq
524290082 gbest123.seq
463054937 gbest124.seq
524291624 gbest125.seq
524292219 gbest126.seq
524289117 gbest127.seq
524290681 gbest128.seq
524289762 gbest129.seq
156627343 gbest13.seq
524292389 gbest130.seq
524288898 gbest131.seq
524289254 gbest132.seq
524291522 gbest133.seq
524288794 gbest134.seq
524290255 gbest135.seq
524289041 gbest136.seq
274581986 gbest137.seq
524290088 gbest138.seq
524291115 gbest139.seq
524289253 gbest14.seq
524289955 gbest140.seq
524290676 gbest141.seq
524289958 gbest142.seq
524291533 gbest143.seq
524290922 gbest144.seq
524292349 gbest145.seq
524292861 gbest146.seq
524291433 gbest147.seq
524289744 gbest148.seq
524290145 gbest149.seq
524289698 gbest15.seq
524291097 gbest150.seq
477294858 gbest151.seq
524291695 gbest152.seq
524289611 gbest153.seq
524291256 gbest154.seq
524289499 gbest155.seq
524290144 gbest156.seq
524289849 gbest157.seq
524292518 gbest158.seq
524291675 gbest159.seq
524289586 gbest16.seq
499690374 gbest160.seq
524291603 gbest161.seq
524288766 gbest162.seq
524289117 gbest163.seq
245963826 gbest164.seq
524292103 gbest165.seq
524292621 gbest166.seq
524289353 gbest167.seq
524292232 gbest168.seq
524289609 gbest169.seq
524290180 gbest17.seq
524294671 gbest170.seq
524290722 gbest171.seq
524290087 gbest172.seq
524289184 gbest173.seq
524290877 gbest174.seq
524291150 gbest175.seq
524289134 gbest176.seq
524291010 gbest177.seq
101090672 gbest178.seq
524291028 gbest179.seq
524290798 gbest18.seq
524291534 gbest180.seq
524289802 gbest181.seq
524289618 gbest182.seq
524291344 gbest183.seq
524290675 gbest184.seq
524292509 gbest185.seq
524289936 gbest186.seq
524290013 gbest187.seq
524290420 gbest188.seq
524289856 gbest189.seq
524290082 gbest19.seq
524290662 gbest190.seq
456797124 gbest191.seq
524290487 gbest192.seq
524292834 gbest193.seq
524290284 gbest194.seq
524291563 gbest195.seq
524293488 gbest196.seq
524291444 gbest197.seq
524291365 gbest198.seq
524291354 gbest199.seq
524289694 gbest2.seq
524290005 gbest20.seq
524288759 gbest200.seq
524291753 gbest201.seq
524289692 gbest202.seq
524289087 gbest203.seq
524289424 gbest204.seq
97021668 gbest205.seq
524290842 gbest206.seq
524291427 gbest207.seq
524289426 gbest208.seq
524291070 gbest209.seq
524289853 gbest21.seq
524291423 gbest210.seq
524289678 gbest211.seq
524290929 gbest212.seq
524289112 gbest213.seq
524289214 gbest214.seq
524291403 gbest215.seq
429494611 gbest216.seq
524290473 gbest217.seq
524293339 gbest218.seq
524289897 gbest219.seq
511864268 gbest22.seq
524291187 gbest220.seq
524289475 gbest221.seq
524290819 gbest222.seq
524290615 gbest223.seq
524289003 gbest224.seq
524289093 gbest225.seq
524288735 gbest226.seq
524290442 gbest227.seq
524289326 gbest228.seq
524291624 gbest229.seq
500398505 gbest23.seq
374660805 gbest230.seq
524290691 gbest231.seq
524292109 gbest232.seq
524292590 gbest233.seq
524291253 gbest234.seq
524289017 gbest235.seq
524289882 gbest236.seq
524290265 gbest237.seq
524292038 gbest238.seq
524290201 gbest239.seq
509309105 gbest24.seq
524289523 gbest240.seq
524289744 gbest241.seq
524290687 gbest242.seq
524289519 gbest243.seq
524290932 gbest244.seq
50535914 gbest245.seq
524292939 gbest246.seq
524289295 gbest247.seq
524293048 gbest248.seq
524290879 gbest249.seq
319190837 gbest25.seq
524291116 gbest250.seq
524291189 gbest251.seq
524288750 gbest252.seq
524290912 gbest253.seq
524290564 gbest254.seq
524291150 gbest255.seq
524291730 gbest256.seq
239359530 gbest257.seq
524289595 gbest258.seq
524289082 gbest259.seq
524290900 gbest26.seq
524288973 gbest260.seq
524290025 gbest261.seq
524288733 gbest262.seq
524289158 gbest263.seq
524290336 gbest264.seq
524290548 gbest265.seq
524289274 gbest266.seq
524291618 gbest267.seq
287356802 gbest268.seq
524289035 gbest269.seq
524289014 gbest27.seq
524289329 gbest270.seq
524289147 gbest271.seq
524290891 gbest272.seq
524289147 gbest273.seq
524290008 gbest274.seq
524289946 gbest275.seq
524288802 gbest276.seq
524289456 gbest277.seq
524289549 gbest278.seq
524290995 gbest279.seq
524289431 gbest28.seq
295102228 gbest280.seq
524292118 gbest281.seq
524290436 gbest282.seq
524289271 gbest283.seq
524289600 gbest284.seq
524289583 gbest285.seq
524289567 gbest286.seq
524290162 gbest287.seq
524290559 gbest288.seq
524290249 gbest289.seq
524291872 gbest29.seq
524292289 gbest290.seq
524290741 gbest291.seq
230566281 gbest292.seq
524290179 gbest293.seq
524290782 gbest294.seq
524289305 gbest295.seq
524290091 gbest296.seq
524289112 gbest297.seq
524291671 gbest298.seq
524288830 gbest299.seq
497701912 gbest3.seq
524292549 gbest30.seq
524289671 gbest300.seq
479526564 gbest301.seq
485146985 gbest302.seq
486608996 gbest303.seq
314744731 gbest304.seq
524290628 gbest305.seq
524289741 gbest306.seq
524292696 gbest307.seq
524292374 gbest308.seq
524290518 gbest309.seq
524288756 gbest31.seq
524289916 gbest310.seq
524289442 gbest311.seq
524288906 gbest312.seq
524291344 gbest313.seq
524289175 gbest314.seq
524289161 gbest315.seq
524289240 gbest316.seq
512942060 gbest317.seq
524290413 gbest318.seq
524291177 gbest319.seq
524289945 gbest32.seq
524290316 gbest320.seq
524288958 gbest321.seq
524289150 gbest322.seq
524291748 gbest323.seq
524292355 gbest324.seq
524291825 gbest325.seq
524290651 gbest326.seq
524291809 gbest327.seq
524288804 gbest328.seq
524290732 gbest329.seq
524290428 gbest33.seq
524290347 gbest330.seq
264869903 gbest331.seq
524289235 gbest332.seq
524289103 gbest333.seq
524289402 gbest334.seq
524290279 gbest335.seq
524292490 gbest336.seq
524291369 gbest337.seq
524291958 gbest338.seq
524289531 gbest339.seq
519456801 gbest34.seq
524289274 gbest340.seq
524288812 gbest341.seq
524290275 gbest342.seq
524290311 gbest343.seq
524289384 gbest344.seq
342817293 gbest345.seq
524292279 gbest346.seq
524289013 gbest347.seq
524290634 gbest348.seq
524291018 gbest349.seq
492728679 gbest35.seq
524289723 gbest350.seq
524291207 gbest351.seq
524292426 gbest352.seq
524289998 gbest353.seq
524289656 gbest354.seq
524292632 gbest355.seq
524288735 gbest356.seq
524290284 gbest357.seq
524290671 gbest358.seq
504309765 gbest359.seq
494454216 gbest36.seq
524289178 gbest360.seq
524289492 gbest361.seq
524290217 gbest362.seq
524290520 gbest363.seq
524291853 gbest364.seq
524291199 gbest365.seq
524289560 gbest366.seq
524289528 gbest367.seq
524289431 gbest368.seq
524289294 gbest369.seq
493339530 gbest37.seq
461370203 gbest370.seq
524288795 gbest371.seq
524290205 gbest372.seq
524289492 gbest373.seq
524288911 gbest374.seq
524291811 gbest375.seq
524289458 gbest376.seq
506124913 gbest377.seq
524289348 gbest378.seq
524289212 gbest379.seq
487999109 gbest38.seq
524289492 gbest380.seq
524290197 gbest381.seq
278283086 gbest382.seq
524289306 gbest383.seq
524291164 gbest384.seq
524290909 gbest385.seq
524289644 gbest386.seq
524289721 gbest387.seq
524291701 gbest388.seq
524291075 gbest389.seq
493269666 gbest39.seq
524289397 gbest390.seq
524290364 gbest391.seq
524289695 gbest392.seq
524289232 gbest393.seq
356844306 gbest394.seq
524288851 gbest395.seq
524290861 gbest396.seq
524288821 gbest397.seq
524291643 gbest398.seq
524290466 gbest399.seq
524288944 gbest4.seq
111902842 gbest40.seq
524290793 gbest400.seq
524290579 gbest401.seq
524291034 gbest402.seq
524291077 gbest403.seq
524290126 gbest404.seq
524289469 gbest405.seq
524290854 gbest406.seq
433248342 gbest407.seq
524290123 gbest408.seq
524289683 gbest409.seq
524292786 gbest41.seq
524289600 gbest410.seq
524289699 gbest411.seq
524291338 gbest412.seq
524289395 gbest413.seq
524289242 gbest414.seq
524289080 gbest415.seq
524292511 gbest416.seq
524289202 gbest417.seq
524289966 gbest418.seq
524293090 gbest419.seq
524289049 gbest42.seq
524290049 gbest420.seq
524290533 gbest421.seq
32063648 gbest422.seq
524292183 gbest423.seq
524288845 gbest424.seq
524289762 gbest425.seq
524290959 gbest426.seq
524289051 gbest427.seq
524288913 gbest428.seq
524291358 gbest429.seq
524290510 gbest43.seq
524289052 gbest430.seq
524291278 gbest431.seq
524291228 gbest432.seq
