Release Notes For GenBank Release 189
GBREL.TXT Genetic Sequence Data Bank
April 15 2012
NCBI-GenBank Flat File Release 189.0
Distribution Release Notes
151824421 loci, 139266481398 bases, from 151824421 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 189.0
1.2 Cutoff Date
1.3 Important Changes in Release 189.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 189.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for GenBank's web-based submission tool (BankIt) :
http://www.ncbi.nlm.nih.gov/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 189.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:
http://www.bio-mirror.net/
1.2 Cutoff Date
This full release, 189.0, incorporates data available to the collaborating
databases as of April 15, 2012 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 189.0
1.3.1 Extension of position syntax for /anticodon qualifiers
Starting with the April 2012 GenBank Release 189.0, the format
of the /anticodon qualifier has been extended to allow the use
of join() and complement() for the location of a tRNA's anticodon.
Currently, the qualifier supports only a simple continuous
basepair range. For example:
/anticodon=(pos:34..36,aa:Phe)
But there are rare cases of intron-containing tRNAs, for which a
simple X..Y location will not suffice:
tRNA join(<1..5,495..544)
/gene="trnL"
/product="tRNA-Leu"
/note="codon recognized: UUA"
/anticodon=(pos:join(5,495..496),aa:Leu)
To support cases like these, the "pos" field is now allowed to make
use of the join() and complement() location operators. Anticodons are
usually three (sometimes four) bases in length, and this *remains*
true even though the join() operator could theoretically be (mis)used
to assert a much more complex/larger location than that.
1.3.2 New representation for Transcriptome Shotgun Assembly (TSA) records.
The TSA division of GenBank (see http://www.ncbi.nlm.nih.gov/genbank/tsa
for details) has grown much more quickly than expected. To accommodate the
increasing TSA submission volume, GenBank plans to use a WGS-like approach
for TSA sequencing projects. It is likely that we will start to provide
TSA project data in the new format *prior* to Release 190.0 in June 2012.
TSA projects will be assigned a four-letter project code, starting with
the letter "G" (for example, GAAA). Individual mRNA sequences within a
project will make use of the 4+2+6 accession number convention, familiar
to users of WGS data (for example, GAAA01000001). Unlike WGS, re-assembly
of the mRNAs for a TSA sequencing project is expected to be a very rare
occurrence, and we expect that the 2-digit assembly-version number will
almost always be "01" for TSA mRNAs. Similar to WGS, a TSA master record
will provide a convenient overview of a TSA project, with an 'all-zeroes'
accession number (eg: GAAA00000000) .
TSA projects that make use of this new representation will be provided
in a separate FTP directory at the NCBI FTP site: genbank/tsa . And like
WGS, the various data files for a TSA project will be grouped by the
4-letter project code, and they will be updated independently of the
GenBank release cycle.
Plans aren't yet finalized for the 5.2 million TSA records currently
provided in the divisional gbtsa* files of a GenBank release. Ideally,
all would be converted to the new WGS-like representation, so that all
TSA records in GenBank utilize a common approach. However, the resources
for such a conversion might not be readily available, in which case
older/legacy TSA records might remain as they are now.
Further details about this new approach for handling TSA data will be
made available via these release notes and the GenBank newsgroup, as we
get closer to implementation.
1.3.3 Organizational changes
The total number of sequence data files increased by 28 with this release:
- the BCT division is now composed of 85 files (+3)
- the CON division is now composed of 167 files (+1)
- the ENV division is now composed of 53 files (+3)
- the EST division is now composed of 461 files (+6)
- the INV division is now composed of 30 files (-2)
- the MAM division is now composed of 8 files (+1)
- the PAT division is now composed of 178 files (+2)
- the PLN division is now composed of 55 files (+2)
- the PRI division is now composed of 45 files (+1)
- the TSA division is now composed of 70 files (+10)
- the VRT division is now composed of 26 files (+1)
The decrease in the number of INV-division files was a consequence of
the removal of approximately 340,000 BarCode sequence records that
lacked tentative taxonomic identification, and hence did not satisfy the
terms of the iBOL/GenBank early-release agreement.
The total number of 'index' files increased by 1 with this release:
- the AUT (author name) index is now composed of 97 files (+1)
1.3.4 Project DBLINKs transitioning to BioProject
The Genome Project Database resource at the NCBI was redesigned in
recent months, culminating in the implementation of a new BioProject
resource:
http://www.ncbi.nlm.nih.gov/bioproject
An article that describes the goals of BioProject is available:
http://www.ncbi.nlm.nih.gov/books/NBK54015/
BioProject is a collaborative effort of the International Nucleotide
Sequence Database Collaboration (INSDC), and project data are exchanged
with NCBI's partner INSDC institutions, EBI and DDBJ. A BioProject
website is also available at DDBJ:
http://trace.ddbj.nig.ac.jp/bioproject/index_e.shtml
BioProjects are uniquely identified by BioProject Accession Numbers,
which utilize this format:
"PRJ"
"E" or "N" or "D"
one letter
one or more digits
Examples of valid BioProject accessions are PRJNA12521 and PRJEB1 .
With BioProject now in operation, we are preparing to implement links
from sequence records to the new resource. Previously, links to the
Genome Project Database were provided by numeric 'Project' DBLINKs .
Here's an example for a bacterial complete-genome record:
LOCUS CP002497 1110245 bp DNA linear PLN 14-NOV-2011
DEFINITION Eremothecium cymbalariae DBVPG#7215 chromosome 1, complete
sequence.
ACCESSION CP002497
VERSION CP002497.1 GI:356887709
DBLINK Project: 60715
When this link is switched to a BioProject accession, the DBLINK line
will change slightly:
LOCUS CP002497 1110245 bp DNA linear PLN 14-NOV-2011
DEFINITION Eremothecium cymbalariae DBVPG#7215 chromosome 1, complete
sequence.
ACCESSION CP002497
VERSION CP002497.1 GI:356887709
DBLINK BioProject: PRJNA60715
In the coming months, many millions of sequence records will gradually
be modified, to make use of the new BioProject DBLINK. These modifications
will not be distributed via daily GenBank and RefSeq incremental-update
products.
However, the new BioProject links are gradually appearing on newly
submitted sequence records, and were present in GenBank and RefSeq
release and incremental-update products starting in December 2011.
In addition, the new BioProject links are visible via NCBI's Entrez:Nucleotide
resource.
1.3.5 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.6 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
103 of the GSS flatfiles in Release 189.0. Consider gbgss153.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
April 15 2012
NCBI-GenBank Flat File Release 189.0
GSS Sequences (Part 1)
87113 loci, 63992234 bases, from 87113 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "153" based on the number of files dumped from the other
system. We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.2 New /pseudogene qualifier; /pseudo will be deprecated
A new controlled-vocabulary /pseudogene qualifier has been under
discussion within the INSDC since the last collaborative INSD meeting
in May 2011. The goal of the new qualifier is to use it for the annotation
of certain well-defined classes of pseudogenes. And at the same time,
to cease using the poorly-defined /pseudo qualifier, which has been
used for a variety of different situations by each INSDC member.
Although a formal definition of /pseudogene is not yet available, we
do have a tentative list of the values for the new qualifier:
"processed" - the pseudogene has arisen by reverse
transcription of a mRNA into cDNA, followed by reintegration into the
genome. Therefore, it has lost any intron/exon structure, and it will
have a pseudo-polyA-tail (if a young pseudogene).
"unprocessed" - the pseudogene has arisen from a copy of
the parent gene by means other than reverse transcription. This covers
usually duplication (transposition [not retrotransposition] and perhaps
recombination) followed by accumulation of random mutation. The changes,
compared to their functional homolog, include insertion, deletions,
premature stop codons, frameshifts and a higher proportion of
non-synonymous versus synonymous substitutions.
"unitary" - the pseudogene has no parent. It is the
original gene, which is functional is some species but disrupted in some
way (indels, mutation, recombination) in another species or strain. In a
lot of cases, such changes would kill the organism, particularly with
house-keeping genes.
"allelic" - a (unitary) pseudogene that is stable in the
population but importantly it has a functional alternative allele also
in the population. i.e., one strain may have the gene, another strain
may have the pseudogene. MHC haplotypes have allelic pseudogenes.
"unknown" - would imply that the submitter does not know
the method of pseudogenisation
If a final definition of /pseudogene can be arrived at within the
next few weeks, then the new qualifier would be legal as of GenBank
Release 190.0 in June of 2012. We will keep users posted about this
new qualifier via the GenBank newsgroup and these release notes.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1790 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut74.idx - Index of the entries according to author name, part 74.
76. gbaut75.idx - Index of the entries according to author name, part 75.
77. gbaut76.idx - Index of the entries according to author name, part 76.
78. gbaut77.idx - Index of the entries according to author name, part 77.
79. gbaut78.idx - Index of the entries according to author name, part 78.
80. gbaut79.idx - Index of the entries according to author name, part 79.
81. gbaut8.idx - Index of the entries according to author name, part 8.
82. gbaut80.idx - Index of the entries according to author name, part 80.
83. gbaut81.idx - Index of the entries according to author name, part 81.
84. gbaut82.idx - Index of the entries according to author name, part 82.
85. gbaut83.idx - Index of the entries according to author name, part 83.
86. gbaut84.idx - Index of the entries according to author name, part 84.
87. gbaut85.idx - Index of the entries according to author name, part 85.
88. gbaut86.idx - Index of the entries according to author name, part 86.
89. gbaut87.idx - Index of the entries according to author name, part 87.
90. gbaut88.idx - Index of the entries according to author name, part 88.
91. gbaut89.idx - Index of the entries according to author name, part 89.
92. gbaut9.idx - Index of the entries according to author name, part 9.
93. gbaut90.idx - Index of the entries according to author name, part 90.
94. gbaut91.idx - Index of the entries according to author name, part 91.
95. gbaut92.idx - Index of the entries according to author name, part 92.
96. gbaut93.idx - Index of the entries according to author name, part 93.
97. gbaut94.idx - Index of the entries according to author name, part 94.
98. gbaut95.idx - Index of the entries according to author name, part 95.
99. gbaut96.idx - Index of the entries according to author name, part 96.
100. gbaut97.idx - Index of the entries according to author name, part 97.
101. gbbct1.seq - Bacterial sequence entries, part 1.
102. gbbct10.seq - Bacterial sequence entries, part 10.
103. gbbct11.seq - Bacterial sequence entries, part 11.
104. gbbct12.seq - Bacterial sequence entries, part 12.
105. gbbct13.seq - Bacterial sequence entries, part 13.
106. gbbct14.seq - Bacterial sequence entries, part 14.
107. gbbct15.seq - Bacterial sequence entries, part 15.
108. gbbct16.seq - Bacterial sequence entries, part 16.
109. gbbct17.seq - Bacterial sequence entries, part 17.
110. gbbct18.seq - Bacterial sequence entries, part 18.
111. gbbct19.seq - Bacterial sequence entries, part 19.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct21.seq - Bacterial sequence entries, part 21.
115. gbbct22.seq - Bacterial sequence entries, part 22.
116. gbbct23.seq - Bacterial sequence entries, part 23.
117. gbbct24.seq - Bacterial sequence entries, part 24.
118. gbbct25.seq - Bacterial sequence entries, part 25.
119. gbbct26.seq - Bacterial sequence entries, part 26.
120. gbbct27.seq - Bacterial sequence entries, part 27.
121. gbbct28.seq - Bacterial sequence entries, part 28.
122. gbbct29.seq - Bacterial sequence entries, part 29.
123. gbbct3.seq - Bacterial sequence entries, part 3.
124. gbbct30.seq - Bacterial sequence entries, part 30.
125. gbbct31.seq - Bacterial sequence entries, part 31.
126. gbbct32.seq - Bacterial sequence entries, part 32.
127. gbbct33.seq - Bacterial sequence entries, part 33.
128. gbbct34.seq - Bacterial sequence entries, part 34.
129. gbbct35.seq - Bacterial sequence entries, part 35.
130. gbbct36.seq - Bacterial sequence entries, part 36.
131. gbbct37.seq - Bacterial sequence entries, part 37.
132. gbbct38.seq - Bacterial sequence entries, part 38.
133. gbbct39.seq - Bacterial sequence entries, part 39.
134. gbbct4.seq - Bacterial sequence entries, part 4.
135. gbbct40.seq - Bacterial sequence entries, part 40.
136. gbbct41.seq - Bacterial sequence entries, part 41.
137. gbbct42.seq - Bacterial sequence entries, part 42.
138. gbbct43.seq - Bacterial sequence entries, part 43.
139. gbbct44.seq - Bacterial sequence entries, part 44.
140. gbbct45.seq - Bacterial sequence entries, part 45.
141. gbbct46.seq - Bacterial sequence entries, part 46.
142. gbbct47.seq - Bacterial sequence entries, part 47.
143. gbbct48.seq - Bacterial sequence entries, part 48.
144. gbbct49.seq - Bacterial sequence entries, part 49.
145. gbbct5.seq - Bacterial sequence entries, part 5.
146. gbbct50.seq - Bacterial sequence entries, part 50.
147. gbbct51.seq - Bacterial sequence entries, part 51.
148. gbbct52.seq - Bacterial sequence entries, part 52.
149. gbbct53.seq - Bacterial sequence entries, part 53.
150. gbbct54.seq - Bacterial sequence entries, part 54.
151. gbbct55.seq - Bacterial sequence entries, part 55.
152. gbbct56.seq - Bacterial sequence entries, part 56.
153. gbbct57.seq - Bacterial sequence entries, part 57.
154. gbbct58.seq - Bacterial sequence entries, part 58.
155. gbbct59.seq - Bacterial sequence entries, part 59.
156. gbbct6.seq - Bacterial sequence entries, part 6.
157. gbbct60.seq - Bacterial sequence entries, part 60.
158. gbbct61.seq - Bacterial sequence entries, part 61.