524291773 gbest433.seq
524288728 gbest434.seq
449759673 gbest435.seq
524292241 gbest436.seq
524291901 gbest437.seq
524290114 gbest438.seq
524290470 gbest439.seq
524289998 gbest44.seq
524290276 gbest440.seq
524291128 gbest441.seq
524288756 gbest442.seq
524291040 gbest443.seq
524290882 gbest444.seq
524290762 gbest445.seq
524290989 gbest446.seq
351781490 gbest447.seq
524290945 gbest448.seq
524291028 gbest449.seq
524291194 gbest45.seq
524288964 gbest450.seq
452152779 gbest451.seq
524290826 gbest46.seq
524291225 gbest47.seq
524289098 gbest48.seq
524290212 gbest49.seq
524289625 gbest5.seq
524291211 gbest50.seq
524290427 gbest51.seq
524289076 gbest52.seq
524290444 gbest53.seq
272796696 gbest54.seq
524290709 gbest55.seq
524288752 gbest56.seq
524290193 gbest57.seq
524290427 gbest58.seq
524290141 gbest59.seq
524288762 gbest6.seq
524292004 gbest60.seq
524291197 gbest61.seq
524290276 gbest62.seq
524290080 gbest63.seq
524290124 gbest64.seq
524289673 gbest65.seq
524288847 gbest66.seq
464657769 gbest67.seq
524290678 gbest68.seq
524288774 gbest69.seq
524291131 gbest7.seq
524290941 gbest70.seq
524289318 gbest71.seq
524289634 gbest72.seq
524289100 gbest73.seq
524292074 gbest74.seq
524292948 gbest75.seq
524289093 gbest76.seq
524289770 gbest77.seq
524290895 gbest78.seq
524289743 gbest79.seq
524289317 gbest8.seq
203796750 gbest80.seq
524290390 gbest81.seq
524289764 gbest82.seq
524289928 gbest83.seq
524289428 gbest84.seq
524289004 gbest85.seq
524292142 gbest86.seq
524291795 gbest87.seq
524290656 gbest88.seq
524291123 gbest89.seq
524292211 gbest9.seq
524289995 gbest90.seq
524291340 gbest91.seq
448864914 gbest92.seq
524291246 gbest93.seq
524291357 gbest94.seq
524291406 gbest95.seq
524292756 gbest96.seq
524290446 gbest97.seq
524291978 gbest98.seq
524288877 gbest99.seq
177359014 gbgen.idx
524290312 gbgss1.seq
524291523 gbgss10.seq
524292593 gbgss100.seq
524289703 gbgss101.seq
524291138 gbgss102.seq
524290642 gbgss103.seq
418359951 gbgss104.seq
524290801 gbgss105.seq
524290943 gbgss106.seq
524290652 gbgss107.seq
524289339 gbgss108.seq
524289785 gbgss109.seq
524292188 gbgss11.seq
524291091 gbgss110.seq
524290077 gbgss111.seq
524289903 gbgss112.seq
524290560 gbgss113.seq
524290818 gbgss114.seq
524289833 gbgss115.seq
55545305 gbgss116.seq
524289697 gbgss117.seq
524288912 gbgss118.seq
524289314 gbgss119.seq
524289997 gbgss12.seq
524288887 gbgss120.seq
524289936 gbgss121.seq
524289166 gbgss122.seq
524288921 gbgss123.seq
524289103 gbgss124.seq
524289552 gbgss125.seq
524289600 gbgss126.seq
524290475 gbgss127.seq
524289083 gbgss128.seq
229915473 gbgss129.seq
524288852 gbgss13.seq
524289187 gbgss130.seq
524288934 gbgss131.seq
524289981 gbgss132.seq
524290857 gbgss133.seq
524289683 gbgss134.seq
524291558 gbgss135.seq
524292251 gbgss136.seq
524291729 gbgss137.seq
524290034 gbgss138.seq
515988605 gbgss139.seq
524288998 gbgss14.seq
516017830 gbgss140.seq
103887015 gbgss141.seq
524289324 gbgss142.seq
524289797 gbgss143.seq
524291421 gbgss144.seq
524290358 gbgss145.seq
524288787 gbgss146.seq
524289733 gbgss147.seq
221712385 gbgss148.seq
249997973 gbgss149.seq
524291185 gbgss15.seq
249999361 gbgss150.seq
249999987 gbgss151.seq
249999769 gbgss152.seq
28622349 gbgss153.seq
249997137 gbgss154.seq
250000033 gbgss155.seq
249998542 gbgss156.seq
249998333 gbgss157.seq
224919493 gbgss158.seq
249998415 gbgss159.seq
524290859 gbgss16.seq
249998761 gbgss160.seq
249998880 gbgss161.seq
249997763 gbgss162.seq
189046598 gbgss163.seq
249999433 gbgss164.seq
249998390 gbgss165.seq
249999267 gbgss166.seq
249997904 gbgss167.seq
249997062 gbgss168.seq
76835987 gbgss169.seq
524290670 gbgss17.seq
249998100 gbgss170.seq
2079852 gbgss171.seq
79542394 gbgss172.seq
249999009 gbgss173.seq
250000259 gbgss174.seq
87380505 gbgss175.seq
249999685 gbgss176.seq
249998355 gbgss177.seq
249998984 gbgss178.seq
202719103 gbgss179.seq
524290328 gbgss18.seq
249999232 gbgss180.seq
249999013 gbgss181.seq
249998851 gbgss182.seq
246250899 gbgss183.seq
249999268 gbgss184.seq
249997406 gbgss185.seq
249999279 gbgss186.seq
243520281 gbgss187.seq
249999336 gbgss188.seq
249997150 gbgss189.seq
314841901 gbgss19.seq
249998209 gbgss190.seq
249998771 gbgss191.seq
122182588 gbgss192.seq
249998013 gbgss193.seq
250000031 gbgss194.seq
249999974 gbgss195.seq
249998152 gbgss196.seq
94058788 gbgss197.seq
249998892 gbgss198.seq
249999850 gbgss199.seq
524289034 gbgss2.seq
524288952 gbgss20.seq
249998239 gbgss200.seq
249999582 gbgss201.seq
179090630 gbgss202.seq
249999236 gbgss203.seq
249997993 gbgss204.seq
249998006 gbgss205.seq
249999353 gbgss206.seq
95926739 gbgss207.seq
249999461 gbgss208.seq
249999350 gbgss209.seq
524289034 gbgss21.seq
249998406 gbgss210.seq
249998619 gbgss211.seq
249999398 gbgss212.seq
249999995 gbgss213.seq
17245248 gbgss214.seq
249999424 gbgss215.seq
249999963 gbgss216.seq
249997369 gbgss217.seq
43648880 gbgss218.seq
52862187 gbgss219.seq
524291398 gbgss22.seq
249997605 gbgss220.seq
249998120 gbgss221.seq
250000111 gbgss222.seq
249999449 gbgss223.seq
30198048 gbgss224.seq
249997670 gbgss225.seq
249997588 gbgss226.seq
249999018 gbgss227.seq
250000000 gbgss228.seq
28042636 gbgss229.seq
524290800 gbgss23.seq
249997661 gbgss230.seq
249998578 gbgss231.seq
249998526 gbgss232.seq
249998842 gbgss233.seq
249999591 gbgss234.seq
249998244 gbgss235.seq
178918094 gbgss236.seq
249999812 gbgss237.seq
249998926 gbgss238.seq
249999095 gbgss239.seq
524291392 gbgss24.seq
220154622 gbgss240.seq
250000034 gbgss241.seq
249997956 gbgss242.seq
250000074 gbgss243.seq
249998729 gbgss244.seq
195288113 gbgss245.seq
249999561 gbgss246.seq
249998751 gbgss247.seq
249999600 gbgss248.seq
249999029 gbgss249.seq
524290581 gbgss25.seq
249999714 gbgss250.seq
16550601 gbgss251.seq
524290713 gbgss26.seq
524289900 gbgss27.seq
524288854 gbgss28.seq
524289528 gbgss29.seq
524289102 gbgss3.seq
524289655 gbgss30.seq
38849864 gbgss31.seq
524289075 gbgss32.seq
524290723 gbgss33.seq
524288828 gbgss34.seq
524289728 gbgss35.seq
524289696 gbgss36.seq
524289533 gbgss37.seq
524289071 gbgss38.seq
509087433 gbgss39.seq
524290615 gbgss4.seq
524290362 gbgss40.seq
524289231 gbgss41.seq
524291640 gbgss42.seq
28732657 gbgss43.seq
524288882 gbgss44.seq
524291090 gbgss45.seq
524290976 gbgss46.seq
524290985 gbgss47.seq
209346767 gbgss48.seq
524291863 gbgss49.seq
168350020 gbgss5.seq
524291582 gbgss50.seq
524290401 gbgss51.seq
524290464 gbgss52.seq
524290548 gbgss53.seq
524290689 gbgss54.seq
524289963 gbgss55.seq
524289945 gbgss56.seq
524290428 gbgss57.seq
524291284 gbgss58.seq
524290900 gbgss59.seq
524290951 gbgss6.seq
5856233 gbgss60.seq
524289023 gbgss61.seq
524290882 gbgss62.seq
524290246 gbgss63.seq
457238462 gbgss64.seq
524290719 gbgss65.seq
524291022 gbgss66.seq
524290625 gbgss67.seq
524289509 gbgss68.seq
524291296 gbgss69.seq
524291125 gbgss7.seq
524290162 gbgss70.seq
524290171 gbgss71.seq
524290218 gbgss72.seq
524289197 gbgss73.seq
524291503 gbgss74.seq
524289627 gbgss75.seq
524291206 gbgss76.seq
32487361 gbgss77.seq
524289473 gbgss78.seq
524291931 gbgss79.seq
524291964 gbgss8.seq
524289482 gbgss80.seq
524290727 gbgss81.seq
524289703 gbgss82.seq
524289751 gbgss83.seq
524289336 gbgss84.seq
524290248 gbgss85.seq
524289011 gbgss86.seq
524292247 gbgss87.seq
524290044 gbgss88.seq
376569727 gbgss89.seq
524290754 gbgss9.seq
524292172 gbgss90.seq
524291677 gbgss91.seq
524291807 gbgss92.seq
524292003 gbgss93.seq
524289134 gbgss94.seq
524289592 gbgss95.seq
524289866 gbgss96.seq
524291875 gbgss97.seq
524291048 gbgss98.seq
524291620 gbgss99.seq
249992912 gbhtc1.seq
249998309 gbhtc10.seq
203719899 gbhtc11.seq
249997534 gbhtc12.seq
249996680 gbhtc13.seq
59200540 gbhtc14.seq
249992681 gbhtc2.seq
249996913 gbhtc3.seq
249991889 gbhtc4.seq
249985674 gbhtc5.seq
249997743 gbhtc6.seq
249996123 gbhtc7.seq
83873876 gbhtc8.seq
249999684 gbhtc9.seq
249904748 gbhtg1.seq
249863408 gbhtg10.seq
249917503 gbhtg100.seq
249844944 gbhtg101.seq
249902534 gbhtg102.seq
249987058 gbhtg103.seq
5671243 gbhtg104.seq
249895747 gbhtg105.seq
249878056 gbhtg106.seq
249900312 gbhtg107.seq
249786423 gbhtg108.seq
249827267 gbhtg109.seq
1107147 gbhtg11.seq
249767975 gbhtg110.seq
249985519 gbhtg111.seq
249735288 gbhtg112.seq
246382142 gbhtg113.seq
184661487 gbhtg114.seq
249974219 gbhtg115.seq
249840707 gbhtg116.seq
249918615 gbhtg117.seq
249806582 gbhtg118.seq
249809192 gbhtg119.seq
249658387 gbhtg12.seq
53790815 gbhtg120.seq
249981598 gbhtg121.seq
249775521 gbhtg122.seq
249957990 gbhtg123.seq
249851165 gbhtg124.seq
249786532 gbhtg125.seq
135017451 gbhtg126.seq
249793216 gbhtg127.seq
249694802 gbhtg128.seq
249842811 gbhtg129.seq
249699749 gbhtg13.seq
249805555 gbhtg130.seq
249804237 gbhtg131.seq
249990551 gbhtg132.seq
249825549 gbhtg133.seq
249808878 gbhtg134.seq
249887748 gbhtg135.seq
75526063 gbhtg136.seq
249765870 gbhtg14.seq
249760883 gbhtg15.seq
249872612 gbhtg16.seq
249832528 gbhtg17.seq
249983662 gbhtg18.seq
249677291 gbhtg19.seq
249994630 gbhtg2.seq
249988730 gbhtg20.seq
237145184 gbhtg21.seq
249760624 gbhtg22.seq
249868408 gbhtg23.seq
249987789 gbhtg24.seq
249921752 gbhtg25.seq
249761207 gbhtg26.seq
249891641 gbhtg27.seq
249961480 gbhtg28.seq
249848514 gbhtg29.seq
249950135 gbhtg3.seq
249992987 gbhtg30.seq
225324756 gbhtg31.seq
249827828 gbhtg32.seq
249920767 gbhtg33.seq
249929437 gbhtg34.seq
249919058 gbhtg35.seq
249852033 gbhtg36.seq
249814604 gbhtg37.seq
249767419 gbhtg38.seq
249627604 gbhtg39.seq
249984089 gbhtg4.seq
249839726 gbhtg40.seq
224363115 gbhtg41.seq
249889211 gbhtg42.seq
249786793 gbhtg43.seq
249972417 gbhtg44.seq
249775813 gbhtg45.seq
249913172 gbhtg46.seq
249597238 gbhtg47.seq
249865052 gbhtg48.seq
249793005 gbhtg49.seq
249882044 gbhtg5.seq
249922691 gbhtg50.seq
235040940 gbhtg51.seq
249732550 gbhtg52.seq
249918496 gbhtg53.seq
249773098 gbhtg54.seq
249971361 gbhtg55.seq
249962512 gbhtg56.seq
18795863 gbhtg57.seq
249936487 gbhtg58.seq
249908655 gbhtg59.seq
249898460 gbhtg6.seq
249826456 gbhtg60.seq
249862655 gbhtg61.seq
225820664 gbhtg62.seq
249840063 gbhtg63.seq
249787680 gbhtg64.seq
249883568 gbhtg65.seq
249980692 gbhtg66.seq
249833261 gbhtg67.seq
16614633 gbhtg68.seq
249960711 gbhtg69.seq
249933725 gbhtg7.seq
249973591 gbhtg70.seq
249953795 gbhtg71.seq
249976816 gbhtg72.seq
225297470 gbhtg73.seq
249811185 gbhtg74.seq
249874975 gbhtg75.seq
249800054 gbhtg76.seq
249959610 gbhtg77.seq
244236501 gbhtg78.seq
249883367 gbhtg79.seq
249933567 gbhtg8.seq
249989452 gbhtg80.seq
249839493 gbhtg81.seq
249838775 gbhtg82.seq
216752366 gbhtg83.seq
249967233 gbhtg84.seq
249803266 gbhtg85.seq
249758161 gbhtg86.seq
249850280 gbhtg87.seq
220831167 gbhtg88.seq
249970134 gbhtg89.seq
249923766 gbhtg9.seq
249954241 gbhtg90.seq
249845350 gbhtg91.seq
249992122 gbhtg92.seq
209091181 gbhtg93.seq
249866071 gbhtg94.seq
249975867 gbhtg95.seq
249904055 gbhtg96.seq
249804025 gbhtg97.seq
168109739 gbhtg98.seq
249744688 gbhtg99.seq
250000210 gbinv1.seq
249999064 gbinv10.seq
163214707 gbinv11.seq
249998593 gbinv12.seq
249999247 gbinv13.seq
249999375 gbinv14.seq
146622403 gbinv15.seq
248907789 gbinv16.seq
248493845 gbinv17.seq
249991043 gbinv18.seq
249998281 gbinv19.seq
249981584 gbinv2.seq
249998305 gbinv20.seq
76495806 gbinv21.seq
244702685 gbinv22.seq
175453836 gbinv23.seq
249998067 gbinv24.seq
249997362 gbinv25.seq
249998223 gbinv26.seq
210234332 gbinv27.seq
249998389 gbinv28.seq
249998474 gbinv29.seq
216371754 gbinv3.seq
249999287 gbinv30.seq
249989087 gbinv31.seq
104516992 gbinv32.seq
249995301 gbinv4.seq
249998797 gbinv5.seq
249998383 gbinv6.seq
224196115 gbinv7.seq
249999008 gbinv8.seq
249999323 gbinv9.seq
139995141 gbjou1.idx
292082659 gbjou10.idx
259945829 gbjou11.idx
211862728 gbjou12.idx
8015630 gbjou13.idx
140465418 gbjou2.idx
158710202 gbjou3.idx
189508008 gbjou4.idx
271860560 gbjou5.idx
275973554 gbjou6.idx
281097012 gbjou7.idx
282979171 gbjou8.idx
305517191 gbjou9.idx
328451860 gbkey1.idx
180060483 gbkey2.idx
185465758 gbkey3.idx
240768528 gbkey4.idx
183434753 gbkey5.idx
112128439 gbkey6.idx
249814599 gbmam1.seq
249999313 gbmam2.seq
249818846 gbmam3.seq
249999129 gbmam4.seq
249998473 gbmam5.seq
249996485 gbmam6.seq
205618671 gbmam7.seq
34062753 gbnew.txt
249999770 gbpat1.seq
249999477 gbpat10.seq
249999793 gbpat100.seq
149112469 gbpat101.seq
249999880 gbpat102.seq
249999565 gbpat103.seq
249929731 gbpat104.seq
249824879 gbpat105.seq
249998856 gbpat106.seq
192934358 gbpat107.seq
249999374 gbpat108.seq
249999625 gbpat109.seq
179586962 gbpat11.seq
249996079 gbpat110.seq
80123880 gbpat111.seq
249999775 gbpat112.seq
249998903 gbpat113.seq
249990767 gbpat114.seq
249999878 gbpat115.seq
249849703 gbpat116.seq
66835452 gbpat117.seq
249999441 gbpat118.seq
249999845 gbpat119.seq
250000151 gbpat12.seq
249999888 gbpat120.seq
249999095 gbpat121.seq
160256390 gbpat122.seq
249999974 gbpat123.seq
249999633 gbpat124.seq
234784218 gbpat125.seq
249991591 gbpat126.seq
249970935 gbpat127.seq
249999681 gbpat128.seq
249997397 gbpat129.seq
249995168 gbpat13.seq
249997452 gbpat130.seq
66832984 gbpat131.seq
249992315 gbpat132.seq
249999867 gbpat133.seq
250000197 gbpat134.seq
249999821 gbpat135.seq
249998337 gbpat136.seq
180628585 gbpat137.seq
249998039 gbpat138.seq
250000068 gbpat139.seq
249998803 gbpat14.seq
250000015 gbpat140.seq
86028783 gbpat141.seq
249999922 gbpat142.seq
249997624 gbpat143.seq
249999906 gbpat144.seq
63539765 gbpat145.seq
249995994 gbpat146.seq
249999922 gbpat147.seq
250000217 gbpat148.seq
249999438 gbpat149.seq
250000208 gbpat15.seq
249999327 gbpat150.seq
249997656 gbpat151.seq
222137516 gbpat152.seq
250000249 gbpat153.seq
249999893 gbpat154.seq
249999893 gbpat155.seq
220539897 gbpat156.seq
249999753 gbpat157.seq
249998715 gbpat158.seq
249999474 gbpat159.seq
249999915 gbpat16.seq
12381933 gbpat160.seq
249997013 gbpat161.seq
249998113 gbpat162.seq
249999692 gbpat163.seq
250000126 gbpat164.seq
35343603 gbpat165.seq
249998580 gbpat166.seq
249998972 gbpat167.seq
249999265 gbpat168.seq
249999777 gbpat169.seq
65896429 gbpat17.seq
249998978 gbpat170.seq
249999754 gbpat171.seq
249999829 gbpat172.seq
245475035 gbpat173.seq
250000027 gbpat18.seq
249999801 gbpat19.seq
249999577 gbpat2.seq
249999076 gbpat20.seq
249996878 gbpat21.seq
185824949 gbpat22.seq
249999010 gbpat23.seq
249856602 gbpat24.seq
249999342 gbpat25.seq
249999337 gbpat26.seq
71191909 gbpat27.seq
249986007 gbpat28.seq
249998672 gbpat29.seq
249999257 gbpat3.seq
249997815 gbpat30.seq
249999828 gbpat31.seq
250000149 gbpat32.seq
180194087 gbpat33.seq
249997849 gbpat34.seq
249999790 gbpat35.seq
249998836 gbpat36.seq
250000122 gbpat37.seq
130534023 gbpat38.seq
249996259 gbpat39.seq
249998049 gbpat4.seq
249991603 gbpat40.seq
249999077 gbpat41.seq
250000259 gbpat42.seq
249995261 gbpat43.seq
249844966 gbpat44.seq
249999190 gbpat45.seq
250000078 gbpat46.seq
171468074 gbpat47.seq
249999830 gbpat48.seq
249998527 gbpat49.seq
71794649 gbpat5.seq
249999531 gbpat50.seq
250000197 gbpat51.seq
222934467 gbpat52.seq
249999057 gbpat53.seq
249999815 gbpat54.seq
250000246 gbpat55.seq
164989631 gbpat56.seq
249883089 gbpat57.seq
249999314 gbpat58.seq
249999611 gbpat59.seq
249999527 gbpat6.seq
249999026 gbpat60.seq
134923873 gbpat61.seq
249998978 gbpat62.seq
249999978 gbpat63.seq
249999690 gbpat64.seq
249998210 gbpat65.seq
249999753 gbpat66.seq
249999577 gbpat67.seq
144886744 gbpat68.seq
250000113 gbpat69.seq
249999627 gbpat7.seq
249999899 gbpat70.seq
249998837 gbpat71.seq
244403395 gbpat72.seq
248969066 gbpat73.seq
244459261 gbpat74.seq
247875799 gbpat75.seq
249999901 gbpat76.seq
160624439 gbpat77.seq
250000121 gbpat78.seq
249999657 gbpat79.seq
249991456 gbpat8.seq
249999470 gbpat80.seq
249999644 gbpat81.seq
250000008 gbpat82.seq
250000127 gbpat83.seq
93331147 gbpat84.seq
249155538 gbpat85.seq
249999421 gbpat86.seq
249999867 gbpat87.seq
249999359 gbpat88.seq
249999368 gbpat89.seq
249999342 gbpat9.seq
250000155 gbpat90.seq
145293161 gbpat91.seq
249999076 gbpat92.seq
249998980 gbpat93.seq
249999939 gbpat94.seq