159. gbbct62.seq - Bacterial sequence entries, part 62.
160. gbbct63.seq - Bacterial sequence entries, part 63.
161. gbbct64.seq - Bacterial sequence entries, part 64.
162. gbbct65.seq - Bacterial sequence entries, part 65.
163. gbbct66.seq - Bacterial sequence entries, part 66.
164. gbbct67.seq - Bacterial sequence entries, part 67.
165. gbbct68.seq - Bacterial sequence entries, part 68.
166. gbbct69.seq - Bacterial sequence entries, part 69.
167. gbbct7.seq - Bacterial sequence entries, part 7.
168. gbbct70.seq - Bacterial sequence entries, part 70.
169. gbbct71.seq - Bacterial sequence entries, part 71.
170. gbbct72.seq - Bacterial sequence entries, part 72.
171. gbbct73.seq - Bacterial sequence entries, part 73.
172. gbbct74.seq - Bacterial sequence entries, part 74.
173. gbbct75.seq - Bacterial sequence entries, part 75.
174. gbbct76.seq - Bacterial sequence entries, part 76.
175. gbbct77.seq - Bacterial sequence entries, part 77.
176. gbbct78.seq - Bacterial sequence entries, part 78.
177. gbbct79.seq - Bacterial sequence entries, part 79.
178. gbbct8.seq - Bacterial sequence entries, part 8.
179. gbbct80.seq - Bacterial sequence entries, part 80.
180. gbbct81.seq - Bacterial sequence entries, part 81.
181. gbbct82.seq - Bacterial sequence entries, part 82.
182. gbbct83.seq - Bacterial sequence entries, part 83.
183. gbbct84.seq - Bacterial sequence entries, part 84.
184. gbbct85.seq - Bacterial sequence entries, part 85.
185. gbbct9.seq - Bacterial sequence entries, part 9.
186. gbchg.txt - Accession numbers of entries updated since the previous release.
187. gbcon1.seq - Constructed sequence entries, part 1.
188. gbcon10.seq - Constructed sequence entries, part 10.
189. gbcon100.seq - Constructed sequence entries, part 100.
190. gbcon101.seq - Constructed sequence entries, part 101.
191. gbcon102.seq - Constructed sequence entries, part 102.
192. gbcon103.seq - Constructed sequence entries, part 103.
193. gbcon104.seq - Constructed sequence entries, part 104.
194. gbcon105.seq - Constructed sequence entries, part 105.
195. gbcon106.seq - Constructed sequence entries, part 106.
196. gbcon107.seq - Constructed sequence entries, part 107.
197. gbcon108.seq - Constructed sequence entries, part 108.
198. gbcon109.seq - Constructed sequence entries, part 109.
199. gbcon11.seq - Constructed sequence entries, part 11.
200. gbcon110.seq - Constructed sequence entries, part 110.
201. gbcon111.seq - Constructed sequence entries, part 111.
202. gbcon112.seq - Constructed sequence entries, part 112.
203. gbcon113.seq - Constructed sequence entries, part 113.
204. gbcon114.seq - Constructed sequence entries, part 114.
205. gbcon115.seq - Constructed sequence entries, part 115.
206. gbcon116.seq - Constructed sequence entries, part 116.
207. gbcon117.seq - Constructed sequence entries, part 117.
208. gbcon118.seq - Constructed sequence entries, part 118.
209. gbcon119.seq - Constructed sequence entries, part 119.
210. gbcon12.seq - Constructed sequence entries, part 12.
211. gbcon120.seq - Constructed sequence entries, part 120.
212. gbcon121.seq - Constructed sequence entries, part 121.
213. gbcon122.seq - Constructed sequence entries, part 122.
214. gbcon123.seq - Constructed sequence entries, part 123.
215. gbcon124.seq - Constructed sequence entries, part 124.
216. gbcon125.seq - Constructed sequence entries, part 125.
217. gbcon126.seq - Constructed sequence entries, part 126.
218. gbcon127.seq - Constructed sequence entries, part 127.
219. gbcon128.seq - Constructed sequence entries, part 128.
220. gbcon129.seq - Constructed sequence entries, part 129.
221. gbcon13.seq - Constructed sequence entries, part 13.
222. gbcon130.seq - Constructed sequence entries, part 130.
223. gbcon131.seq - Constructed sequence entries, part 131.
224. gbcon132.seq - Constructed sequence entries, part 132.
225. gbcon133.seq - Constructed sequence entries, part 133.
226. gbcon134.seq - Constructed sequence entries, part 134.
227. gbcon135.seq - Constructed sequence entries, part 135.
228. gbcon136.seq - Constructed sequence entries, part 136.
229. gbcon137.seq - Constructed sequence entries, part 137.
230. gbcon138.seq - Constructed sequence entries, part 138.
231. gbcon139.seq - Constructed sequence entries, part 139.
232. gbcon14.seq - Constructed sequence entries, part 14.
233. gbcon140.seq - Constructed sequence entries, part 140.
234. gbcon141.seq - Constructed sequence entries, part 141.
235. gbcon142.seq - Constructed sequence entries, part 142.
236. gbcon143.seq - Constructed sequence entries, part 143.
237. gbcon144.seq - Constructed sequence entries, part 144.
238. gbcon145.seq - Constructed sequence entries, part 145.
239. gbcon146.seq - Constructed sequence entries, part 146.
240. gbcon147.seq - Constructed sequence entries, part 147.
241. gbcon148.seq - Constructed sequence entries, part 148.
242. gbcon149.seq - Constructed sequence entries, part 149.
243. gbcon15.seq - Constructed sequence entries, part 15.
244. gbcon150.seq - Constructed sequence entries, part 150.
245. gbcon151.seq - Constructed sequence entries, part 151.
246. gbcon152.seq - Constructed sequence entries, part 152.
247. gbcon153.seq - Constructed sequence entries, part 153.
248. gbcon154.seq - Constructed sequence entries, part 154.
249. gbcon155.seq - Constructed sequence entries, part 155.
250. gbcon156.seq - Constructed sequence entries, part 156.
251. gbcon157.seq - Constructed sequence entries, part 157.
252. gbcon158.seq - Constructed sequence entries, part 158.
253. gbcon159.seq - Constructed sequence entries, part 159.
254. gbcon16.seq - Constructed sequence entries, part 16.
255. gbcon160.seq - Constructed sequence entries, part 160.
256. gbcon161.seq - Constructed sequence entries, part 161.
257. gbcon162.seq - Constructed sequence entries, part 162.
258. gbcon163.seq - Constructed sequence entries, part 163.
259. gbcon164.seq - Constructed sequence entries, part 164.
260. gbcon165.seq - Constructed sequence entries, part 165.
261. gbcon166.seq - Constructed sequence entries, part 166.
262. gbcon167.seq - Constructed sequence entries, part 167.
263. gbcon17.seq - Constructed sequence entries, part 17.
264. gbcon18.seq - Constructed sequence entries, part 18.
265. gbcon19.seq - Constructed sequence entries, part 19.
266. gbcon2.seq - Constructed sequence entries, part 2.
267. gbcon20.seq - Constructed sequence entries, part 20.
268. gbcon21.seq - Constructed sequence entries, part 21.
269. gbcon22.seq - Constructed sequence entries, part 22.
270. gbcon23.seq - Constructed sequence entries, part 23.
271. gbcon24.seq - Constructed sequence entries, part 24.
272. gbcon25.seq - Constructed sequence entries, part 25.
273. gbcon26.seq - Constructed sequence entries, part 26.
274. gbcon27.seq - Constructed sequence entries, part 27.
275. gbcon28.seq - Constructed sequence entries, part 28.
276. gbcon29.seq - Constructed sequence entries, part 29.
277. gbcon3.seq - Constructed sequence entries, part 3.
278. gbcon30.seq - Constructed sequence entries, part 30.
279. gbcon31.seq - Constructed sequence entries, part 31.
280. gbcon32.seq - Constructed sequence entries, part 32.
281. gbcon33.seq - Constructed sequence entries, part 33.
282. gbcon34.seq - Constructed sequence entries, part 34.
283. gbcon35.seq - Constructed sequence entries, part 35.
284. gbcon36.seq - Constructed sequence entries, part 36.
285. gbcon37.seq - Constructed sequence entries, part 37.
286. gbcon38.seq - Constructed sequence entries, part 38.
287. gbcon39.seq - Constructed sequence entries, part 39.
288. gbcon4.seq - Constructed sequence entries, part 4.
289. gbcon40.seq - Constructed sequence entries, part 40.
290. gbcon41.seq - Constructed sequence entries, part 41.
291. gbcon42.seq - Constructed sequence entries, part 42.
292. gbcon43.seq - Constructed sequence entries, part 43.
293. gbcon44.seq - Constructed sequence entries, part 44.
294. gbcon45.seq - Constructed sequence entries, part 45.
295. gbcon46.seq - Constructed sequence entries, part 46.
296. gbcon47.seq - Constructed sequence entries, part 47.
297. gbcon48.seq - Constructed sequence entries, part 48.
298. gbcon49.seq - Constructed sequence entries, part 49.
299. gbcon5.seq - Constructed sequence entries, part 5.
300. gbcon50.seq - Constructed sequence entries, part 50.
301. gbcon51.seq - Constructed sequence entries, part 51.
302. gbcon52.seq - Constructed sequence entries, part 52.
303. gbcon53.seq - Constructed sequence entries, part 53.
304. gbcon54.seq - Constructed sequence entries, part 54.
305. gbcon55.seq - Constructed sequence entries, part 55.
306. gbcon56.seq - Constructed sequence entries, part 56.
307. gbcon57.seq - Constructed sequence entries, part 57.
308. gbcon58.seq - Constructed sequence entries, part 58.
309. gbcon59.seq - Constructed sequence entries, part 59.
310. gbcon6.seq - Constructed sequence entries, part 6.
311. gbcon60.seq - Constructed sequence entries, part 60.
312. gbcon61.seq - Constructed sequence entries, part 61.
313. gbcon62.seq - Constructed sequence entries, part 62.
314. gbcon63.seq - Constructed sequence entries, part 63.
315. gbcon64.seq - Constructed sequence entries, part 64.
316. gbcon65.seq - Constructed sequence entries, part 65.
317. gbcon66.seq - Constructed sequence entries, part 66.
318. gbcon67.seq - Constructed sequence entries, part 67.
319. gbcon68.seq - Constructed sequence entries, part 68.
320. gbcon69.seq - Constructed sequence entries, part 69.
321. gbcon7.seq - Constructed sequence entries, part 7.
322. gbcon70.seq - Constructed sequence entries, part 70.
323. gbcon71.seq - Constructed sequence entries, part 71.
324. gbcon72.seq - Constructed sequence entries, part 72.
325. gbcon73.seq - Constructed sequence entries, part 73.
326. gbcon74.seq - Constructed sequence entries, part 74.
327. gbcon75.seq - Constructed sequence entries, part 75.
328. gbcon76.seq - Constructed sequence entries, part 76.
329. gbcon77.seq - Constructed sequence entries, part 77.
330. gbcon78.seq - Constructed sequence entries, part 78.
331. gbcon79.seq - Constructed sequence entries, part 79.
332. gbcon8.seq - Constructed sequence entries, part 8.
333. gbcon80.seq - Constructed sequence entries, part 80.
334. gbcon81.seq - Constructed sequence entries, part 81.
335. gbcon82.seq - Constructed sequence entries, part 82.
336. gbcon83.seq - Constructed sequence entries, part 83.
337. gbcon84.seq - Constructed sequence entries, part 84.
338. gbcon85.seq - Constructed sequence entries, part 85.
339. gbcon86.seq - Constructed sequence entries, part 86.
340. gbcon87.seq - Constructed sequence entries, part 87.
341. gbcon88.seq - Constructed sequence entries, part 88.
342. gbcon89.seq - Constructed sequence entries, part 89.
343. gbcon9.seq - Constructed sequence entries, part 9.
344. gbcon90.seq - Constructed sequence entries, part 90.
345. gbcon91.seq - Constructed sequence entries, part 91.
346. gbcon92.seq - Constructed sequence entries, part 92.
347. gbcon93.seq - Constructed sequence entries, part 93.
348. gbcon94.seq - Constructed sequence entries, part 94.
349. gbcon95.seq - Constructed sequence entries, part 95.
350. gbcon96.seq - Constructed sequence entries, part 96.
351. gbcon97.seq - Constructed sequence entries, part 97.
352. gbcon98.seq - Constructed sequence entries, part 98.
353. gbcon99.seq - Constructed sequence entries, part 99.
354. gbdel.txt - Accession numbers of entries deleted since the previous release.
355. gbenv1.seq - Environmental sampling sequence entries, part 1.
356. gbenv10.seq - Environmental sampling sequence entries, part 10.
357. gbenv11.seq - Environmental sampling sequence entries, part 11.
358. gbenv12.seq - Environmental sampling sequence entries, part 12.
359. gbenv13.seq - Environmental sampling sequence entries, part 13.
360. gbenv14.seq - Environmental sampling sequence entries, part 14.
361. gbenv15.seq - Environmental sampling sequence entries, part 15.
362. gbenv16.seq - Environmental sampling sequence entries, part 16.
363. gbenv17.seq - Environmental sampling sequence entries, part 17.
364. gbenv18.seq - Environmental sampling sequence entries, part 18.
365. gbenv19.seq - Environmental sampling sequence entries, part 19.
366. gbenv2.seq - Environmental sampling sequence entries, part 2.
367. gbenv20.seq - Environmental sampling sequence entries, part 20.
368. gbenv21.seq - Environmental sampling sequence entries, part 21.
369. gbenv22.seq - Environmental sampling sequence entries, part 22.
370. gbenv23.seq - Environmental sampling sequence entries, part 23.
371. gbenv24.seq - Environmental sampling sequence entries, part 24.