250000257 gbpat95.seq
196964910 gbpat96.seq
249999051 gbpat97.seq
249998995 gbpat98.seq
249999064 gbpat99.seq
171577011 gbphg1.seq
249997909 gbpln1.seq
250000036 gbpln10.seq
249995940 gbpln11.seq
249894997 gbpln12.seq
214538339 gbpln13.seq
249998215 gbpln14.seq
249985349 gbpln15.seq
249996352 gbpln16.seq
249429028 gbpln17.seq
249983070 gbpln18.seq
249606536 gbpln19.seq
249853654 gbpln2.seq
249999605 gbpln20.seq
33446710 gbpln21.seq
249999308 gbpln22.seq
97584419 gbpln23.seq
249999270 gbpln24.seq
249998346 gbpln25.seq
249390857 gbpln26.seq
221100868 gbpln27.seq
247981553 gbpln28.seq
249923572 gbpln29.seq
249925094 gbpln3.seq
249856103 gbpln30.seq
249998570 gbpln31.seq
249999030 gbpln32.seq
217495983 gbpln33.seq
249999653 gbpln34.seq
249998807 gbpln35.seq
249999225 gbpln36.seq
249998322 gbpln37.seq
135929383 gbpln38.seq
249972413 gbpln39.seq
249899590 gbpln4.seq
249999846 gbpln40.seq
248401991 gbpln41.seq
249998841 gbpln42.seq
249994533 gbpln43.seq
221073128 gbpln44.seq
249999800 gbpln45.seq
246763278 gbpln46.seq
249998557 gbpln47.seq
249998324 gbpln48.seq
249996347 gbpln49.seq
249875917 gbpln5.seq
249997469 gbpln50.seq
249995929 gbpln51.seq
152739715 gbpln52.seq
249935469 gbpln6.seq
249999166 gbpln7.seq
223220687 gbpln8.seq
249998292 gbpln9.seq
148949677 gbpri1.seq
249783195 gbpri10.seq
129741660 gbpri11.seq
249962747 gbpri12.seq
249896480 gbpri13.seq
249896770 gbpri14.seq
249947119 gbpri15.seq
249902427 gbpri16.seq
249876185 gbpri17.seq
249991978 gbpri18.seq
249902736 gbpri19.seq
249938401 gbpri2.seq
249956081 gbpri20.seq
249962924 gbpri21.seq
249999165 gbpri22.seq
19313989 gbpri23.seq
177481062 gbpri24.seq
249996771 gbpri25.seq
211364614 gbpri26.seq
249987118 gbpri27.seq
249852372 gbpri28.seq
249948820 gbpri29.seq
249938535 gbpri3.seq
249937231 gbpri30.seq
249957235 gbpri31.seq
249855729 gbpri32.seq
249968208 gbpri33.seq
249998158 gbpri34.seq
95882107 gbpri35.seq
249993971 gbpri36.seq
249998537 gbpri37.seq
249973130 gbpri38.seq
249996382 gbpri39.seq
249901006 gbpri4.seq
250000137 gbpri40.seq
180400983 gbpri41.seq
250000164 gbpri42.seq
249988140 gbpri43.seq
39133617 gbpri44.seq
249831515 gbpri5.seq
249788332 gbpri6.seq
249806906 gbpri7.seq
249867498 gbpri8.seq
249957345 gbpri9.seq
312984 gbrel.txt
249987622 gbrod1.seq
249952616 gbrod10.seq
60961015 gbrod11.seq
249871284 gbrod12.seq
249783783 gbrod13.seq
249992872 gbrod14.seq
249651633 gbrod15.seq
249953778 gbrod16.seq
249885197 gbrod17.seq
249824677 gbrod18.seq
241737195 gbrod19.seq
249835135 gbrod2.seq
249767699 gbrod20.seq
249924095 gbrod21.seq
230194968 gbrod22.seq
249998267 gbrod23.seq
249999871 gbrod24.seq
249938826 gbrod25.seq
249698931 gbrod26.seq
250000151 gbrod27.seq
249998490 gbrod28.seq
170553895 gbrod29.seq
249815915 gbrod3.seq
249956027 gbrod4.seq
249987585 gbrod5.seq
249985583 gbrod6.seq
249746791 gbrod7.seq
249760313 gbrod8.seq
249867062 gbrod9.seq
3916738292 gbsdr1.txt
5703319493 gbsdr2.txt
2646536733 gbsdr3.txt
157801052 gbsec.idx
249997389 gbsts1.seq
249997720 gbsts10.seq
210919464 gbsts11.seq
249996524 gbsts12.seq
249999349 gbsts13.seq
249999266 gbsts14.seq
249999572 gbsts15.seq
24470469 gbsts16.seq
249999107 gbsts17.seq
249997790 gbsts18.seq
249999071 gbsts19.seq
249998220 gbsts2.seq
147052162 gbsts20.seq
249999008 gbsts3.seq
249998277 gbsts4.seq
39162150 gbsts5.seq
249997411 gbsts6.seq
249997774 gbsts7.seq
249997192 gbsts8.seq
249998706 gbsts9.seq
249998674 gbsyn1.seq
249606507 gbsyn2.seq
249961000 gbsyn3.seq
249985866 gbsyn4.seq
249950700 gbsyn5.seq
249994925 gbsyn6.seq
128375178 gbsyn7.seq
249999675 gbtsa1.seq
249996722 gbtsa10.seq
249998933 gbtsa11.seq
103907265 gbtsa12.seq
249997835 gbtsa13.seq
249999221 gbtsa14.seq
249998017 gbtsa15.seq
250000059 gbtsa16.seq
167332404 gbtsa17.seq
249998217 gbtsa18.seq
249998887 gbtsa19.seq
249999837 gbtsa2.seq
249998368 gbtsa20.seq
249997867 gbtsa21.seq
249999537 gbtsa22.seq
250000048 gbtsa23.seq
29793689 gbtsa24.seq
249998710 gbtsa25.seq
249997475 gbtsa26.seq
249998934 gbtsa27.seq
249999882 gbtsa28.seq
249998307 gbtsa29.seq
250000222 gbtsa3.seq
249999868 gbtsa30.seq
119964559 gbtsa31.seq
250000015 gbtsa32.seq
249998533 gbtsa33.seq
249998116 gbtsa34.seq
249999499 gbtsa35.seq
249998894 gbtsa36.seq
17368850 gbtsa37.seq
249998927 gbtsa38.seq
249999797 gbtsa39.seq
249999115 gbtsa4.seq
249999340 gbtsa40.seq
249997527 gbtsa41.seq
249999345 gbtsa42.seq
109806121 gbtsa43.seq
249995009 gbtsa44.seq
249996881 gbtsa45.seq
249999075 gbtsa46.seq
249998563 gbtsa47.seq
250000122 gbtsa48.seq
249998908 gbtsa49.seq
83114656 gbtsa5.seq
249999104 gbtsa50.seq
51087549 gbtsa51.seq
249999422 gbtsa6.seq
249998425 gbtsa7.seq
249997712 gbtsa8.seq
249999770 gbtsa9.seq
483312 gbuna1.seq
249997873 gbvrl1.seq
249996895 gbvrl10.seq
105574277 gbvrl11.seq
250000197 gbvrl12.seq
250000047 gbvrl13.seq
249999602 gbvrl14.seq
249999307 gbvrl15.seq
249321791 gbvrl16.seq
249997137 gbvrl17.seq
249997751 gbvrl18.seq
206430051 gbvrl19.seq
249992676 gbvrl2.seq
249995305 gbvrl3.seq
249997548 gbvrl4.seq
182660396 gbvrl5.seq
249996646 gbvrl6.seq
249998347 gbvrl7.seq
249991590 gbvrl8.seq
249998834 gbvrl9.seq
249918245 gbvrt1.seq
249762539 gbvrt10.seq
249940020 gbvrt11.seq
185678776 gbvrt12.seq
249995062 gbvrt13.seq
249964366 gbvrt14.seq
249831294 gbvrt15.seq
249999676 gbvrt16.seq
249998857 gbvrt17.seq
250000052 gbvrt18.seq
97748436 gbvrt19.seq
249998652 gbvrt2.seq
249893734 gbvrt20.seq
250000089 gbvrt21.seq
249999275 gbvrt22.seq
250000195 gbvrt23.seq
249998072 gbvrt24.seq
32858249 gbvrt25.seq
249978768 gbvrt3.seq
249994860 gbvrt4.seq
90943917 gbvrt5.seq
249995156 gbvrt6.seq
249994002 gbvrt7.seq
249811786 gbvrt8.seq
249951536 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 64619 87327389
BCT10 64 115520696
BCT11 93 115223175
BCT12 92 107627430
BCT13 16109 76375795
BCT14 53933 85390732
BCT15 93 110189094
BCT16 151 93915681
BCT17 61 112455059
BCT18 52 112042350
BCT19 46 114233015
BCT2 388 108330800
BCT20 58 114931588
BCT21 67 111284815
BCT22 36 96325907
BCT23 40 106881287
BCT24 58 105533856
BCT25 74 111675186
BCT26 55 110045255
BCT27 63 106845575
BCT28 55 109391288
BCT29 53 108650404
BCT3 51 111931329
BCT30 46 110496749
BCT31 95 109522868
BCT32 59 110966729
BCT33 67 108616570
BCT34 124 106350090
BCT35 36 69419425
BCT36 202 109105429
BCT37 51 109861512
BCT38 40 106911174
BCT39 54 104252121
BCT4 57 110372672
BCT40 58 107350200
BCT41 44 110960713
BCT42 80 107599606
BCT43 52 108571742
BCT44 46 107138318
BCT45 63 108219635
BCT46 73 107730422
BCT47 61 68565025
BCT48 67 107603750
BCT49 63 105184773
BCT5 38311 73304524
BCT50 50 106266960
BCT51 57 108862370
BCT52 55 106463399
BCT53 65 111133232
BCT54 59 102966532
BCT55 53 109217037
BCT56 57 111684194
BCT57 63 108996551
BCT58 60 109345964
BCT59 68 106172262
BCT6 39043 82651736
BCT60 220 98447010
BCT61 390 58676219
BCT62 1589 2511877
BCT63 3179 5215895
BCT64 6347 7901828
BCT65 12648 15076611
BCT66 25628 27748212
BCT67 50523 53965859
BCT68 76420 77512573
BCT69 71630 77262084
BCT7 5523 96146388
BCT70 8858 96283826
BCT71 5304 100122217
BCT72 2997 106775929
BCT73 68 115951486
BCT74 6336 109551182
BCT75 30606 97643228
BCT76 11226 8266002
BCT77 74026 79704731
BCT78 76752 78871851
BCT79 56544 87806094
BCT8 13866 90149060
BCT80 11090 20709562
BCT9 6715 96271807
ENV1 94396 71530918
ENV10 83176 87258007
ENV11 20145 17415525
ENV12 84810 80888385
ENV13 120560 43439426
ENV14 88796 78160979
ENV15 96643 67757348
ENV16 96103 63441595
ENV17 90452 68435862
ENV18 64859 87002629
ENV19 766 1026325
ENV2 91062 69244491
ENV20 69532 85606513
ENV21 93878 72072769
ENV22 128738 31411615
ENV23 123342 29527954
ENV24 63653 14252683
ENV25 123141 49877914
ENV26 97281 68277637
ENV27 117149 55513740
ENV28 137677 52403153
ENV29 105856 60488810
ENV3 91926 72141807
ENV30 36061 35145478
ENV31 71058 96548027
ENV32 95516 69583521
ENV33 107777 43884780
ENV34 89889 67102437
ENV35 56665 35541750
ENV36 111412 47256188
ENV37 103962 58917645
ENV38 108816 63013322
ENV39 72626 93515776