372. gbenv25.seq - Environmental sampling sequence entries, part 25.
373. gbenv26.seq - Environmental sampling sequence entries, part 26.
374. gbenv27.seq - Environmental sampling sequence entries, part 27.
375. gbenv28.seq - Environmental sampling sequence entries, part 28.
376. gbenv29.seq - Environmental sampling sequence entries, part 29.
377. gbenv3.seq - Environmental sampling sequence entries, part 3.
378. gbenv30.seq - Environmental sampling sequence entries, part 30.
379. gbenv31.seq - Environmental sampling sequence entries, part 31.
380. gbenv32.seq - Environmental sampling sequence entries, part 32.
381. gbenv33.seq - Environmental sampling sequence entries, part 33.
382. gbenv34.seq - Environmental sampling sequence entries, part 34.
383. gbenv35.seq - Environmental sampling sequence entries, part 35.
384. gbenv36.seq - Environmental sampling sequence entries, part 36.
385. gbenv37.seq - Environmental sampling sequence entries, part 37.
386. gbenv38.seq - Environmental sampling sequence entries, part 38.
387. gbenv39.seq - Environmental sampling sequence entries, part 39.
388. gbenv4.seq - Environmental sampling sequence entries, part 4.
389. gbenv40.seq - Environmental sampling sequence entries, part 40.
390. gbenv41.seq - Environmental sampling sequence entries, part 41.
391. gbenv42.seq - Environmental sampling sequence entries, part 42.
392. gbenv43.seq - Environmental sampling sequence entries, part 43.
393. gbenv44.seq - Environmental sampling sequence entries, part 44.
394. gbenv45.seq - Environmental sampling sequence entries, part 45.
395. gbenv46.seq - Environmental sampling sequence entries, part 46.
396. gbenv47.seq - Environmental sampling sequence entries, part 47.
397. gbenv48.seq - Environmental sampling sequence entries, part 48.
398. gbenv49.seq - Environmental sampling sequence entries, part 49.
399. gbenv5.seq - Environmental sampling sequence entries, part 5.
400. gbenv50.seq - Environmental sampling sequence entries, part 50.
401. gbenv51.seq - Environmental sampling sequence entries, part 51.
402. gbenv52.seq - Environmental sampling sequence entries, part 52.
403. gbenv53.seq - Environmental sampling sequence entries, part 53.
404. gbenv6.seq - Environmental sampling sequence entries, part 6.
405. gbenv7.seq - Environmental sampling sequence entries, part 7.
406. gbenv8.seq - Environmental sampling sequence entries, part 8.
407. gbenv9.seq - Environmental sampling sequence entries, part 9.
408. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
409. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
410. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
411. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
412. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
413. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
414. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
415. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
416. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
417. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
418. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
419. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
420. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
421. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
422. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
423. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
424. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
425. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
426. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
427. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
428. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
429. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
430. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
431. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
432. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
433. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
434. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
435. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
436. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
437. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
438. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
439. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
440. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
441. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
442. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
443. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
444. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
445. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
446. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
447. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
448. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
449. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
450. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
451. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
452. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
453. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
454. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
455. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
456. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
457. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
458. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
459. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
460. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
461. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
462. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
463. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
464. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
465. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
466. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
467. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
468. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
469. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
470. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
471. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
472. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
473. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
474. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
475. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
476. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
477. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
478. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
479. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
480. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
481. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
482. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
483. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
484. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
485. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
486. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
487. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
488. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
489. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
490. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
491. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
492. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
493. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
494. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
495. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
496. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
497. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
498. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
499. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
500. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
501. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
502. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
503. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
504. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
505. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
506. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
507. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
508. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
509. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
510. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
511. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
512. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
513. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
514. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
515. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
516. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
517. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
518. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
519. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
520. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
521. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
522. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
523. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
524. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
525. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
526. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
527. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
528. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
529. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
530. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
531. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
532. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
533. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
534. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
535. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
536. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
537. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
538. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
539. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
540. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
541. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
542. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
543. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
544. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
545. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
546. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
547. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
548. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
549. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
550. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
551. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
552. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
553. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
554. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
555. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
556. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
557. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
558. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
559. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
560. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
561. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
562. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
563. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
564. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
565. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
566. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
567. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
568. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
569. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
570. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
571. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
572. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
573. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
574. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
575. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
576. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
577. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
578. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
579. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
580. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
581. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
582. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
583. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
584. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
585. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
586. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
587. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
588. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
589. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
590. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
591. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
592. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
593. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
594. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
595. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
596. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
597. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
598. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
599. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
600. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
601. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
602. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
603. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
604. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
605. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
606. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
607. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
608. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
609. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
610. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
611. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
612. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
613. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
614. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
615. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
616. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
617. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
618. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
619. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
620. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
621. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
622. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
623. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
624. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
625. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
626. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
627. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
628. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
629. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
630. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
631. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
632. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
633. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
634. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
635. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
636. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
637. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
638. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
639. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
640. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
641. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
642. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
643. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
644. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
645. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
646. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
647. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
648. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
649. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
650. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
651. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
652. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
653. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
654. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
655. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
656. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
657. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
658. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
659. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
660. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
661. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
662. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
663. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
664. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
665. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
666. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
667. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
668. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
669. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
670. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
671. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
672. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
673. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
674. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
675. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
676. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
677. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
678. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
679. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
680. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
681. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
682. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
683. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
684. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
685. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
686. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
687. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
688. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
689. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
690. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
691. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
692. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
693. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
694. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
695. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
696. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
697. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
698. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
699. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
700. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
701. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
702. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
703. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
704. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
705. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
706. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
707. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
708. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
709. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
710. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
711. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
712. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
713. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
714. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
715. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
716. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
717. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
718. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
719. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
720. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
721. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
722. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
723. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
724. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
725. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
726. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
727. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
728. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
729. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
730. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
731. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
732. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
733. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
734. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
735. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
736. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
737. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
738. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
739. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
740. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
741. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
742. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
743. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
744. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
745. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
746. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
747. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
748. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
749. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
750. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
751. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
752. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
753. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
754. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
755. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
756. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
757. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
758. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
759. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
760. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
761. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
762. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
763. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
764. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
765. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
766. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
767. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
768. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
769. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
770. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
771. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
772. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
773. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
774. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
775. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
776. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
777. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
778. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
779. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
780. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
781. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
782. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
783. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
784. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
785. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
786. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
787. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
788. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
789. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
790. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
791. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
792. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
793. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
794. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
795. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
796. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
797. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
798. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
799. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
800. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
801. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
802. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
803. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
804. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
805. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
806. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
807. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
808. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
809. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
810. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
811. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
812. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
813. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
814. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
815. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
816. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
817. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
818. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
819. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
820. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
821. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
822. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
823. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
824. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
825. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
826. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
827. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
828. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
829. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
830. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
831. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
832. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
833. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
834. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
835. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
836. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
837. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
838. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
839. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
840. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
841. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
842. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
843. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
844. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
845. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
846. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
847. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
848. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
849. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
850. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
851. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
852. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
853. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
854. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
855. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
856. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
857. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
858. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
859. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
860. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
861. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
862. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
863. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
864. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
865. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
866. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
867. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
868. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
869. gbgen.idx - Index of the entries according to gene symbols.
870. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
871. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
872. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
873. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
874. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
875. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
876. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
877. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
878. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
879. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
880. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
881. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
882. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
883. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
884. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
885. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
886. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
887. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
888. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
889. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
890. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
891. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
892. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
893. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
894. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
895. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
896. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
897. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
898. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
899. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
900. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
901. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
902. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
903. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
904. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
905. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
906. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
907. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
908. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
909. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
910. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
911. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
912. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
913. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
914. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
915. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
916. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
917. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
918. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
919. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
920. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
921. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
922. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
923. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
924. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
925. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
926. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
927. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
928. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
929. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
930. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
931. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
932. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
933. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
934. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
935. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
936. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
937. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
938. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
939. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
940. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
941. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
942. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
943. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
944. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
945. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
946. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
947. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
948. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
949. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
950. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
951. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
952. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
953. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
954. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
955. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
956. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
957. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
958. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
959. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
960. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
961. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
962. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
963. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
964. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
965. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
966. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
967. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
968. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
969. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
970. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
971. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
972. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
973. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
974. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
975. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
976. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
977. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
978. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
979. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
980. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
981. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
982. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
983. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
984. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
985. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
986. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
987. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
988. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
989. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
990. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
991. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
992. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
993. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
994. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
995. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
996. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
997. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
998. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
999. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1000. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1001. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1002. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1003. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1004. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1005. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1006. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1007. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1008. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1009. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1010. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1011. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1012. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1013. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1014. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1015. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1016. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1017. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1018. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1019. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1020. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1021. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1022. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1023. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1024. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1025. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1026. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1027. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1028. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1029. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1030. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1031. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1032. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1033. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1034. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1035. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1036. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1037. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1038. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1039. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1040. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1041. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1042. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1043. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1044. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1045. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1046. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1047. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1048. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1049. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1050. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1051. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1052. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1053. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1054. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1055. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1056. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1057. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1058. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1059. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1060. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1061. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1062. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1063. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1064. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1065. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1066. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1067. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1068. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1069. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1070. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1071. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1072. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1073. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1074. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1075. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1076. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1077. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1078. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1079. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1080. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1081. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1082. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1083. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1084. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1085. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1086. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1087. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1088. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1089. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1090. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1091. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1092. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1093. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1094. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1095. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1096. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1097. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1098. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1099. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1100. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1101. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1102. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1103. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1104. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1105. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1106. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1107. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1108. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1109. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1110. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1111. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1112. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1113. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1114. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1115. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1116. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1117. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1118. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1119. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1120. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1121. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1122. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1123. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1124. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1125. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1126. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1127. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1128. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1129. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1130. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1131. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1132. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1133. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1134. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1135. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1136. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1137. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1138. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1139. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1140. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1141. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1142. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1143. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1144. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1145. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1146. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1147. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1148. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1149. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1150. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1151. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1152. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1153. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1154. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1155. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1156. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1157. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1158. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1159. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1160. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1161. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1162. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1163. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1164. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1165. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1166. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1167. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1168. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1169. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1170. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1171. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1172. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1173. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1174. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1175. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1176. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1177. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1178. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1179. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1180. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1181. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1182. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1183. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1184. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1185. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1186. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1187. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1188. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1189. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1190. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1191. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1192. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1193. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1194. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1195. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1196. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1197. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1198. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1199. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1200. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1201. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1202. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1203. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1204. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1205. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1206. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1207. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1208. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1209. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1210. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1211. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1212. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1213. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1214. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1215. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1216. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1217. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1218. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1219. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1220. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1221. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1222. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1223. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1224. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1225. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1226. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1227. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1228. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1229. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1230. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1231. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1232. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1233. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1234. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1235. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1236. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1237. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1238. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1239. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1240. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1241. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1242. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1243. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1244. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1245. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1246. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1247. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1248. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1249. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1250. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1251. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1252. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1253. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1254. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1255. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1256. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1257. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1258. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1259. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1260. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1261. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1262. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1263. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1264. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1265. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1266. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1267. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1268. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1269. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1270. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1271. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1272. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1273. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1274. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1275. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1276. gbinv1.seq - Invertebrate sequence entries, part 1.
1277. gbinv10.seq - Invertebrate sequence entries, part 10.
1278. gbinv11.seq - Invertebrate sequence entries, part 11.
1279. gbinv12.seq - Invertebrate sequence entries, part 12.
1280. gbinv13.seq - Invertebrate sequence entries, part 13.
1281. gbinv14.seq - Invertebrate sequence entries, part 14.
1282. gbinv15.seq - Invertebrate sequence entries, part 15.
1283. gbinv16.seq - Invertebrate sequence entries, part 16.
1284. gbinv17.seq - Invertebrate sequence entries, part 17.
1285. gbinv18.seq - Invertebrate sequence entries, part 18.
1286. gbinv19.seq - Invertebrate sequence entries, part 19.
1287. gbinv2.seq - Invertebrate sequence entries, part 2.
1288. gbinv20.seq - Invertebrate sequence entries, part 20.
1289. gbinv21.seq - Invertebrate sequence entries, part 21.
1290. gbinv22.seq - Invertebrate sequence entries, part 22.
1291. gbinv23.seq - Invertebrate sequence entries, part 23.
1292. gbinv24.seq - Invertebrate sequence entries, part 24.
1293. gbinv25.seq - Invertebrate sequence entries, part 25.
1294. gbinv26.seq - Invertebrate sequence entries, part 26.
1295. gbinv27.seq - Invertebrate sequence entries, part 27.
1296. gbinv28.seq - Invertebrate sequence entries, part 28.
1297. gbinv29.seq - Invertebrate sequence entries, part 29.
1298. gbinv3.seq - Invertebrate sequence entries, part 3.
1299. gbinv30.seq - Invertebrate sequence entries, part 30.
1300. gbinv4.seq - Invertebrate sequence entries, part 4.
1301. gbinv5.seq - Invertebrate sequence entries, part 5.
1302. gbinv6.seq - Invertebrate sequence entries, part 6.
1303. gbinv7.seq - Invertebrate sequence entries, part 7.
1304. gbinv8.seq - Invertebrate sequence entries, part 8.
1305. gbinv9.seq - Invertebrate sequence entries, part 9.
1306. gbjou1.idx - Index of the entries according to journal citation, part 1.
1307. gbjou10.idx - Index of the entries according to journal citation, part 10.
1308. gbjou11.idx - Index of the entries according to journal citation, part 11.
1309. gbjou12.idx - Index of the entries according to journal citation, part 12.
1310. gbjou13.idx - Index of the entries according to journal citation, part 13.
1311. gbjou2.idx - Index of the entries according to journal citation, part 2.
1312. gbjou3.idx - Index of the entries according to journal citation, part 3.
1313. gbjou4.idx - Index of the entries according to journal citation, part 4.
1314. gbjou5.idx - Index of the entries according to journal citation, part 5.
1315. gbjou6.idx - Index of the entries according to journal citation, part 6.
1316. gbjou7.idx - Index of the entries according to journal citation, part 7.
1317. gbjou8.idx - Index of the entries according to journal citation, part 8.
1318. gbjou9.idx - Index of the entries according to journal citation, part 9.
1319. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1320. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1321. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1322. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1323. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1324. gbkey6.idx - Index of the entries according to keyword phrase, part 6.
1325. gbmam1.seq - Other mammalian sequence entries, part 1.
1326. gbmam2.seq - Other mammalian sequence entries, part 2.
1327. gbmam3.seq - Other mammalian sequence entries, part 3.
1328. gbmam4.seq - Other mammalian sequence entries, part 4.
1329. gbmam5.seq - Other mammalian sequence entries, part 5.
1330. gbmam6.seq - Other mammalian sequence entries, part 6.
1331. gbmam7.seq - Other mammalian sequence entries, part 7.
1332. gbmam8.seq - Other mammalian sequence entries, part 8.
1333. gbnew.txt - Accession numbers of entries new since the previous release.
1334. gbpat1.seq - Patent sequence entries, part 1.
1335. gbpat10.seq - Patent sequence entries, part 10.
1336. gbpat100.seq - Patent sequence entries, part 100.
1337. gbpat101.seq - Patent sequence entries, part 101.
1338. gbpat102.seq - Patent sequence entries, part 102.
1339. gbpat103.seq - Patent sequence entries, part 103.
1340. gbpat104.seq - Patent sequence entries, part 104.
1341. gbpat105.seq - Patent sequence entries, part 105.
1342. gbpat106.seq - Patent sequence entries, part 106.
1343. gbpat107.seq - Patent sequence entries, part 107.
1344. gbpat108.seq - Patent sequence entries, part 108.
1345. gbpat109.seq - Patent sequence entries, part 109.
1346. gbpat11.seq - Patent sequence entries, part 11.
1347. gbpat110.seq - Patent sequence entries, part 110.
1348. gbpat111.seq - Patent sequence entries, part 111.
1349. gbpat112.seq - Patent sequence entries, part 112.
1350. gbpat113.seq - Patent sequence entries, part 113.
1351. gbpat114.seq - Patent sequence entries, part 114.
1352. gbpat115.seq - Patent sequence entries, part 115.
1353. gbpat116.seq - Patent sequence entries, part 116.
1354. gbpat117.seq - Patent sequence entries, part 117.
1355. gbpat118.seq - Patent sequence entries, part 118.
1356. gbpat119.seq - Patent sequence entries, part 119.
1357. gbpat12.seq - Patent sequence entries, part 12.
1358. gbpat120.seq - Patent sequence entries, part 120.
1359. gbpat121.seq - Patent sequence entries, part 121.
1360. gbpat122.seq - Patent sequence entries, part 122.
1361. gbpat123.seq - Patent sequence entries, part 123.
1362. gbpat124.seq - Patent sequence entries, part 124.
1363. gbpat125.seq - Patent sequence entries, part 125.
1364. gbpat126.seq - Patent sequence entries, part 126.
1365. gbpat127.seq - Patent sequence entries, part 127.
1366. gbpat128.seq - Patent sequence entries, part 128.
1367. gbpat129.seq - Patent sequence entries, part 129.
1368. gbpat13.seq - Patent sequence entries, part 13.
1369. gbpat130.seq - Patent sequence entries, part 130.
1370. gbpat131.seq - Patent sequence entries, part 131.
1371. gbpat132.seq - Patent sequence entries, part 132.
1372. gbpat133.seq - Patent sequence entries, part 133.
1373. gbpat134.seq - Patent sequence entries, part 134.
1374. gbpat135.seq - Patent sequence entries, part 135.
1375. gbpat136.seq - Patent sequence entries, part 136.
1376. gbpat137.seq - Patent sequence entries, part 137.
1377. gbpat138.seq - Patent sequence entries, part 138.
1378. gbpat139.seq - Patent sequence entries, part 139.
1379. gbpat14.seq - Patent sequence entries, part 14.
1380. gbpat140.seq - Patent sequence entries, part 140.
1381. gbpat141.seq - Patent sequence entries, part 141.
1382. gbpat142.seq - Patent sequence entries, part 142.
1383. gbpat143.seq - Patent sequence entries, part 143.
1384. gbpat144.seq - Patent sequence entries, part 144.
1385. gbpat145.seq - Patent sequence entries, part 145.
1386. gbpat146.seq - Patent sequence entries, part 146.
1387. gbpat147.seq - Patent sequence entries, part 147.
1388. gbpat148.seq - Patent sequence entries, part 148.
1389. gbpat149.seq - Patent sequence entries, part 149.
1390. gbpat15.seq - Patent sequence entries, part 15.
1391. gbpat150.seq - Patent sequence entries, part 150.
1392. gbpat151.seq - Patent sequence entries, part 151.
1393. gbpat152.seq - Patent sequence entries, part 152.
1394. gbpat153.seq - Patent sequence entries, part 153.
1395. gbpat154.seq - Patent sequence entries, part 154.
1396. gbpat155.seq - Patent sequence entries, part 155.
1397. gbpat156.seq - Patent sequence entries, part 156.
1398. gbpat157.seq - Patent sequence entries, part 157.
1399. gbpat158.seq - Patent sequence entries, part 158.
1400. gbpat159.seq - Patent sequence entries, part 159.
1401. gbpat16.seq - Patent sequence entries, part 16.
1402. gbpat160.seq - Patent sequence entries, part 160.
1403. gbpat161.seq - Patent sequence entries, part 161.
1404. gbpat162.seq - Patent sequence entries, part 162.
1405. gbpat163.seq - Patent sequence entries, part 163.
1406. gbpat164.seq - Patent sequence entries, part 164.
1407. gbpat165.seq - Patent sequence entries, part 165.
1408. gbpat166.seq - Patent sequence entries, part 166.
1409. gbpat167.seq - Patent sequence entries, part 167.
1410. gbpat168.seq - Patent sequence entries, part 168.
1411. gbpat169.seq - Patent sequence entries, part 169.
1412. gbpat17.seq - Patent sequence entries, part 17.
1413. gbpat170.seq - Patent sequence entries, part 170.
1414. gbpat171.seq - Patent sequence entries, part 171.
1415. gbpat172.seq - Patent sequence entries, part 172.
1416. gbpat173.seq - Patent sequence entries, part 173.
1417. gbpat174.seq - Patent sequence entries, part 174.
1418. gbpat175.seq - Patent sequence entries, part 175.
1419. gbpat176.seq - Patent sequence entries, part 176.
1420. gbpat177.seq - Patent sequence entries, part 177.
1421. gbpat178.seq - Patent sequence entries, part 178.
1422. gbpat18.seq - Patent sequence entries, part 18.
1423. gbpat19.seq - Patent sequence entries, part 19.
1424. gbpat2.seq - Patent sequence entries, part 2.
1425. gbpat20.seq - Patent sequence entries, part 20.
1426. gbpat21.seq - Patent sequence entries, part 21.
1427. gbpat22.seq - Patent sequence entries, part 22.
1428. gbpat23.seq - Patent sequence entries, part 23.
1429. gbpat24.seq - Patent sequence entries, part 24.
1430. gbpat25.seq - Patent sequence entries, part 25.
1431. gbpat26.seq - Patent sequence entries, part 26.
1432. gbpat27.seq - Patent sequence entries, part 27.
1433. gbpat28.seq - Patent sequence entries, part 28.
1434. gbpat29.seq - Patent sequence entries, part 29.
1435. gbpat3.seq - Patent sequence entries, part 3.
1436. gbpat30.seq - Patent sequence entries, part 30.
1437. gbpat31.seq - Patent sequence entries, part 31.
1438. gbpat32.seq - Patent sequence entries, part 32.
1439. gbpat33.seq - Patent sequence entries, part 33.
1440. gbpat34.seq - Patent sequence entries, part 34.
1441. gbpat35.seq - Patent sequence entries, part 35.
1442. gbpat36.seq - Patent sequence entries, part 36.
1443. gbpat37.seq - Patent sequence entries, part 37.
1444. gbpat38.seq - Patent sequence entries, part 38.
1445. gbpat39.seq - Patent sequence entries, part 39.
1446. gbpat4.seq - Patent sequence entries, part 4.
1447. gbpat40.seq - Patent sequence entries, part 40.
1448. gbpat41.seq - Patent sequence entries, part 41.
1449. gbpat42.seq - Patent sequence entries, part 42.
1450. gbpat43.seq - Patent sequence entries, part 43.
1451. gbpat44.seq - Patent sequence entries, part 44.
1452. gbpat45.seq - Patent sequence entries, part 45.
1453. gbpat46.seq - Patent sequence entries, part 46.
1454. gbpat47.seq - Patent sequence entries, part 47.
1455. gbpat48.seq - Patent sequence entries, part 48.
1456. gbpat49.seq - Patent sequence entries, part 49.
1457. gbpat5.seq - Patent sequence entries, part 5.
1458. gbpat50.seq - Patent sequence entries, part 50.
1459. gbpat51.seq - Patent sequence entries, part 51.
1460. gbpat52.seq - Patent sequence entries, part 52.
1461. gbpat53.seq - Patent sequence entries, part 53.
1462. gbpat54.seq - Patent sequence entries, part 54.
1463. gbpat55.seq - Patent sequence entries, part 55.
1464. gbpat56.seq - Patent sequence entries, part 56.
1465. gbpat57.seq - Patent sequence entries, part 57.
1466. gbpat58.seq - Patent sequence entries, part 58.
1467. gbpat59.seq - Patent sequence entries, part 59.
1468. gbpat6.seq - Patent sequence entries, part 6.
1469. gbpat60.seq - Patent sequence entries, part 60.
1470. gbpat61.seq - Patent sequence entries, part 61.
1471. gbpat62.seq - Patent sequence entries, part 62.
1472. gbpat63.seq - Patent sequence entries, part 63.
1473. gbpat64.seq - Patent sequence entries, part 64.
1474. gbpat65.seq - Patent sequence entries, part 65.
1475. gbpat66.seq - Patent sequence entries, part 66.
1476. gbpat67.seq - Patent sequence entries, part 67.
1477. gbpat68.seq - Patent sequence entries, part 68.
1478. gbpat69.seq - Patent sequence entries, part 69.
1479. gbpat7.seq - Patent sequence entries, part 7.
1480. gbpat70.seq - Patent sequence entries, part 70.
1481. gbpat71.seq - Patent sequence entries, part 71.
1482. gbpat72.seq - Patent sequence entries, part 72.
1483. gbpat73.seq - Patent sequence entries, part 73.
1484. gbpat74.seq - Patent sequence entries, part 74.
1485. gbpat75.seq - Patent sequence entries, part 75.
1486. gbpat76.seq - Patent sequence entries, part 76.
1487. gbpat77.seq - Patent sequence entries, part 77.
1488. gbpat78.seq - Patent sequence entries, part 78.
1489. gbpat79.seq - Patent sequence entries, part 79.
1490. gbpat8.seq - Patent sequence entries, part 8.
1491. gbpat80.seq - Patent sequence entries, part 80.
1492. gbpat81.seq - Patent sequence entries, part 81.
1493. gbpat82.seq - Patent sequence entries, part 82.
1494. gbpat83.seq - Patent sequence entries, part 83.
1495. gbpat84.seq - Patent sequence entries, part 84.
1496. gbpat85.seq - Patent sequence entries, part 85.
1497. gbpat86.seq - Patent sequence entries, part 86.
1498. gbpat87.seq - Patent sequence entries, part 87.
1499. gbpat88.seq - Patent sequence entries, part 88.
1500. gbpat89.seq - Patent sequence entries, part 89.
1501. gbpat9.seq - Patent sequence entries, part 9.
1502. gbpat90.seq - Patent sequence entries, part 90.
1503. gbpat91.seq - Patent sequence entries, part 91.
1504. gbpat92.seq - Patent sequence entries, part 92.
1505. gbpat93.seq - Patent sequence entries, part 93.
1506. gbpat94.seq - Patent sequence entries, part 94.
1507. gbpat95.seq - Patent sequence entries, part 95.
1508. gbpat96.seq - Patent sequence entries, part 96.
1509. gbpat97.seq - Patent sequence entries, part 97.
1510. gbpat98.seq - Patent sequence entries, part 98.
1511. gbpat99.seq - Patent sequence entries, part 99.
1512. gbphg1.seq - Phage sequence entries, part 1.
1513. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1514. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1515. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1516. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1517. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1518. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1519. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1520. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1521. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1522. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1523. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1524. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1525. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1526. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1527. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1528. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1529. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1530. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1531. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1532. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1533. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1534. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1535. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1536. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1537. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1538. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1539. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1540. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1541. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1542. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1543. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1544. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1545. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1546. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1547. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1548. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1549. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1550. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1551. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1552. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1553. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1554. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1555. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1556. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1557. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1558. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1559. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1560. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1561. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
1562. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
1563. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
1564. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1565. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1566. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1567. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1568. gbpri1.seq - Primate sequence entries, part 1.
1569. gbpri10.seq - Primate sequence entries, part 10.
1570. gbpri11.seq - Primate sequence entries, part 11.
1571. gbpri12.seq - Primate sequence entries, part 12.
1572. gbpri13.seq - Primate sequence entries, part 13.
1573. gbpri14.seq - Primate sequence entries, part 14.
1574. gbpri15.seq - Primate sequence entries, part 15.
1575. gbpri16.seq - Primate sequence entries, part 16.
1576. gbpri17.seq - Primate sequence entries, part 17.
1577. gbpri18.seq - Primate sequence entries, part 18.
1578. gbpri19.seq - Primate sequence entries, part 19.