ENV4 80881 85477472
ENV40 34084 46268924
ENV41 79713 81984809
ENV42 109906 53839265
ENV43 113964 56656311
ENV44 95158 66870881
ENV45 101596 46276467
ENV46 301 211804
ENV5 89111 85925763
ENV6 85572 50214327
ENV7 131779 31253773
ENV8 86385 70481479
ENV9 93283 72934827
EST1 158932 61578479
EST10 167449 72157693
EST100 226264 140239030
EST101 227876 115659958
EST102 201207 104812696
EST103 172048 100993598
EST104 102141 80099408
EST105 165086 110960002
EST106 168528 110445423
EST107 117336 68340860
EST108 63863 23527312
EST109 64115 22727247
EST11 169551 73990710
EST110 64332 23421594
EST111 64296 27232269
EST112 64304 21892571
EST113 65713 25960282
EST114 63774 27850880
EST115 64286 26247748
EST116 64525 26965223
EST117 64244 25128362
EST118 61232 38021283
EST119 162068 76978898
EST12 166812 70069138
EST120 174823 86140156
EST121 158477 92898019
EST122 149626 95761470
EST123 153477 89559420
EST124 125895 78316874
EST125 202876 99251380
EST126 153535 79573162
EST127 157661 84198371
EST128 155783 89048296
EST129 149626 79582445
EST13 72705 34876658
EST130 174498 101221879
EST131 199755 116492004
EST132 182924 99395258
EST133 162692 84591078
EST134 158421 80023195
EST135 145997 89295313
EST136 142146 85882253
EST137 93960 49352258
EST138 188208 107207834
EST139 232320 102104376
EST14 217988 109456242
EST140 153006 89673673
EST141 168259 91528147
EST142 146979 87095506
EST143 137540 86872541
EST144 157511 95441425
EST145 146282 76542576
EST146 123493 64366210
EST147 121742 65859590
EST148 129203 54566656
EST149 127602 50731917
EST15 168489 105323905
EST150 128339 51062112
EST151 119510 45393000
EST152 171932 86436994
EST153 180065 80258706
EST154 154571 109521263
EST155 211737 129261883
EST156 215403 119898276
EST157 174370 93061333
EST158 147408 112021960
EST159 134124 83157659
EST16 179030 112340883
EST160 156525 97667283
EST161 150052 80146888
EST162 141889 81673231
EST163 169010 94499284
EST164 72883 43840217
EST165 154566 95973326
EST166 188984 106150288
EST167 142570 78072923
EST168 135424 71890069
EST169 168420 93997944
EST17 195242 112993027
EST170 180129 103517714
EST171 150835 94209885
EST172 171475 83616440
EST173 129354 86247752
EST174 182229 107546020
EST175 165194 93333050
EST176 112545 66624592
EST177 163589 93256132
EST178 34629 21962390
EST179 169046 101010968
EST18 190718 121438479
EST180 181553 127496330
EST181 148667 106501243
EST182 190804 99674572
EST183 152886 115940268
EST184 144193 86864102
EST185 145316 82971082
EST186 177764 71832083
EST187 149424 84312691
EST188 155253 97131850
EST189 162785 99942769
EST19 159308 114088825
EST190 141941 88206001
EST191 162266 94469043
EST192 133847 89815602
EST193 131320 88449325
EST194 144697 89213599
EST195 134192 89314169
EST196 124147 87244129
EST197 172860 92208130
EST198 173996 95857982
EST199 173451 96327628
EST2 161860 61550624
EST20 187007 99412696
EST200 171159 96079264
EST201 168284 94223546
EST202 172234 95843600
EST203 173453 95045773
EST204 173997 95579785
EST205 32356 17599756
EST206 191192 103860812
EST207 202395 106546783
EST208 174614 105291990
EST209 183709 103813415
EST21 217124 106452918
EST210 197199 118617362
EST211 195653 116446218
EST212 182857 121372720
EST213 173963 104901932
EST214 214267 146906621
EST215 237786 107491349
EST216 139202 108165098
EST217 150828 101459894
EST218 146713 91000518
EST219 205555 111408664
EST22 198770 65908970
EST220 171945 113775039
EST221 100185 91317408
EST222 142439 110343573
EST223 160803 94661715
EST224 145877 106332710
EST225 216127 100562202
EST226 144412 101968476
EST227 137794 96801288
EST228 140542 100912570
EST229 121075 86007085
EST23 140942 40081726
EST230 95695 61724965
EST231 141393 91619041
EST232 133048 97997496
EST233 137799 98181253
EST234 123958 84447235
EST235 132222 86600160
EST236 158280 116644654
EST237 143671 116995349
EST238 133488 113383325
EST239 154628 95286229
EST24 103789 28102424
EST240 178327 113048072
EST241 146211 92209735
EST242 179473 112186411
EST243 164720 122949344
EST244 139003 103048825
EST245 13131 10472727
EST246 164769 100715186
EST247 231024 96831275
EST248 152333 113395857
EST249 179043 65377464
EST25 121302 50818612
EST250 216978 49806618
EST251 212610 81919314
EST252 171046 131501472
EST253 165350 101327338
EST254 168720 107661767
EST255 164593 111354626
EST256 166281 117351978
EST257 87224 44496316
EST258 187591 98402776
EST259 176363 111518975
EST26 213567 97133327
EST260 165212 109295991
EST261 233047 110552516
EST262 278130 120160552
EST263 184069 112101583
EST264 187448 36827978
EST265 259245 124372995
EST266 151670 94525410
EST267 161064 104987823
EST268 96160 56018597
EST269 173742 118483168
EST27 219261 110222276
EST270 183789 98700893
EST271 172057 113342036
EST272 182216 105531859
EST273 207953 36905660
EST274 191199 55938776
EST275 185605 105747028
EST276 187420 118404378
EST277 173153 113469739
EST278 179819 102531780
EST279 156381 104417915
EST28 190448 88579855
EST280 111506 37195441
EST281 129801 81757918
EST282 132785 85924949
EST283 156013 100637050
EST284 259867 27444795
EST285 263841 24255453
EST286 146647 105820732
EST287 168721 109252025
EST288 161515 103060934
EST289 155504 91159662
EST29 157995 68875086
EST290 264850 31949915
EST291 164956 108052496
EST292 73943 43160506
EST293 185007 111270455
EST294 149043 90703586
EST295 195134 109696615
EST296 164589 114984956
EST297 161883 104490591
EST298 189230 113750292
EST299 179275 100240141
EST3 153644 54437600
EST30 171542 69631452
EST300 181271 103445328
EST301 188367 64361365
EST302 187449 69698119
EST303 187278 70914975
EST304 122787 47113483
EST305 187228 91670741
EST306 181996 133366149
EST307 149886 86380523
EST308 154273 90662203
EST309 128684 100409459
EST31 148896 63217399
EST310 156980 97939654
EST311 170066 97314905
EST312 154900 96757068
EST313 170654 98554535
EST314 157284 105098731
EST315 145691 101403563
EST316 164996 106723135
EST317 156933 115226420
EST318 182340 153708339
EST319 172842 94542230
EST32 168362 76138490
EST320 134412 84965336
EST321 144064 99147104
EST322 140792 94013032
EST323 139703 91324294
EST324 145691 101484586
EST325 151004 101275980
EST326 179196 106400488
EST327 149692 86839432
EST328 151777 86235882
EST329 155374 112729467
EST33 173962 66610573
EST330 158723 94822422
EST331 74390 49422874
EST332 138931 86948346
EST333 153225 95119495
EST334 205828 106193333
EST335 114770 63282157
EST336 102993 65457450
EST337 132636 88739418
EST338 139004 87949026
EST339 122654 75453980
EST34 122831 43242860
EST340 216763 82746611
EST341 181917 86359510
EST342 157361 95282890
EST343 178249 108962362
EST344 150977 90107696
EST345 83956 55221692
EST346 134753 90084495
EST347 146546 95386965
EST348 187026 116555652
EST349 158380 90858403
EST35 97393 29892123
EST350 174616 99974568
EST351 176093 129458614
EST352 81143 49245404
EST353 85774 48302868
EST354 146467 84400465
EST355 131112 77302782
EST356 157942 42002454
EST357 158937 31661733
EST358 156737 49816859
EST359 183581 119658352
EST36 97797 30586622
EST360 247326 114307512
EST361 250821 114811592
EST362 176175 99708914
EST363 142342 92334245
EST364 137895 86153507
EST365 156652 93375963
EST366 194499 119600627
EST367 222572 59058877
EST368 184838 112918675
EST369 222186 121724992
EST37 96709 29346134
EST370 139988 67486398
EST371 171773 95841557
EST372 156980 103067817
EST373 195102 134194068
EST374 174044 135774788
EST375 173741 117986997
EST376 164151 97390563
EST377 164726 108706935
EST378 197406 110844298
EST379 188467 97749709
EST38 98630 29837565
EST380 198001 121751643
EST381 191792 128435267
EST382 103816 68400219
EST383 207838 139687322
EST384 215900 131926680
EST385 209083 168408128
EST386 183831 117142702
EST387 195321 110086673
EST388 171302 24337594
EST389 161251 13455270
EST39 99441 31226275
EST390 156773 23613898
EST391 158559 32568678
EST392 158935 31664048
EST393 152721 69182055
EST394 107118 61792204