1579. gbpri2.seq - Primate sequence entries, part 2.
1580. gbpri20.seq - Primate sequence entries, part 20.
1581. gbpri21.seq - Primate sequence entries, part 21.
1582. gbpri22.seq - Primate sequence entries, part 22.
1583. gbpri23.seq - Primate sequence entries, part 23.
1584. gbpri24.seq - Primate sequence entries, part 24.
1585. gbpri25.seq - Primate sequence entries, part 25.
1586. gbpri26.seq - Primate sequence entries, part 26.
1587. gbpri27.seq - Primate sequence entries, part 27.
1588. gbpri28.seq - Primate sequence entries, part 28.
1589. gbpri29.seq - Primate sequence entries, part 29.
1590. gbpri3.seq - Primate sequence entries, part 3.
1591. gbpri30.seq - Primate sequence entries, part 30.
1592. gbpri31.seq - Primate sequence entries, part 31.
1593. gbpri32.seq - Primate sequence entries, part 32.
1594. gbpri33.seq - Primate sequence entries, part 33.
1595. gbpri34.seq - Primate sequence entries, part 34.
1596. gbpri35.seq - Primate sequence entries, part 35.
1597. gbpri36.seq - Primate sequence entries, part 36.
1598. gbpri37.seq - Primate sequence entries, part 37.
1599. gbpri38.seq - Primate sequence entries, part 38.
1600. gbpri39.seq - Primate sequence entries, part 39.
1601. gbpri4.seq - Primate sequence entries, part 4.
1602. gbpri40.seq - Primate sequence entries, part 40.
1603. gbpri41.seq - Primate sequence entries, part 41.
1604. gbpri42.seq - Primate sequence entries, part 42.
1605. gbpri43.seq - Primate sequence entries, part 43.
1606. gbpri44.seq - Primate sequence entries, part 44.
1607. gbpri45.seq - Primate sequence entries, part 45.
1608. gbpri5.seq - Primate sequence entries, part 5.
1609. gbpri6.seq - Primate sequence entries, part 6.
1610. gbpri7.seq - Primate sequence entries, part 7.
1611. gbpri8.seq - Primate sequence entries, part 8.
1612. gbpri9.seq - Primate sequence entries, part 9.
1613. gbrel.txt - Release notes (this document).
1614. gbrod1.seq - Rodent sequence entries, part 1.
1615. gbrod10.seq - Rodent sequence entries, part 10.
1616. gbrod11.seq - Rodent sequence entries, part 11.
1617. gbrod12.seq - Rodent sequence entries, part 12.
1618. gbrod13.seq - Rodent sequence entries, part 13.
1619. gbrod14.seq - Rodent sequence entries, part 14.
1620. gbrod15.seq - Rodent sequence entries, part 15.
1621. gbrod16.seq - Rodent sequence entries, part 16.
1622. gbrod17.seq - Rodent sequence entries, part 17.
1623. gbrod18.seq - Rodent sequence entries, part 18.
1624. gbrod19.seq - Rodent sequence entries, part 19.
1625. gbrod2.seq - Rodent sequence entries, part 2.
1626. gbrod20.seq - Rodent sequence entries, part 20.
1627. gbrod21.seq - Rodent sequence entries, part 21.
1628. gbrod22.seq - Rodent sequence entries, part 22.
1629. gbrod23.seq - Rodent sequence entries, part 23.
1630. gbrod24.seq - Rodent sequence entries, part 24.
1631. gbrod25.seq - Rodent sequence entries, part 25.
1632. gbrod26.seq - Rodent sequence entries, part 26.
1633. gbrod27.seq - Rodent sequence entries, part 27.
1634. gbrod28.seq - Rodent sequence entries, part 28.
1635. gbrod29.seq - Rodent sequence entries, part 29.
1636. gbrod3.seq - Rodent sequence entries, part 3.
1637. gbrod4.seq - Rodent sequence entries, part 4.
1638. gbrod5.seq - Rodent sequence entries, part 5.
1639. gbrod6.seq - Rodent sequence entries, part 6.
1640. gbrod7.seq - Rodent sequence entries, part 7.
1641. gbrod8.seq - Rodent sequence entries, part 8.
1642. gbrod9.seq - Rodent sequence entries, part 9.
1643. gbsdr1.txt - Short directory of the data bank, part 1.
1644. gbsdr2.txt - Short directory of the data bank, part 2.
1645. gbsdr3.txt - Short directory of the data bank, part 3.
1646. gbsec.idx - Index of the entries according to secondary accession number.
1647. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1648. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1649. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1650. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1651. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1652. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1653. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1654. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1655. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1656. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1657. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1658. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1659. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1660. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1661. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1662. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1663. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1664. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1665. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1666. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1667. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1668. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1669. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1670. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
1671. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
1672. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
1673. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
1674. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1675. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1676. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1677. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1678. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1679. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1680. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1681. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1682. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1683. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1684. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1685. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1686. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1687. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1688. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1689. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1690. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1691. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1692. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1693. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1694. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1695. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1696. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1697. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1698. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
1699. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
1700. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
1701. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
1702. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
1703. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
1704. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
1705. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
1706. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
1707. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1708. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
1709. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
1710. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
1711. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
1712. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
1713. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
1714. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
1715. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
1716. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
1717. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
1718. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1719. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
1720. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
1721. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
1722. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
1723. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
1724. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
1725. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
1726. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
1727. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
1728. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
1729. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1730. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
1731. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
1732. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
1733. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
1734. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
1735. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
1736. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
1737. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
1738. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
1739. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
1740. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1741. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
1742. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1743. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1744. gbuna1.seq - Unannotated sequence entries, part 1.
1745. gbvrl1.seq - Viral sequence entries, part 1.
1746. gbvrl10.seq - Viral sequence entries, part 10.
1747. gbvrl11.seq - Viral sequence entries, part 11.
1748. gbvrl12.seq - Viral sequence entries, part 12.
1749. gbvrl13.seq - Viral sequence entries, part 13.
1750. gbvrl14.seq - Viral sequence entries, part 14.
1751. gbvrl15.seq - Viral sequence entries, part 15.
1752. gbvrl16.seq - Viral sequence entries, part 16.
1753. gbvrl17.seq - Viral sequence entries, part 17.
1754. gbvrl18.seq - Viral sequence entries, part 18.
1755. gbvrl19.seq - Viral sequence entries, part 19.
1756. gbvrl2.seq - Viral sequence entries, part 2.
1757. gbvrl20.seq - Viral sequence entries, part 20.
1758. gbvrl3.seq - Viral sequence entries, part 3.
1759. gbvrl4.seq - Viral sequence entries, part 4.
1760. gbvrl5.seq - Viral sequence entries, part 5.
1761. gbvrl6.seq - Viral sequence entries, part 6.
1762. gbvrl7.seq - Viral sequence entries, part 7.
1763. gbvrl8.seq - Viral sequence entries, part 8.
1764. gbvrl9.seq - Viral sequence entries, part 9.
1765. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1766. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1767. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1768. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1769. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1770. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1771. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1772. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1773. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1774. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1775. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1776. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1777. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1778. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1779. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1780. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1781. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1782. gbvrt25.seq - Other vertebrate sequence entries, part 25.
1783. gbvrt26.seq - Other vertebrate sequence entries, part 26.
1784. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1785. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1786. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1787. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1788. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1789. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1790. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 189.0 flatfiles require roughly 545 GB (sequence
files only) or 586 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1992103018 gbacc1.idx
2393141685 gbacc2.idx
845916231 gbacc3.idx
183987859 gbaut1.idx
186090645 gbaut10.idx
186060262 gbaut11.idx
184271344 gbaut12.idx
250584891 gbaut13.idx
183902984 gbaut14.idx
186755583 gbaut15.idx
188375618 gbaut16.idx
234847560 gbaut17.idx
187030523 gbaut18.idx
188907466 gbaut19.idx
247761002 gbaut2.idx
185023067 gbaut20.idx
250122200 gbaut21.idx
230209356 gbaut22.idx
187695199 gbaut23.idx
188782709 gbaut24.idx
201508914 gbaut25.idx
241060510 gbaut26.idx
185843220 gbaut27.idx
184606016 gbaut28.idx
184077621 gbaut29.idx
220840469 gbaut3.idx
183955073 gbaut30.idx
184001803 gbaut31.idx
184524119 gbaut32.idx
185845670 gbaut33.idx
183800094 gbaut34.idx
207855256 gbaut35.idx
188655558 gbaut36.idx
183938245 gbaut37.idx
192847440 gbaut38.idx
183970959 gbaut39.idx
183950020 gbaut4.idx
183893885 gbaut40.idx
183948601 gbaut41.idx
185960623 gbaut42.idx
185541308 gbaut43.idx
192412762 gbaut44.idx
250820422 gbaut45.idx
207504576 gbaut46.idx
188755028 gbaut47.idx
199158863 gbaut48.idx
190385798 gbaut49.idx
243347491 gbaut5.idx
202993617 gbaut50.idx
232486458 gbaut51.idx
186869098 gbaut52.idx
184287318 gbaut53.idx
183898075 gbaut54.idx
184025803 gbaut55.idx
185823112 gbaut56.idx
224055967 gbaut57.idx
186047565 gbaut58.idx
185212585 gbaut59.idx
200283326 gbaut6.idx
184042509 gbaut60.idx
185688569 gbaut61.idx
183860697 gbaut62.idx
188071738 gbaut63.idx
185804331 gbaut64.idx
240069295 gbaut65.idx
189901689 gbaut66.idx
185254279 gbaut67.idx
186019011 gbaut68.idx
183940699 gbaut69.idx
184148093 gbaut7.idx
184788998 gbaut70.idx
186493825 gbaut71.idx
187137281 gbaut72.idx
184694322 gbaut73.idx
186255499 gbaut74.idx
187741906 gbaut75.idx
185954406 gbaut76.idx
219719889 gbaut77.idx
184673368 gbaut78.idx
185346028 gbaut79.idx
188537898 gbaut8.idx
191861059 gbaut80.idx
183904094 gbaut81.idx
184524770 gbaut82.idx
184294509 gbaut83.idx
184509475 gbaut84.idx
244979657 gbaut85.idx
184956702 gbaut86.idx
185149283 gbaut87.idx
183788052 gbaut88.idx
185617183 gbaut89.idx
196458144 gbaut9.idx
184412369 gbaut90.idx
194570681 gbaut91.idx
184651361 gbaut92.idx
183863734 gbaut93.idx
209997120 gbaut94.idx
183952573 gbaut95.idx
187119204 gbaut96.idx
31809183 gbaut97.idx
249999222 gbbct1.seq
244870852 gbbct10.seq
244613667 gbbct11.seq
236598271 gbbct12.seq
250000111 gbbct13.seq
30699010 gbbct14.seq
243165286 gbbct15.seq
249783326 gbbct16.seq
245551992 gbbct17.seq
248628765 gbbct18.seq
248242091 gbbct19.seq
245372753 gbbct2.seq
249281961 gbbct20.seq
246198630 gbbct21.seq
245693356 gbbct22.seq
217806784 gbbct23.seq
242803771 gbbct24.seq
241840999 gbbct25.seq
248677048 gbbct26.seq
247875345 gbbct27.seq
249388245 gbbct28.seq
244185977 gbbct29.seq
247570684 gbbct3.seq
247336992 gbbct30.seq
249996799 gbbct31.seq
249761445 gbbct32.seq
249790948 gbbct33.seq
242886336 gbbct34.seq
241625881 gbbct35.seq
160068904 gbbct36.seq
243880501 gbbct37.seq
246111304 gbbct38.seq
242768074 gbbct39.seq
241184574 gbbct4.seq
239636196 gbbct40.seq
247210305 gbbct41.seq
246790666 gbbct42.seq
245870812 gbbct43.seq
244913595 gbbct44.seq
248036754 gbbct45.seq
248281460 gbbct46.seq
241195587 gbbct47.seq
162003991 gbbct48.seq
249923106 gbbct49.seq
213978084 gbbct5.seq
247105195 gbbct50.seq
241662934 gbbct51.seq
245557638 gbbct52.seq
246292986 gbbct53.seq
246413424 gbbct54.seq
249774041 gbbct55.seq
247796112 gbbct56.seq
248838160 gbbct57.seq
244464112 gbbct58.seq
243118318 gbbct59.seq
242133044 gbbct6.seq
198928158 gbbct60.seq
245006659 gbbct61.seq
247398154 gbbct62.seq
249964013 gbbct63.seq
246718647 gbbct64.seq
145949622 gbbct65.seq
6887681 gbbct66.seq
14096568 gbbct67.seq
23201077 gbbct68.seq
45100970 gbbct69.seq
248056375 gbbct7.seq
87782672 gbbct70.seq
170071264 gbbct71.seq
249999413 gbbct72.seq
249998793 gbbct73.seq
243633457 gbbct74.seq
249784623 gbbct75.seq
241414051 gbbct76.seq
247359815 gbbct77.seq
249997476 gbbct78.seq
249773683 gbbct79.seq
247183485 gbbct8.seq
78703112 gbbct80.seq
249769426 gbbct81.seq
249999929 gbbct82.seq
249997613 gbbct83.seq
249995007 gbbct84.seq
112611248 gbbct85.seq
245011144 gbbct9.seq
12439594 gbchg.txt
249998437 gbcon1.seq
249997306 gbcon10.seq
249994223 gbcon100.seq
249995660 gbcon101.seq
249998605 gbcon102.seq
249998936 gbcon103.seq
250000223 gbcon104.seq
156342446 gbcon105.seq
249996812 gbcon106.seq
249993767 gbcon107.seq
249992301 gbcon108.seq
249998322 gbcon109.seq
249367269 gbcon11.seq
71615782 gbcon110.seq
212826019 gbcon111.seq
250000256 gbcon112.seq
250000098 gbcon113.seq
249995503 gbcon114.seq
249983740 gbcon115.seq
109734089 gbcon116.seq
249914315 gbcon117.seq
249999105 gbcon118.seq
180025678 gbcon119.seq
248928386 gbcon12.seq
249997285 gbcon120.seq
250000198 gbcon121.seq
249998745 gbcon122.seq
222475340 gbcon123.seq
248981147 gbcon124.seq
249952905 gbcon125.seq
249856157 gbcon126.seq
249994853 gbcon127.seq
249998775 gbcon128.seq
249998332 gbcon129.seq
249414427 gbcon13.seq
26893749 gbcon130.seq
249978699 gbcon131.seq
249998490 gbcon132.seq
249993348 gbcon133.seq
249999880 gbcon134.seq
249912502 gbcon135.seq
249948624 gbcon136.seq
249955490 gbcon137.seq
233498612 gbcon138.seq
246632492 gbcon139.seq
249998181 gbcon14.seq
247088480 gbcon140.seq
249512645 gbcon141.seq
249992268 gbcon142.seq
108787033 gbcon143.seq
249998195 gbcon144.seq
249695087 gbcon145.seq
249996033 gbcon146.seq
249963114 gbcon147.seq
250000246 gbcon148.seq
249792074 gbcon149.seq
46257922 gbcon15.seq
249955090 gbcon150.seq
249999017 gbcon151.seq
199658550 gbcon152.seq
249970974 gbcon153.seq
249999146 gbcon154.seq
249995739 gbcon155.seq
249929876 gbcon156.seq
249999580 gbcon157.seq
130279337 gbcon158.seq
250000007 gbcon159.seq
247404331 gbcon16.seq
249955167 gbcon160.seq
249997423 gbcon161.seq
249998688 gbcon162.seq
250000092 gbcon163.seq
249668804 gbcon164.seq
249998963 gbcon165.seq
95920969 gbcon166.seq
18856115 gbcon167.seq
249996913 gbcon17.seq
249931945 gbcon18.seq
45091689 gbcon19.seq
249930528 gbcon2.seq
249999960 gbcon20.seq
249360219 gbcon21.seq
116173132 gbcon22.seq
249999462 gbcon23.seq
120041874 gbcon24.seq
249996870 gbcon25.seq
249724019 gbcon26.seq
249997572 gbcon27.seq
249998238 gbcon28.seq
186471574 gbcon29.seq
248161967 gbcon3.seq
249999756 gbcon30.seq
249997224 gbcon31.seq
249999813 gbcon32.seq
249999952 gbcon33.seq
247997550 gbcon34.seq
232565070 gbcon35.seq
249999237 gbcon36.seq
249996869 gbcon37.seq
249995921 gbcon38.seq
249996351 gbcon39.seq
248979371 gbcon4.seq
249999450 gbcon40.seq
249997210 gbcon41.seq
61183731 gbcon42.seq
249997486 gbcon43.seq
249994070 gbcon44.seq
249999391 gbcon45.seq
249997743 gbcon46.seq
249994859 gbcon47.seq
43089049 gbcon48.seq
249993995 gbcon49.seq
249999843 gbcon5.seq
249996310 gbcon50.seq
249994442 gbcon51.seq
249997248 gbcon52.seq
250000078 gbcon53.seq
36404971 gbcon54.seq
249993185 gbcon55.seq
249998119 gbcon56.seq
249995170 gbcon57.seq
249998154 gbcon58.seq
249998078 gbcon59.seq
249993449 gbcon6.seq
152679523 gbcon60.seq
249999955 gbcon61.seq
249999066 gbcon62.seq
249997558 gbcon63.seq
249998625 gbcon64.seq
183609322 gbcon65.seq
249999870 gbcon66.seq
249997967 gbcon67.seq
249997138 gbcon68.seq
249995207 gbcon69.seq
231272949 gbcon7.seq
245488804 gbcon70.seq
250000182 gbcon71.seq
249998695 gbcon72.seq
249998372 gbcon73.seq
249996966 gbcon74.seq
250000007 gbcon75.seq
96627683 gbcon76.seq
249993448 gbcon77.seq
249995119 gbcon78.seq
249997383 gbcon79.seq
249997708 gbcon8.seq
249995948 gbcon80.seq
249999042 gbcon81.seq
62682749 gbcon82.seq
249997771 gbcon83.seq
249996653 gbcon84.seq
249999445 gbcon85.seq
249999590 gbcon86.seq
249998149 gbcon87.seq
21674116 gbcon88.seq
249998140 gbcon89.seq
249996514 gbcon9.seq
249997503 gbcon90.seq
249996940 gbcon91.seq
249995720 gbcon92.seq
197881888 gbcon93.seq
249993974 gbcon94.seq
249996060 gbcon95.seq
249999726 gbcon96.seq
249998645 gbcon97.seq
249996901 gbcon98.seq
133265984 gbcon99.seq
5226689 gbdel.txt
249998126 gbenv1.seq
249999987 gbenv10.seq
56473734 gbenv11.seq
249999616 gbenv12.seq
249999595 gbenv13.seq
249997680 gbenv14.seq
249999723 gbenv15.seq
249998637 gbenv16.seq
249999240 gbenv17.seq
249996520 gbenv18.seq
201131266 gbenv19.seq
249999695 gbenv2.seq
249997542 gbenv20.seq
250000045 gbenv21.seq
249998701 gbenv22.seq
249999056 gbenv23.seq
156286621 gbenv24.seq
249998724 gbenv25.seq
249965280 gbenv26.seq
249999705 gbenv27.seq
249999280 gbenv28.seq
249999160 gbenv29.seq
250000121 gbenv3.seq
154215264 gbenv30.seq
249998069 gbenv31.seq
249997320 gbenv32.seq
249998597 gbenv33.seq
249999542 gbenv34.seq
142451829 gbenv35.seq
249999327 gbenv36.seq
249999297 gbenv37.seq
249999340 gbenv38.seq
249998563 gbenv39.seq
249997874 gbenv4.seq
249998831 gbenv40.seq
226946874 gbenv41.seq
249999751 gbenv42.seq
249998764 gbenv43.seq
250000028 gbenv44.seq
249999389 gbenv45.seq
80801262 gbenv46.seq
249996327 gbenv47.seq
249996957 gbenv48.seq
249997170 gbenv49.seq
249999153 gbenv5.seq
249997321 gbenv50.seq
249999151 gbenv51.seq
249998084 gbenv52.seq
19654377 gbenv53.seq
241051428 gbenv6.seq
249998471 gbenv7.seq
249999917 gbenv8.seq
249998584 gbenv9.seq
524292008 gbest1.seq
524289016 gbest10.seq
524291268 gbest100.seq
524289437 gbest101.seq
524290715 gbest102.seq
524289086 gbest103.seq
349471723 gbest104.seq
524291148 gbest105.seq
524289738 gbest106.seq
524291194 gbest107.seq
385839175 gbest108.seq
389670817 gbest109.seq
524290986 gbest11.seq
383425467 gbest110.seq
384188998 gbest111.seq
381057139 gbest112.seq
385305672 gbest113.seq
390039961 gbest114.seq
388178589 gbest115.seq
387308759 gbest116.seq
383862694 gbest117.seq
407500455 gbest118.seq
510284736 gbest119.seq
524288931 gbest12.seq
524288993 gbest120.seq
524289609 gbest121.seq
524290228 gbest122.seq
524290198 gbest123.seq
431202902 gbest124.seq
524290226 gbest125.seq
524292007 gbest126.seq
524289559 gbest127.seq
524289933 gbest128.seq
524292165 gbest129.seq
156583008 gbest13.seq
524290205 gbest130.seq
524288969 gbest131.seq
524290499 gbest132.seq
524289594 gbest133.seq
524291657 gbest134.seq
524289466 gbest135.seq
524289777 gbest136.seq
299948048 gbest137.seq
524290906 gbest138.seq
524291320 gbest139.seq
524289786 gbest14.seq
524292469 gbest140.seq
524291268 gbest141.seq
524292303 gbest142.seq
524289908 gbest143.seq
524289804 gbest144.seq
524290725 gbest145.seq
524289388 gbest146.seq
524288942 gbest147.seq
524289469 gbest148.seq
524291987 gbest149.seq
524291437 gbest15.seq
524289983 gbest150.seq
464599767 gbest151.seq
524291621 gbest152.seq
524289898 gbest153.seq
524290313 gbest154.seq
524291048 gbest155.seq
524289615 gbest156.seq
524288756 gbest157.seq
524289333 gbest158.seq
524292205 gbest159.seq
524289246 gbest16.seq
524289298 gbest160.seq
524292946 gbest161.seq
524288923 gbest162.seq
524288941 gbest163.seq
244792923 gbest164.seq
524290553 gbest165.seq
524290082 gbest166.seq
524291149 gbest167.seq
524291109 gbest168.seq
524290549 gbest169.seq
524289351 gbest17.seq
524289746 gbest170.seq
524290294 gbest171.seq
524289737 gbest172.seq
524289426 gbest173.seq
524289043 gbest174.seq
524290997 gbest175.seq
524290710 gbest176.seq
524289416 gbest177.seq
112726770 gbest178.seq
524289455 gbest179.seq
524290027 gbest18.seq