EST395 180549 116174556
EST396 166101 105236658
EST397 164241 108866468
EST398 143159 95276948
EST399 142030 100657578
EST4 170812 67108330
EST40 23166 5905608
EST400 149007 95255430
EST401 178587 129604043
EST402 147729 94748452
EST403 171257 79086169
EST404 167807 26687023
EST405 164676 91406067
EST406 155888 104760711
EST407 140735 90216632
EST408 144773 87744110
EST409 181224 100972559
EST41 101002 53008237
EST410 181653 127273000
EST411 135353 90845100
EST412 131792 89991358
EST413 154745 95950369
EST414 167052 95034908
EST415 179818 96284694
EST416 143238 90833265
EST417 174745 103288380
EST418 179067 107707072
EST419 110870 76009381
EST42 119591 50876281
EST420 82772 63109671
EST421 99831 66441497
EST422 7624 4619788
EST423 157814 86990816
EST424 126330 76648260
EST425 138769 91139592
EST426 141764 83375258
EST427 164940 96873405
EST428 156671 87086133
EST429 195358 116333375
EST43 164050 85771021
EST430 128121 85136302
EST431 184295 95110774
EST432 168141 80543556
EST433 146065 82850623
EST434 187745 114299217
EST435 134452 88024023
EST436 138938 91332768
EST437 136022 92119317
EST438 185518 76826596
EST439 185047 81199990
EST44 166556 67561577
EST440 205333 87842792
EST441 202236 93278985
EST442 215926 125171839
EST443 163462 101006306
EST444 184415 115828496
EST445 143279 93839261
EST446 164161 107676646
EST447 126420 62507428
EST448 151268 84041093
EST449 163591 74176152
EST45 166147 87481904
EST450 168651 59228348
EST451 140154 54771794
EST46 170532 87234492
EST47 162219 87511094
EST48 162822 82217467
EST49 157684 91186497
EST5 168996 66194437
EST50 161226 91067430
EST51 158729 97987128
EST52 157238 69645056
EST53 150386 82906321
EST54 81818 50046140
EST55 167804 67469558
EST56 160637 76530251
EST57 168910 93006890
EST58 156502 101565373
EST59 157574 100365242
EST6 171504 66930687
EST60 163321 100740971
EST61 160517 106017460
EST62 172752 74009357
EST63 173113 100919246
EST64 151399 80261551
EST65 151044 84151946
EST66 159172 99437900
EST67 137254 78679601
EST68 143278 85052060
EST69 196241 109283008
EST7 169800 72720649
EST70 197806 103725202
EST71 211701 118740452
EST72 191988 113282334
EST73 193866 114172508
EST74 160443 86448329
EST75 133291 62214755
EST76 136784 68626791
EST77 158599 108207870
EST78 155640 85578818
EST79 144446 78842055
EST8 179404 72869764
EST80 55902 37365456
EST81 182550 94460118
EST82 211237 123221893
EST83 214378 115129525
EST84 209162 98414576
EST85 209040 91195645
EST86 148529 90253217
EST87 144306 83890035
EST88 162803 81161604
EST89 159941 80848909
EST9 168515 69281418
EST90 151957 102903044
EST91 152623 99264682
EST92 133419 75844241
EST93 152420 115234390
EST94 141968 104568184
EST95 145379 105381481
EST96 139442 88336562
EST97 152795 86184751
EST98 174897 107332720
EST99 243563 149230578
GSS1 200062 87617305
GSS10 132040 60283372
GSS100 145362 114337340
GSS101 141643 116113759
GSS102 143263 116656493
GSS103 167238 128921102
GSS104 149783 82569304
GSS105 191527 120854119
GSS106 167754 112128998
GSS107 197330 115526115
GSS108 204979 134771775
GSS109 209811 138227419
GSS11 137026 73963307
GSS110 207578 140849257
GSS111 206236 142442604
GSS112 205252 143736524
GSS113 205174 143940262
GSS114 202120 146640781
GSS115 182321 139886386
GSS116 18402 10868805
GSS117 132848 84052151
GSS118 169611 80019194
GSS119 184271 79450634
GSS12 147892 75892162
GSS120 170296 148327490
GSS121 178758 122129958
GSS122 184792 149527338
GSS123 192471 124816227
GSS124 187616 137681247
GSS125 192582 126536809
GSS126 190068 95974036
GSS127 166167 152508730
GSS128 164283 115995268
GSS129 72077 47971984
GSS13 145394 68606548
GSS130 171040 155483774
GSS131 172682 154208585
GSS132 172147 155463991
GSS133 173791 154275835
GSS134 172766 152312161
GSS135 184110 144930584
GSS136 180850 146630825
GSS137 163509 113524702
GSS138 211746 85953665
GSS139 265738 40930491
GSS14 169809 84775490
GSS140 265732 40961625
GSS141 53525 8209147
GSS142 257193 58189558
GSS143 249204 63496141
GSS144 194724 79925705
GSS145 194632 76567977
GSS146 185155 152752062
GSS147 178781 157318949
GSS148 74095 67660841
GSS149 87118 64000130
GSS15 161100 97663213
GSS150 83555 62807097
GSS151 103680 48622710
GSS152 68578 58473263
GSS153 7665 7016900
GSS154 68591 57924394
GSS155 69224 56650935
GSS156 69460 56187403
GSS157 71202 55998401
GSS158 68561 51865315
GSS159 75915 58209304
GSS16 172836 87033749
GSS160 87237 74898207
GSS161 81830 44609896
GSS162 92677 45029689
GSS163 63209 47603494
GSS164 77435 61351403
GSS165 69655 58699293
GSS166 67711 62706526
GSS167 61946 53348157
GSS168 95612 42935517
GSS169 21104 4920928
GSS17 183523 113501533
GSS170 112937 70876701
GSS171 823 560132
GSS172 23226 28867035
GSS173 109043 70652585
GSS174 84533 34668223
GSS175 35815 22222733
GSS176 103304 62490220
GSS177 102329 63761256
GSS178 104268 67656826
GSS179 82099 41276456
GSS18 192358 114305774
GSS180 83102 54651503
GSS181 95673 61335435
GSS182 107323 78547443
GSS183 106375 76684757
GSS184 106058 79947480
GSS185 103996 80016519
GSS186 76374 51039123
GSS187 104572 63292187
GSS188 109868 66415305
GSS189 106205 59313311
GSS19 114075 52103409
GSS190 68379 37446344
GSS191 69573 38736929
GSS192 37145 17774305
GSS193 85481 46023427
GSS194 97119 55907586
GSS195 94982 49597190
GSS196 96286 55922591
GSS197 42132 23615490
GSS198 114638 43642267
GSS199 117085 39368203
GSS2 182294 92190593
GSS20 181789 101771260
GSS200 108676 55514545
GSS201 101471 78372335
GSS202 71100 45542204
GSS203 95891 36542252
GSS204 95417 37268709
GSS205 96671 35161518
GSS206 94285 39167432
GSS207 37736 17626556
GSS208 103939 66277823
GSS209 94551 61190929
GSS21 166208 114173594
GSS210 95128 60357048
GSS211 94773 60868501
GSS212 75675 70017159
GSS213 75117 74330280
GSS214 4473 7127270
GSS215 83736 28233267
GSS216 84219 27346468
GSS217 84926 25909272
GSS218 14851 4422302
GSS219 16547 7508221
GSS22 169506 97609042
GSS220 92648 59635081
GSS221 84649 52506719
GSS222 94060 50733017
GSS223 88580 48352815
GSS224 10706 5829890
GSS225 90648 56882510
GSS226 89662 61882079
GSS227 88553 63641206
GSS228 89283 62505584
GSS229 9890 7129098
GSS23 187251 126687349
GSS230 87995 63795538
GSS231 90217 62488977
GSS232 94639 59914104
GSS233 74309 63030713
GSS234 84243 78883806
GSS235 83030 80583817
GSS236 70509 52677201
GSS237 117650 64297121
GSS238 108874 55446727
GSS239 107533 52125503
GSS24 194057 130219707
GSS240 96658 43251344
GSS241 109801 49060015
GSS242 98194 46325477
GSS243 73059 72225597
GSS244 76682 71142435
GSS245 72980 46435649
GSS246 94787 57200301
GSS247 93517 59081345
GSS248 93900 58510429
GSS249 94714 57307691
GSS25 177481 105207105
GSS250 94279 58016121
GSS251 6701 3333254
GSS26 185918 107808246
GSS27 170600 151419573
GSS28 190494 146229226
GSS29 151147 106441309
GSS3 174946 87827370
GSS30 192446 132128206
GSS31 13634 8776287
GSS32 196044 127318947
GSS33 216659 116231837
GSS34 218573 113602417
GSS35 219720 112025390
GSS36 213958 121897898
GSS37 198560 156434224
GSS38 194991 146802885
GSS39 197241 73368303
GSS4 167155 85101061
GSS40 185065 97681837
GSS41 189783 125959643
GSS42 170343 158769399
GSS43 9054 5887224
GSS44 183999 100320381
GSS45 173032 121667203
GSS46 185089 124655109
GSS47 190835 122398633
GSS48 70733 62564650
GSS49 171799 101963548
GSS5 53445 31617730
GSS50 167647 103037030
GSS51 167798 102616122
GSS52 184194 121477291
GSS53 184774 116632196
GSS54 181686 122485290
GSS55 187531 113994336
GSS56 189392 134519036
GSS57 178947 104938173
GSS58 195715 120562907
GSS59 179925 133347062
GSS6 161617 84471320
GSS60 1898 1718384
GSS61 172844 138948397
GSS62 161635 111553347
GSS63 161673 111572480
GSS64 158827 107592995
GSS65 156768 129062324
GSS66 170185 142553826
GSS67 179844 117096102
GSS68 204911 127968663
GSS69 193332 110756601
GSS7 165323 79361698
GSS70 243921 125965583
GSS71 160206 106329772
GSS72 159350 119782538
GSS73 162663 124539011
GSS74 162629 124600834
GSS75 175106 108957765
GSS76 190310 140120939