524290176 gbest180.seq
524289972 gbest181.seq
524291308 gbest182.seq
524288814 gbest183.seq
524290837 gbest184.seq
524290819 gbest185.seq
524289479 gbest186.seq
524289157 gbest187.seq
524291338 gbest188.seq
524288746 gbest189.seq
524291602 gbest19.seq
524288754 gbest190.seq
467977833 gbest191.seq
524290972 gbest192.seq
524290099 gbest193.seq
524290680 gbest194.seq
524292662 gbest195.seq
524289242 gbest196.seq
524289152 gbest197.seq
524289984 gbest198.seq
524290974 gbest199.seq
524289694 gbest2.seq
524289794 gbest20.seq
524289613 gbest200.seq
524289209 gbest201.seq
524290559 gbest202.seq
524289133 gbest203.seq
524291398 gbest204.seq
83759466 gbest205.seq
524289587 gbest206.seq
524288736 gbest207.seq
524289118 gbest208.seq
524289225 gbest209.seq
524291555 gbest21.seq
524291008 gbest210.seq
524290107 gbest211.seq
524291006 gbest212.seq
524290702 gbest213.seq
524288823 gbest214.seq
524289838 gbest215.seq
421982696 gbest216.seq
524292573 gbest217.seq
524291705 gbest218.seq
524288981 gbest219.seq
512090321 gbest22.seq
524290993 gbest220.seq
524291112 gbest221.seq
524294808 gbest222.seq
524289268 gbest223.seq
524291819 gbest224.seq
524290881 gbest225.seq
524289350 gbest226.seq
524290342 gbest227.seq
524291126 gbest228.seq
524291154 gbest229.seq
500344147 gbest23.seq
351153673 gbest230.seq
524291828 gbest231.seq
524290256 gbest232.seq
524289759 gbest233.seq
524293306 gbest234.seq
524292254 gbest235.seq
524290349 gbest236.seq
524293292 gbest237.seq
524290432 gbest238.seq
524291590 gbest239.seq
509304525 gbest24.seq
524291065 gbest240.seq
524290788 gbest241.seq
524289177 gbest242.seq
524290253 gbest243.seq
524290415 gbest244.seq
49001491 gbest245.seq
524288751 gbest246.seq
524289516 gbest247.seq
524292105 gbest248.seq
524288902 gbest249.seq
319590070 gbest25.seq
524290050 gbest250.seq
524289119 gbest251.seq
524289777 gbest252.seq
524291413 gbest253.seq
524289460 gbest254.seq
524289663 gbest255.seq
524291724 gbest256.seq
260104720 gbest257.seq
524289994 gbest258.seq
524290112 gbest259.seq
524288828 gbest26.seq
524289510 gbest260.seq
524290027 gbest261.seq
524289945 gbest262.seq
524290744 gbest263.seq
524288967 gbest264.seq
524290443 gbest265.seq
524290316 gbest266.seq
524290430 gbest267.seq
297070339 gbest268.seq
524288751 gbest269.seq
524290412 gbest27.seq
524288830 gbest270.seq
524289356 gbest271.seq
524291720 gbest272.seq
524289115 gbest273.seq
524289389 gbest274.seq
524288772 gbest275.seq
524290550 gbest276.seq
524289620 gbest277.seq
524289992 gbest278.seq
524289409 gbest279.seq
524288758 gbest28.seq
302513707 gbest280.seq
524293416 gbest281.seq
524290544 gbest282.seq
524289704 gbest283.seq
524290519 gbest284.seq
524289514 gbest285.seq
524289433 gbest286.seq
524289863 gbest287.seq
524290574 gbest288.seq
524292530 gbest289.seq
524290753 gbest29.seq
524289853 gbest290.seq
524288759 gbest291.seq
230059846 gbest292.seq
524290964 gbest293.seq
524290663 gbest294.seq
524289307 gbest295.seq
524291130 gbest296.seq
524291216 gbest297.seq
524288935 gbest298.seq
524290523 gbest299.seq
497701912 gbest3.seq
524290738 gbest30.seq
524288772 gbest300.seq
477427193 gbest301.seq
485390008 gbest302.seq
487642595 gbest303.seq
320271085 gbest304.seq
524290048 gbest305.seq
524289871 gbest306.seq
524289378 gbest307.seq
524289530 gbest308.seq
524290042 gbest309.seq
524290199 gbest31.seq
524290258 gbest310.seq
524290274 gbest311.seq
524290889 gbest312.seq
524291644 gbest313.seq
524289301 gbest314.seq
524288916 gbest315.seq
524291749 gbest316.seq
497575917 gbest317.seq
524289299 gbest318.seq
524290548 gbest319.seq
524291145 gbest32.seq
524290184 gbest320.seq
524289957 gbest321.seq
524292539 gbest322.seq
524289872 gbest323.seq
524288956 gbest324.seq
524290991 gbest325.seq
524290627 gbest326.seq
524118653 gbest327.seq
524289685 gbest328.seq
524291318 gbest329.seq
524289323 gbest33.seq
524290569 gbest330.seq
250338987 gbest331.seq
524290455 gbest332.seq
524289770 gbest333.seq
524290662 gbest334.seq
524293472 gbest335.seq
501685245 gbest336.seq
524292606 gbest337.seq
524290450 gbest338.seq
524291819 gbest339.seq
519566956 gbest34.seq
524289116 gbest340.seq
524289345 gbest341.seq
524292325 gbest342.seq
524289433 gbest343.seq
524289249 gbest344.seq
342088864 gbest345.seq
524292213 gbest346.seq
524290831 gbest347.seq
524289370 gbest348.seq
524290335 gbest349.seq
492730500 gbest35.seq
524290773 gbest350.seq
524290880 gbest351.seq
524290558 gbest352.seq
524288833 gbest353.seq
524292507 gbest354.seq
524289430 gbest355.seq
524289104 gbest356.seq
524288900 gbest357.seq
524291932 gbest358.seq
524290462 gbest359.seq
494451765 gbest36.seq
16502264 gbest360.seq
524290373 gbest361.seq
524289513 gbest362.seq
524291941 gbest363.seq
524292678 gbest364.seq
524290541 gbest365.seq
524290060 gbest366.seq
524289377 gbest367.seq
524289351 gbest368.seq
524291276 gbest369.seq
493340572 gbest37.seq
524289106 gbest370.seq
386240288 gbest371.seq
524289612 gbest372.seq
524289110 gbest373.seq
524289755 gbest374.seq
505509793 gbest375.seq
524289509 gbest376.seq
524291315 gbest377.seq
524291404 gbest378.seq
524291214 gbest379.seq
488000483 gbest38.seq
524289505 gbest380.seq
524291322 gbest381.seq
524290565 gbest382.seq
354341025 gbest383.seq
524291127 gbest384.seq
524289482 gbest385.seq
524289915 gbest386.seq
524291218 gbest387.seq
524290453 gbest388.seq
524292363 gbest389.seq
493252495 gbest39.seq
524288764 gbest390.seq
524290144 gbest391.seq
524290932 gbest392.seq
524289330 gbest393.seq
524290342 gbest394.seq
185097263 gbest395.seq
524292162 gbest396.seq
524291056 gbest397.seq
524288912 gbest398.seq
524290219 gbest399.seq
524288944 gbest4.seq
111460427 gbest40.seq
524290838 gbest400.seq
524292071 gbest401.seq
524288841 gbest402.seq
524289363 gbest403.seq
524291329 gbest404.seq
524291661 gbest405.seq
524291155 gbest406.seq
524289864 gbest407.seq
485613512 gbest408.seq
524290761 gbest409.seq
524294013 gbest41.seq
524289578 gbest410.seq
524289089 gbest411.seq
524289797 gbest412.seq
524288959 gbest413.seq
524290418 gbest414.seq
524290592 gbest415.seq
524289240 gbest416.seq
524290163 gbest417.seq
524291589 gbest418.seq
524289635 gbest419.seq
524292378 gbest42.seq
524290071 gbest420.seq
524291541 gbest421.seq
19587268 gbest422.seq
524290635 gbest423.seq
524290812 gbest424.seq
524291282 gbest425.seq
524290169 gbest426.seq
524292260 gbest427.seq
524290775 gbest428.seq
524290919 gbest429.seq
524291152 gbest43.seq
524290073 gbest430.seq
524290231 gbest431.seq
524290589 gbest432.seq
524290117 gbest433.seq
524290183 gbest434.seq
524288838 gbest435.seq
524290267 gbest436.seq
25342560 gbest437.seq
524290097 gbest438.seq
524289139 gbest439.seq
524291994 gbest44.seq
524289291 gbest440.seq
524290687 gbest441.seq
524291641 gbest442.seq
524292107 gbest443.seq
524289173 gbest444.seq
524291054 gbest445.seq
524290278 gbest446.seq
524290005 gbest447.seq
524290827 gbest448.seq
357942556 gbest449.seq
524289744 gbest45.seq
524289991 gbest450.seq
524289686 gbest451.seq
524290075 gbest452.seq
524290204 gbest453.seq
524290572 gbest454.seq
524289962 gbest455.seq
524289235 gbest456.seq
524292356 gbest457.seq
524290358 gbest458.seq
524289760 gbest459.seq
524290536 gbest46.seq
524289164 gbest460.seq
135655340 gbest461.seq
524290443 gbest47.seq
524289407 gbest48.seq
524288743 gbest49.seq
524289625 gbest5.seq
524289597 gbest50.seq
524290850 gbest51.seq
524290902 gbest52.seq
524291426 gbest53.seq
253754987 gbest54.seq
524289855 gbest55.seq
524292065 gbest56.seq
524288912 gbest57.seq
524289072 gbest58.seq
524289254 gbest59.seq
524288762 gbest6.seq
524290970 gbest60.seq
524291770 gbest61.seq
524291036 gbest62.seq
524290524 gbest63.seq
524290125 gbest64.seq
524291456 gbest65.seq
524289317 gbest66.seq
463063233 gbest67.seq
524293061 gbest68.seq
524289120 gbest69.seq
524290014 gbest7.seq
524290220 gbest70.seq
524288927 gbest71.seq
524291051 gbest72.seq
524292401 gbest73.seq
524290703 gbest74.seq
524289284 gbest75.seq
524288986 gbest76.seq
524291000 gbest77.seq
524290955 gbest78.seq
524291491 gbest79.seq
524290628 gbest8.seq
190810938 gbest80.seq
524290100 gbest81.seq
524289613 gbest82.seq
524289693 gbest83.seq
524288728 gbest84.seq
524289166 gbest85.seq
524292117 gbest86.seq
524291563 gbest87.seq
524291075 gbest88.seq
524290998 gbest89.seq
524289667 gbest9.seq
524290258 gbest90.seq
524290235 gbest91.seq
462469660 gbest92.seq
524291760 gbest93.seq
524292054 gbest94.seq
524291571 gbest95.seq
524289444 gbest96.seq
524290291 gbest97.seq
524292097 gbest98.seq
524290031 gbest99.seq
182899103 gbgen.idx
524290352 gbgss1.seq
524292173 gbgss10.seq
524292593 gbgss100.seq
524289703 gbgss101.seq
524291138 gbgss102.seq
524290642 gbgss103.seq
418354153 gbgss104.seq
524290801 gbgss105.seq
524290070 gbgss106.seq
524290718 gbgss107.seq
524288733 gbgss108.seq
524288767 gbgss109.seq
524291375 gbgss11.seq
524289084 gbgss110.seq
524290809 gbgss111.seq
524289971 gbgss112.seq
524291028 gbgss113.seq
524291069 gbgss114.seq
524289142 gbgss115.seq
55578194 gbgss116.seq
524289697 gbgss117.seq
524288912 gbgss118.seq
524289210 gbgss119.seq
524290109 gbgss12.seq
524289140 gbgss120.seq
524290583 gbgss121.seq
524289663 gbgss122.seq
524289754 gbgss123.seq
524289869 gbgss124.seq
524290826 gbgss125.seq
524289574 gbgss126.seq
524289664 gbgss127.seq
524289492 gbgss128.seq
212391980 gbgss129.seq
524289051 gbgss13.seq
524289179 gbgss130.seq
524289525 gbgss131.seq
524289495 gbgss132.seq
524291043 gbgss133.seq
524288845 gbgss134.seq
524291036 gbgss135.seq
524292513 gbgss136.seq
524288848 gbgss137.seq
524289263 gbgss138.seq
515991481 gbgss139.seq
524289106 gbgss14.seq
516018273 gbgss140.seq
112014629 gbgss141.seq
524289872 gbgss142.seq
524291315 gbgss143.seq
524290675 gbgss144.seq
524290093 gbgss145.seq
524290136 gbgss146.seq
524291253 gbgss147.seq
524290973 gbgss148.seq
524290456 gbgss149.seq
524290836 gbgss15.seq
524289948 gbgss150.seq
524289018 gbgss151.seq
205352039 gbgss152.seq
249997495 gbgss153.seq
249999691 gbgss154.seq
249999296 gbgss155.seq
249999790 gbgss156.seq
28694264 gbgss157.seq
249997137 gbgss158.seq
250000033 gbgss159.seq
524290486 gbgss16.seq
249998542 gbgss160.seq
249998333 gbgss161.seq
224919493 gbgss162.seq
249998415 gbgss163.seq
249998761 gbgss164.seq
249998880 gbgss165.seq
249998175 gbgss166.seq
190065974 gbgss167.seq
249999433 gbgss168.seq
249998390 gbgss169.seq
524288946 gbgss17.seq
249999267 gbgss170.seq
249997904 gbgss171.seq
249996974 gbgss172.seq
76835987 gbgss173.seq
249998100 gbgss174.seq
2079852 gbgss175.seq
79542394 gbgss176.seq
249999009 gbgss177.seq
250000259 gbgss178.seq
87380505 gbgss179.seq
524291200 gbgss18.seq
249999685 gbgss180.seq
249998355 gbgss181.seq
249998984 gbgss182.seq
202719103 gbgss183.seq
249999232 gbgss184.seq
249999013 gbgss185.seq
249998851 gbgss186.seq
246250899 gbgss187.seq
249999268 gbgss188.seq
249997406 gbgss189.seq
314849258 gbgss19.seq
249999279 gbgss190.seq
243520281 gbgss191.seq
249999336 gbgss192.seq
249997150 gbgss193.seq
249998209 gbgss194.seq
249998771 gbgss195.seq
122182588 gbgss196.seq
249998013 gbgss197.seq
250000031 gbgss198.seq
249999974 gbgss199.seq
524289034 gbgss2.seq
524288952 gbgss20.seq
249998152 gbgss200.seq
94058788 gbgss201.seq
249998892 gbgss202.seq
249999850 gbgss203.seq
249998239 gbgss204.seq
249999582 gbgss205.seq
180308144 gbgss206.seq
249999236 gbgss207.seq
249997993 gbgss208.seq
249998006 gbgss209.seq
524289034 gbgss21.seq
249999353 gbgss210.seq
95926739 gbgss211.seq
249999461 gbgss212.seq
249999350 gbgss213.seq
249998406 gbgss214.seq
249998619 gbgss215.seq
249999398 gbgss216.seq
249999995 gbgss217.seq
17245248 gbgss218.seq
249999424 gbgss219.seq
524291398 gbgss22.seq
249999963 gbgss220.seq
249997369 gbgss221.seq