GSS77 13117 7645415
GSS78 199135 126616367
GSS79 170370 111603100
GSS8 165782 88979927
GSS80 200718 131518447
GSS81 211575 85835271
GSS82 187842 98659368
GSS83 131802 92017231
GSS84 146986 118083551
GSS85 139587 116995322
GSS86 142817 114062378
GSS87 144008 119847686
GSS88 141842 115691442
GSS89 106718 88926972
GSS9 137999 67157686
GSS90 149425 122240891
GSS91 147663 117692857
GSS92 143995 113064403
GSS93 142869 115422868
GSS94 144203 119656289
GSS95 148069 121684067
GSS96 147696 117745472
GSS97 146077 121054040
GSS98 146145 120923099
GSS99 146569 120073651
HTC1 25057 27045808
HTC10 63431 67180460
HTC11 62746 57492888
HTC12 66993 60073171
HTC13 68556 69499762
HTC14 21666 15118268
HTC2 16086 36243320
HTC3 16029 36627693
HTC4 16251 35560357
HTC5 15980 40344457
HTC6 16068 37474845
HTC7 53834 31477922
HTC8 31137 19451907
HTC9 62355 78487812
HTG1 1318 188771164
HTG10 1298 186333849
HTG100 990 189440077
HTG101 996 189331054
HTG102 985 189419172
HTG103 1161 190585510
HTG104 30 4314892
HTG105 1087 189830459
HTG106 1045 189717260
HTG107 1388 191466263
HTG108 1301 190817637
HTG109 1618 191094779
HTG11 6 837687
HTG110 1360 191866703
HTG111 1299 192131784
HTG112 1308 190200930
HTG113 1044 185728683
HTG114 866 136599513
HTG115 1513 182381556
HTG116 992 192165745
HTG117 930 180556880
HTG118 1076 193695026
HTG119 1103 193020481
HTG12 1451 183826000
HTG120 222 41677204
HTG121 1029 189558680
HTG122 1054 192628794
HTG123 1164 192104076
HTG124 1083 192929368
HTG125 1083 192942392
HTG126 591 104225836
HTG127 1121 192542900
HTG128 1080 192286375
HTG129 1078 192355914
HTG13 875 191579912
HTG130 1165 191935230
HTG131 1542 191732030
HTG132 1070 192316972
HTG133 1069 192283809
HTG134 1129 191726888
HTG135 1380 190128572
HTG136 446 51564651
HTG14 753 192058598
HTG15 745 191952430
HTG16 786 192030578
HTG17 798 191859978
HTG18 775 192103394
HTG19 2069 170638342
HTG2 2470 186037380
HTG20 1096 187413748
HTG21 887 180042173
HTG22 785 191651644
HTG23 928 190141652
HTG24 907 190491600
HTG25 811 191323929
HTG26 784 191771279
HTG27 874 191079273
HTG28 896 190515178
HTG29 939 189964220
HTG3 2513 185208586
HTG30 911 190941779
HTG31 841 171449145
HTG32 875 191097680
HTG33 968 189501635
HTG34 884 191025385
HTG35 868 191276405
HTG36 825 191697068
HTG37 949 189868158
HTG38 949 190351720
HTG39 940 190045229
HTG4 2550 188439001
HTG40 1049 189067591
HTG41 1089 167537350
HTG42 1256 188119418
HTG43 1169 188010117
HTG44 1150 188080035
HTG45 1117 191232412
HTG46 1269 190634433
HTG47 1176 190820823
HTG48 1128 191224702
HTG49 1046 191244150
HTG5 1283 185453274
HTG50 1030 189619303
HTG51 1042 178756613
HTG52 968 190052338
HTG53 1105 190148899
HTG54 1046 190158403
HTG55 1014 189831932
HTG56 969 189170679
HTG57 81 14306584
HTG58 1010 189396132
HTG59 1031 189967604
HTG6 1273 185124562
HTG60 1077 187192796
HTG61 1125 188251573
HTG62 990 171367209
HTG63 1085 189473966
HTG64 1064 189415560
HTG65 1169 188798107
HTG66 1179 187545797
HTG67 1282 184397923
HTG68 94 12194080
HTG69 1221 185314622
HTG7 1276 185375030
HTG70 1239 184674446
HTG71 1244 184625496
HTG72 1183 187688486
HTG73 1020 170303770
HTG74 1118 188293510
HTG75 1103 190775743
HTG76 1135 190789237
HTG77 1182 190871034
HTG78 1096 185997580
HTG79 1171 190202119
HTG8 1459 184608562
HTG80 1115 190063261
HTG81 1213 189874691
HTG82 1120 189645029
HTG83 959 164682536
HTG84 1229 188409093
HTG85 1250 187741728
HTG86 1141 189879061
HTG87 1144 189686641
HTG88 978 167870813
HTG89 1182 189961005
HTG9 1200 186916809
HTG90 1104 190233697
HTG91 1146 190099121
HTG92 1109 190495628
HTG93 963 159549226
HTG94 1056 190751235
HTG95 1161 191033671
HTG96 1031 189156227
HTG97 1071 189524206
HTG98 685 127675409
HTG99 1018 189641315
INV1 94145 48350003
INV10 83435 65435227
INV11 54515 43124836
INV12 84921 66267646
INV13 80894 66911394
INV14 78476 68146368
INV15 44771 40991599
INV16 34677 110596616
INV17 386 154397728
INV18 58166 94065731
INV19 74056 62085031
INV2 16009 164228490
INV20 74147 53663002
INV21 21418 13965215
INV22 27268 129946772
INV23 6 133712559
INV24 53103 98220211
INV25 74704 49375238
INV26 73208 49221114
INV27 62005 42630688
INV28 72475 49027732
INV29 73714 50210395
INV3 1336 150507243
INV30 71331 51489216
INV31 68010 63479170
INV32 8388 46389335
INV4 16933 128332256
INV5 78559 72589399
INV6 54253 94946170
INV7 47206 81971624
INV8 80584 71781516
INV9 59161 86005042
MAM1 15605 161967877
MAM2 20361 156939871
MAM3 58435 83515717
MAM4 8982 182828945
MAM5 79368 74719786
MAM6 52965 118935400
MAM7 62400 51901403
PAT1 222542 70116699
PAT10 124452 102575971
PAT100 178185 3385515
PAT101 132610 2848492
PAT102 342935 8573375
PAT103 188806 88519660
PAT104 111348 132068608
PAT105 3850 194703659
PAT106 131292 110979300
PAT107 158599 54826034
PAT108 224730 34113420
PAT109 250080 15844360
PAT11 98645 64114703
PAT110 180680 63677151
PAT111 51648 26046194
PAT112 114184 110462046
PAT113 137702 83278366
PAT114 164163 99348600
PAT115 158877 103325984
PAT116 137417 114988187
PAT117 42311 27994848
PAT118 193712 81686401
PAT119 150217 108404022
PAT12 142065 62828791
PAT120 356051 11379688
PAT121 257211 57607099
PAT122 138161 48226925
PAT123 322021 22795469
PAT124 155639 102753887
PAT125 132727 110696284
PAT126 128341 121313309
PAT127 21664 184390005
PAT128 144888 112900567
PAT129 171997 96403773
PAT13 105888 59875034
PAT130 44618 171217879
PAT131 9167 47581637
PAT132 33645 178334734
PAT133 153558 109675196
PAT134 178705 90913377
PAT135 136049 115324159
PAT136 120392 123342367
PAT137 112436 66489146
PAT138 203662 47737230
PAT139 277828 9627968
PAT14 103642 50160321
PAT140 220409 46465135
PAT141 106719 2881142
PAT142 270386 21672571
PAT143 186751 61239638
PAT144 109799 106056597
PAT145 47518 9550821
PAT146 87299 88249520
PAT147 78465 95588128
PAT148 145201 77694876
PAT149 167499 71382707
PAT15 121148 53317075
PAT150 121465 92942809
PAT151 102977 85383727
PAT152 165566 46016231
PAT153 270022 5130418
PAT154 269978 5129582
PAT155 269978 5129582
PAT156 237888 4519872
PAT157 269396 5118524
PAT158 235480 25575098
PAT159 203734 47154417
PAT16 113137 61274458
PAT160 12033 422577
PAT161 165317 74871979
PAT162 91686 126656173
PAT163 172588 71662855
PAT164 137862 72260487
PAT165 9532 13982682
PAT166 93111 87244841
PAT167 91681 79829797
PAT168 83213 91467896
PAT169 109150 53717368
PAT17 39159 16235508
PAT170 140382 87089805
PAT171 114046 109103441
PAT172 154903 82576933
PAT173 191668 58048079
PAT18 146771 52594264
PAT19 153705 78039102
PAT2 194544 84644913
PAT20 104995 118172564
PAT21 133550 95503155
PAT22 84598 79322013
PAT23 123563 103405415
PAT24 119415 105656371
PAT25 145486 86670068
PAT26 175165 64299073
PAT27 71371 1784275
PAT28 102171 77387698
PAT29 93955 87644560
PAT3 171983 95894231
PAT30 119942 61673191
PAT31 96645 78968068
PAT32 128387 55025904
PAT33 92210 51123413
PAT34 111297 78150994
PAT35 138100 29119820
PAT36 158503 24081830
PAT37 114681 49019496
PAT38 44867 54579973
PAT39 95732 83191686
PAT4 153734 106065135
PAT40 100232 70984798
PAT41 136206 39303264
PAT42 143775 35446842
PAT43 123730 64736958
PAT44 104361 81207665
PAT45 93445 74211542
PAT46 113255 66591457
PAT47 65218 54831902
PAT48 135193 108001084
PAT49 167081 97032398
PAT5 57197 23951583
PAT50 116397 127555645
PAT51 196343 76722711
PAT52 80302 127991032
PAT53 27631 180872621
PAT54 185408 93066629
PAT55 274259 6856475
PAT56 129447 31627433
PAT57 161320 77719729
PAT58 92812 89404206
PAT59 106517 74781811
PAT6 170642 91909261
PAT60 122361 64031080
PAT61 67425 30297598
PAT62 70750 109767817
PAT63 87947 82758966
PAT64 92971 78937516
PAT65 93166 72441718
PAT66 93384 75085880
PAT67 115775 60531183
PAT68 102736 9941783
PAT69 175933 10547809
PAT7 154779 88234702
PAT70 171510 10872561
PAT71 171496 10866737
PAT72 99859 86225043
PAT73 99 196466297
PAT74 67 192869889
PAT75 103 195600591
PAT76 1137 196318757
PAT77 97599 5772236
PAT78 151009 9636510
PAT79 151022 9621259
PAT8 131215 96912207
PAT80 151024 9622125
PAT81 151021 9620837
PAT82 94633 88060720
PAT83 93690 93465044
PAT84 34071 33980501
PAT85 83459 93185861
PAT86 15570 180450165
PAT87 164898 19209900
PAT88 178944 3399936
PAT89 177434 3371246
PAT9 129375 101133373
PAT90 175305 3330795
PAT91 101391 1926429
PAT92 169171 12412246
PAT93 178699 3395281
PAT94 178691 3395129
PAT95 178677 3394863
PAT96 140780 2674820
PAT97 178683 3394977
PAT98 178342 3388498
PAT99 178198 3385762
PHG1 6377 70021949
PLN1 59897 93484081
PLN10 37435 49339456
PLN11 40284 65703271
PLN12 22496 123991381
PLN13 21103 99490646
PLN14 17578 144865462
PLN15 17634 146278605
PLN16 17564 146392665
PLN17 24586 128622172
PLN18 6000 149205408
PLN19 1266 170315035
PLN2 38356 117281443
PLN20 14134 155912680
PLN21 7126 8366082
PLN22 67256 69764583
PLN23 29372 31563580
PLN24 76964 76375552
PLN25 65424 81402358
PLN26 44731 113954432
PLN27 42 85481108
PLN28 7 95178561
PLN29 3220 146938239
PLN3 1360 177757738
PLN30 24414 133137973
PLN31 60122 88166797
PLN32 76411 77221479
PLN33 87518 45984627
PLN34 80392 71715812
PLN35 77969 75754264
PLN36 80049 70465838
PLN37 82083 75743844
PLN38 56872 30226055
PLN39 101375 57285209
PLN4 1841 185713161
PLN40 80556 70166250
PLN41 44537 98175265
PLN42 29827 123442428
PLN43 16062 134620056
PLN44 63390 71157351
PLN45 81344 72266169
PLN46 61845 82042198
PLN47 61231 83055551
PLN48 87821 61275443
PLN49 89425 64364903
PLN5 1841 194237923
PLN50 67610 87288894
PLN51 70177 77753952
PLN52 31330 56398746
PLN6 1713 194409470
PLN7 30550 132974059
PLN8 68546 68774097
PLN9 73074 75873315
PRI1 23016 59646733
PRI10 1272 179275558
PRI11 775 94029396
PRI12 1278 179183454
PRI13 1451 177770436
PRI14 1589 180081042
PRI15 1591 181937113
PRI16 1285 191720215
PRI17 1137 193666240
PRI18 1099 194310776
PRI19 1166 193657185
PRI2 18318 149402096
PRI20 1737 191824483
PRI21 2647 189799961
PRI22 18082 162623904
PRI23 2662 10140267
PRI24 31573 84616058
PRI25 61950 78204817
PRI26 31351 70630978
PRI27 8521 161801360
PRI28 2251 180536345
PRI29 1618 181509288
PRI3 1433 175232985
PRI30 2007 181705860
PRI31 1958 180727178
PRI32 13182 156344247
PRI33 1328 183749995
PRI34 41712 106643745
PRI35 22922 33120663
PRI36 32189 63608729
PRI37 20137 117669283
PRI38 18568 147184451
PRI39 66602 86841579
PRI4 1282 185505233
PRI40 49427 89761235
PRI41 39706 73270313
PRI42 45389 95494997
PRI43 68105 86686545
PRI44 2833 24749741
PRI5 1324 184292917
PRI6 1180 179907324
PRI7 1246 180917243
PRI8 1212 178442526
PRI9 1367 174647124
ROD1 32312 140773658
ROD10 987 181481529
ROD11 232 44057446
ROD12 1034 185475616
ROD13 940 182703335
ROD14 1040 189324025
ROD15 950 180306408
ROD16 967 182057152
ROD17 991 185811349
ROD18 1189 190476978
ROD19 16750 151126619
ROD2 915 175328944
ROD20 20349 148361192
ROD21 1132 182075942
ROD22 1079 168189648
ROD23 13592 162644180
ROD24 38845 69265379
ROD25 21807 104556970
ROD26 1508 187599166
ROD27 134649 36929314
ROD28 84468 70117467
ROD29 46936 54764728
ROD3 905 173323995
ROD4 901 173936926
ROD5 923 174315076
ROD6 966 178209811
ROD7 968 179457909
ROD8 979 181267813
ROD9 994 181774273
STS1 85282 36763268
STS10 57907 44420267
STS11 48910 37503235
STS12 57924 43637361
STS13 64284 42850769
STS14 93606 34184225
STS15 104286 26517062
STS16 10116 2741066
STS17 103611 27476228
STS18 86929 34448302
STS19 99733 33367597
STS2 84354 49850025
STS20 54479 20731657
STS3 66846 26362760
STS4 76989 36945836
STS5 8457 4958885
STS6 54259 31650966
STS7 54162 31838227
STS8 54316 31957697
STS9 55716 37767321
SYN1 43082 76687142
SYN2 49326 68181793
SYN3 10743 160550160
SYN4 4599 176535222
SYN5 4596 176475231
SYN6 4601 176600811
SYN7 4715 87366528
TSA1 120505 38243959
TSA10 110707 38087107
TSA11 93510 31663613
TSA12 49790 16705166
TSA13 86486 70566494
TSA14 121991 38853496
TSA15 134870 35826510
TSA16 60982 79709095
TSA17 39421 53478178
TSA18 70282 97466599
TSA19 100893 57110196
TSA2 113528 41670793
TSA20 110663 52343396
TSA21 102937 53577836
TSA22 103736 52459823
TSA23 100922 47136901
TSA24 10725 6386002
TSA25 66573 59369298
TSA26 90250 62317379
TSA27 90395 75445863
TSA28 81291 75040690
TSA29 113045 34907447
TSA3 110398 41018342
TSA30 105614 51695041
TSA31 43017 35545468
TSA32 117006 42754122
TSA33 100254 55661219
TSA34 104927 53272065
TSA35 89834 69966029
TSA36 94138 70090503
TSA37 8432 2306791
TSA38 91228 72116539
TSA39 96026 56830673
TSA4 110952 45737441
TSA40 65364 106745352
TSA41 88818 78124099
TSA42 76071 81314094
TSA43 27377 46400956
TSA44 89053 69490190
TSA45 75197 86012084
TSA46 73336 77189655
TSA47 88445 82175735
TSA48 93774 84045049
TSA49 87724 67729510
TSA5 43145 10916057
TSA50 70645 65573403
TSA51 24567 11714134
TSA6 112460 59451131
TSA7 95611 66256273
TSA8 105745 68771636
TSA9 105926 64847592
UNA1 238 125011
VRL1 68339 68920830
VRL10 61946 72891123
VRL11 21350 31318272
VRL12 62820 71199258
VRL13 57510 72744374
VRL14 62975 65177941
VRL15 56675 74134409
VRL16 57508 72117308
VRL17 57619 71080866
VRL18 57775 70787880
VRL19 56941 57376269
VRL2 73433 64330658
VRL3 69704 60993796
VRL4 68159 70041598
VRL5 47565 49612533
VRL6 48252 77528882
VRL7 48500 73318366
VRL8 63041 71830291
VRL9 68745 66537284
VRT1 39444 127438981
VRT10 1256 189144082
VRT11 8274 177844568
VRT12 3994 136790703
VRT13 13095 170781188
VRT14 5348 182619924
VRT15 3936 185905956
VRT16 37547 134662096
VRT17 79796 68487148
VRT18 78401 66470518
VRT19 30574 24779295
VRT2 4381 189270242
VRT20 70217 79239317
VRT21 48712 118053901
VRT22 76703 62511632
VRT23 77611 60419637
VRT24 80313 56499892
VRT25 9875 9491030
VRT3 69380 81681978
VRT4 9602 168230313
VRT5 30067 23830691
VRT6 73012 66721467
VRT7 31732 63525065
VRT8 30651 111956535
VRT9 1202 189984871
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 187.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:
Entries Bases Species
19445681 15964956444 Homo sapiens
9317799 9884836246 Mus musculus
2187523 6506940433 Rattus norvegicus
2199739 5383949303 Bos taurus
3932517 5059842686 Zea mays
3227493 4837305038 Sus scrofa
1707183 3126299357 Danio rerio
228316 1352989825 Strongylocentrotus purpuratus
1347274 1253406828 Oryza sativa Japonica Group
1772107 1196186274 Nicotiana tabacum
1424332 1147248014 Xenopus (Silurana) tropicalis
2322316 1140559423 Arabidopsis thaliana
1226961 1063159869 Drosophila melanogaster
216458 1007860551 Pan troglodytes
766573 998717841 Vitis vinifera
1455267 948944699 Canis lupus familiaris
1902619 905699264 Glycine max
813754 898332820 Gallus gallus
83587 830368867 Macaca mulatta
739106 829516000 Solanum lycopersicum
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
187 Dec 2011 135117731375 146413798
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
187 Dec 2011 239868309609 73729553
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
October 15 2010
NCBI-GenBank Flat File Release 187.0
Bacterial Sequences (Part 1)
51396 loci, 92682287 bases, from 51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
or 2010.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA).
Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
DBLINK Project:18787
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK Project:100,200,300
DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:
http://www.ncbi.nlm.nih.gov/genomes/static/gprj_help.html#introduction
As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 187.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Michel Eschenbrenner, Irene Fang,
Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Leigh Riley, Gert Roosen, Susan Schafer,
Ruth Timme, Beverly Underwood, Melissa Wright, and Linda Yankie
Data Management and Preparation
Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky,
WonHee Jang, Jonathan Kans, Leonid Khotomliansky, Michael Kimelman,
Jim Ostell, Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov
Database Administration
Slava Khotomliansky, Igor Lozitskiy, Ben Slade, Constantin Vasilyev
User Support
Peter Cooper, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