43648880 gbgss222.seq
52862187 gbgss223.seq
249999126 gbgss224.seq
249999236 gbgss225.seq
249997873 gbgss226.seq
249998364 gbgss227.seq
30976250 gbgss228.seq
249997670 gbgss229.seq
524291152 gbgss23.seq
249997588 gbgss230.seq
249999018 gbgss231.seq
250000000 gbgss232.seq
28042636 gbgss233.seq
249997661 gbgss234.seq
249998578 gbgss235.seq
249999047 gbgss236.seq
249997348 gbgss237.seq
249999380 gbgss238.seq
250000153 gbgss239.seq
524291392 gbgss24.seq
178837789 gbgss240.seq
249999812 gbgss241.seq
249998926 gbgss242.seq
249999095 gbgss243.seq
220154622 gbgss244.seq
250000034 gbgss245.seq
249997956 gbgss246.seq
250000074 gbgss247.seq
249998729 gbgss248.seq
195288113 gbgss249.seq
524290581 gbgss25.seq
249999561 gbgss250.seq
249998751 gbgss251.seq
249999600 gbgss252.seq
249999029 gbgss253.seq
249999913 gbgss254.seq
25748608 gbgss255.seq
524290713 gbgss26.seq
524289900 gbgss27.seq
524288854 gbgss28.seq
524289528 gbgss29.seq
524289102 gbgss3.seq
524290730 gbgss30.seq
38753639 gbgss31.seq
524289097 gbgss32.seq
524290723 gbgss33.seq
524288828 gbgss34.seq
524289728 gbgss35.seq
524289696 gbgss36.seq
524289533 gbgss37.seq
524290149 gbgss38.seq
509095937 gbgss39.seq
524290615 gbgss4.seq
524291541 gbgss40.seq
524289016 gbgss41.seq
524291234 gbgss42.seq
28742152 gbgss43.seq
524288946 gbgss44.seq
524291118 gbgss45.seq
524291184 gbgss46.seq
524290985 gbgss47.seq
209346767 gbgss48.seq
524291863 gbgss49.seq
168350020 gbgss5.seq
524291582 gbgss50.seq
524290401 gbgss51.seq
524290464 gbgss52.seq
524290548 gbgss53.seq
524290885 gbgss54.seq
524289963 gbgss55.seq
524289945 gbgss56.seq
524290892 gbgss57.seq
524290809 gbgss58.seq
524290855 gbgss59.seq
524290951 gbgss6.seq
5859198 gbgss60.seq
524289023 gbgss61.seq
524290882 gbgss62.seq
524290246 gbgss63.seq
457238462 gbgss64.seq
524291294 gbgss65.seq
524291022 gbgss66.seq
524290625 gbgss67.seq
524289509 gbgss68.seq
524291296 gbgss69.seq
524289102 gbgss7.seq
524290162 gbgss70.seq
524290176 gbgss71.seq
524290850 gbgss72.seq
524289394 gbgss73.seq
524291500 gbgss74.seq
524290572 gbgss75.seq
524290538 gbgss76.seq
32490242 gbgss77.seq
524289537 gbgss78.seq
524291931 gbgss79.seq
524291704 gbgss8.seq
524289482 gbgss80.seq
524290727 gbgss81.seq
524289703 gbgss82.seq
524289751 gbgss83.seq
524289336 gbgss84.seq
524290248 gbgss85.seq
524289011 gbgss86.seq
524292247 gbgss87.seq
524290044 gbgss88.seq
376569727 gbgss89.seq
524290120 gbgss9.seq
524292172 gbgss90.seq
524291677 gbgss91.seq
524291807 gbgss92.seq
524292003 gbgss93.seq
524289134 gbgss94.seq
524289592 gbgss95.seq
524289866 gbgss96.seq
524291875 gbgss97.seq
524291048 gbgss98.seq
524291620 gbgss99.seq
249992912 gbhtc1.seq
249998418 gbhtc10.seq
249997449 gbhtc11.seq
19305626 gbhtc12.seq
249997534 gbhtc13.seq
249996320 gbhtc14.seq
64316003 gbhtc15.seq
249992681 gbhtc2.seq
249996913 gbhtc3.seq
249991889 gbhtc4.seq
249985674 gbhtc5.seq
249997743 gbhtc6.seq
249996123 gbhtc7.seq
83873876 gbhtc8.seq
249996616 gbhtc9.seq
249904748 gbhtg1.seq
249868447 gbhtg10.seq
249917503 gbhtg100.seq
249844944 gbhtg101.seq
249902534 gbhtg102.seq
249987029 gbhtg103.seq
5671243 gbhtg104.seq
249895732 gbhtg105.seq
249878049 gbhtg106.seq
249900433 gbhtg107.seq
249915790 gbhtg108.seq
249836851 gbhtg109.seq
1107147 gbhtg11.seq
249976359 gbhtg110.seq
249780420 gbhtg111.seq
249873742 gbhtg112.seq
249970078 gbhtg113.seq
167814795 gbhtg114.seq
249997695 gbhtg115.seq
249533556 gbhtg116.seq
249988332 gbhtg117.seq
249895879 gbhtg118.seq
249822759 gbhtg119.seq
249888470 gbhtg12.seq
54512760 gbhtg120.seq
249935891 gbhtg121.seq
249834856 gbhtg122.seq
249931131 gbhtg123.seq
249875691 gbhtg124.seq
249782400 gbhtg125.seq
134760056 gbhtg126.seq
249831507 gbhtg127.seq
249847301 gbhtg128.seq
249819096 gbhtg129.seq
249970424 gbhtg13.seq
249939383 gbhtg130.seq
249998279 gbhtg131.seq
249828527 gbhtg132.seq
249872447 gbhtg133.seq
249867339 gbhtg134.seq
249854169 gbhtg135.seq
76420905 gbhtg136.seq
249587437 gbhtg14.seq
249775919 gbhtg15.seq
249742391 gbhtg16.seq
249169910 gbhtg17.seq
249983662 gbhtg18.seq
249677291 gbhtg19.seq
249994630 gbhtg2.seq
249988730 gbhtg20.seq
237145184 gbhtg21.seq
249760624 gbhtg22.seq
249868408 gbhtg23.seq
249987789 gbhtg24.seq
249921752 gbhtg25.seq
249761207 gbhtg26.seq
249891641 gbhtg27.seq
249961480 gbhtg28.seq
249841969 gbhtg29.seq
249950135 gbhtg3.seq
249992987 gbhtg30.seq
225324756 gbhtg31.seq
249827828 gbhtg32.seq
249920767 gbhtg33.seq
249929437 gbhtg34.seq
249919058 gbhtg35.seq
249858205 gbhtg36.seq
249814604 gbhtg37.seq
249767419 gbhtg38.seq
249627604 gbhtg39.seq
249984089 gbhtg4.seq
249839726 gbhtg40.seq
224363115 gbhtg41.seq
249889211 gbhtg42.seq
249786793 gbhtg43.seq
249972417 gbhtg44.seq
249775813 gbhtg45.seq
249913172 gbhtg46.seq
249598316 gbhtg47.seq
249865084 gbhtg48.seq
249793045 gbhtg49.seq
249882044 gbhtg5.seq
249922715 gbhtg50.seq
235040956 gbhtg51.seq
249732687 gbhtg52.seq
249918496 gbhtg53.seq
249773162 gbhtg54.seq
249971361 gbhtg55.seq
249962512 gbhtg56.seq
18795863 gbhtg57.seq
249861195 gbhtg58.seq
249939539 gbhtg59.seq
249898460 gbhtg6.seq
249990521 gbhtg60.seq
249920304 gbhtg61.seq
225327613 gbhtg62.seq
249854005 gbhtg63.seq
249787648 gbhtg64.seq
249883720 gbhtg65.seq
249980764 gbhtg66.seq
249833261 gbhtg67.seq
16614633 gbhtg68.seq
249960711 gbhtg69.seq
249933725 gbhtg7.seq
249973591 gbhtg70.seq
249953795 gbhtg71.seq
249976832 gbhtg72.seq
225068425 gbhtg73.seq
249811217 gbhtg74.seq
249874983 gbhtg75.seq
249800230 gbhtg76.seq
249959810 gbhtg77.seq
244236211 gbhtg78.seq
249883527 gbhtg79.seq
249933567 gbhtg8.seq
249989775 gbhtg80.seq
249839558 gbhtg81.seq
249838461 gbhtg82.seq
216751380 gbhtg83.seq
249966974 gbhtg84.seq
249803194 gbhtg85.seq
249757813 gbhtg86.seq
249850131 gbhtg87.seq
220831145 gbhtg88.seq
249970053 gbhtg89.seq
249923766 gbhtg9.seq
249954204 gbhtg90.seq
249999447 gbhtg91.seq
249963669 gbhtg92.seq
208918917 gbhtg93.seq
249866049 gbhtg94.seq
249911674 gbhtg95.seq
249904005 gbhtg96.seq
249769960 gbhtg97.seq
167889754 gbhtg98.seq
249744688 gbhtg99.seq
249999729 gbinv1.seq
249999464 gbinv10.seq
249999214 gbinv11.seq
167143988 gbinv12.seq
249995378 gbinv13.seq
249997995 gbinv14.seq
249995483 gbinv15.seq
150828588 gbinv16.seq
249999928 gbinv17.seq
248995288 gbinv18.seq
249998320 gbinv19.seq
249870004 gbinv2.seq
249998808 gbinv20.seq
238112954 gbinv21.seq
220615455 gbinv22.seq
175506919 gbinv23.seq
249997791 gbinv24.seq
249998477 gbinv25.seq
80884318 gbinv26.seq
249999550 gbinv27.seq
249999259 gbinv28.seq
249997711 gbinv29.seq
212085004 gbinv3.seq
184359498 gbinv30.seq
249998496 gbinv4.seq
249999334 gbinv5.seq
249998974 gbinv6.seq
249999025 gbinv7.seq
16559478 gbinv8.seq
249998289 gbinv9.seq
144177333 gbjou1.idx
300941919 gbjou10.idx
261524780 gbjou11.idx
247989182 gbjou12.idx
47871838 gbjou13.idx
140721978 gbjou2.idx
172375994 gbjou3.idx
184093434 gbjou4.idx
269819877 gbjou5.idx
278658578 gbjou6.idx
281568666 gbjou7.idx
280680781 gbjou8.idx
305240627 gbjou9.idx
340242625 gbkey1.idx
180077814 gbkey2.idx
180145860 gbkey3.idx
184381414 gbkey4.idx
301030822 gbkey5.idx
137104095 gbkey6.idx
249863224 gbmam1.seq
249997261 gbmam2.seq
249915148 gbmam3.seq
249999577 gbmam4.seq
250000224 gbmam5.seq
250000032 gbmam6.seq
249996816 gbmam7.seq
3386287 gbmam8.seq
36401723 gbnew.txt
249999772 gbpat1.seq
249999613 gbpat10.seq
249999793 gbpat100.seq
149112469 gbpat101.seq
249999880 gbpat102.seq
249999565 gbpat103.seq
249929731 gbpat104.seq
249824879 gbpat105.seq
249998856 gbpat106.seq
192934428 gbpat107.seq
249999496 gbpat108.seq
249999625 gbpat109.seq
179557952 gbpat11.seq
249996328 gbpat110.seq
80124329 gbpat111.seq
249999327 gbpat112.seq
250000261 gbpat113.seq
249988052 gbpat114.seq
249999878 gbpat115.seq
249849703 gbpat116.seq
66835452 gbpat117.seq
249999441 gbpat118.seq
249999845 gbpat119.seq
250000152 gbpat12.seq
249999888 gbpat120.seq
249999095 gbpat121.seq
160256390 gbpat122.seq
249999974 gbpat123.seq
249999633 gbpat124.seq
234784218 gbpat125.seq
249991591 gbpat126.seq
249970935 gbpat127.seq
249999681 gbpat128.seq
249997397 gbpat129.seq
249995214 gbpat13.seq
249997452 gbpat130.seq
66832984 gbpat131.seq
249992315 gbpat132.seq
249999867 gbpat133.seq
250000197 gbpat134.seq
249999821 gbpat135.seq
249998337 gbpat136.seq
18437114 gbpat137.seq
249999655 gbpat138.seq
249998828 gbpat139.seq
249999071 gbpat14.seq
249999803 gbpat140.seq
220985436 gbpat141.seq
249998039 gbpat142.seq
250000068 gbpat143.seq
250000015 gbpat144.seq
86028783 gbpat145.seq
249999922 gbpat146.seq
249998356 gbpat147.seq
249999124 gbpat148.seq
63537091 gbpat149.seq
249999991 gbpat15.seq
249996936 gbpat150.seq
249999968 gbpat151.seq
249999470 gbpat152.seq
249999961 gbpat153.seq
250000095 gbpat154.seq
249998310 gbpat155.seq
222137448 gbpat156.seq
250000249 gbpat157.seq
249999893 gbpat158.seq
249999893 gbpat159.seq
249999915 gbpat16.seq
220539897 gbpat160.seq
249999753 gbpat161.seq
249998599 gbpat162.seq
249999673 gbpat163.seq
12381933 gbpat164.seq
249997013 gbpat165.seq
249998113 gbpat166.seq
249999975 gbpat167.seq
249999201 gbpat168.seq
35343603 gbpat169.seq
65896429 gbpat17.seq
249998580 gbpat170.seq
249998996 gbpat171.seq
249998092 gbpat172.seq
250000010 gbpat173.seq
249999842 gbpat174.seq
249999544 gbpat175.seq
249993849 gbpat176.seq
249999604 gbpat177.seq
165992988 gbpat178.seq
250000027 gbpat18.seq
249999801 gbpat19.seq
249998573 gbpat2.seq
249999076 gbpat20.seq
249996990 gbpat21.seq
185825051 gbpat22.seq
249998934 gbpat23.seq
249858647 gbpat24.seq
249999397 gbpat25.seq
249999337 gbpat26.seq
71191909 gbpat27.seq
249986100 gbpat28.seq
249998620 gbpat29.seq
249999135 gbpat3.seq
249997666 gbpat30.seq
249999841 gbpat31.seq
250000175 gbpat32.seq
180194091 gbpat33.seq
249997878 gbpat34.seq
249999688 gbpat35.seq
249999436 gbpat36.seq
250000186 gbpat37.seq
130533969 gbpat38.seq
249996407 gbpat39.seq
249997195 gbpat4.seq
249993739 gbpat40.seq
249999063 gbpat41.seq
249999040 gbpat42.seq
249997287 gbpat43.seq
249845172 gbpat44.seq
249999190 gbpat45.seq
250000090 gbpat46.seq
171467978 gbpat47.seq
249999830 gbpat48.seq
249998527 gbpat49.seq
71727149 gbpat5.seq
249999531 gbpat50.seq
250000197 gbpat51.seq
222934467 gbpat52.seq
249999057 gbpat53.seq
249999815 gbpat54.seq
250000246 gbpat55.seq
164989556 gbpat56.seq
249883080 gbpat57.seq
249996731 gbpat58.seq
250000139 gbpat59.seq
249999527 gbpat6.seq
249998980 gbpat60.seq
134927252 gbpat61.seq
249998969 gbpat62.seq
249999978 gbpat63.seq
249999690 gbpat64.seq
249998210 gbpat65.seq
249999753 gbpat66.seq
249999505 gbpat67.seq
144886744 gbpat68.seq
250000113 gbpat69.seq
249998882 gbpat7.seq
249999899 gbpat70.seq
249998837 gbpat71.seq
244403359 gbpat72.seq
248969066 gbpat73.seq
244459261 gbpat74.seq
247875799 gbpat75.seq
249999901 gbpat76.seq
160624439 gbpat77.seq
250000121 gbpat78.seq
249999657 gbpat79.seq
249992125 gbpat8.seq
249999470 gbpat80.seq
249999644 gbpat81.seq
250000008 gbpat82.seq
249998696 gbpat83.seq
93332873 gbpat84.seq
249155886 gbpat85.seq
249999519 gbpat86.seq
249999665 gbpat87.seq
249999359 gbpat88.seq
249999368 gbpat89.seq
249999906 gbpat9.seq
250000155 gbpat90.seq
145293161 gbpat91.seq
249999199 gbpat92.seq
249998980 gbpat93.seq
249999939 gbpat94.seq
250000257 gbpat95.seq
196964910 gbpat96.seq
249999051 gbpat97.seq
249998995 gbpat98.seq
249999064 gbpat99.seq
185841667 gbphg1.seq
249997631 gbpln1.seq
249999556 gbpln10.seq
249994685 gbpln11.seq
249999246 gbpln12.seq
249769731 gbpln13.seq
214812798 gbpln14.seq
249998215 gbpln15.seq
249985349 gbpln16.seq
249996352 gbpln17.seq
249709069 gbpln18.seq
249989832 gbpln19.seq
249938758 gbpln2.seq
249606536 gbpln20.seq
249997642 gbpln21.seq
33449513 gbpln22.seq
249992320 gbpln23.seq
97645141 gbpln24.seq
249998136 gbpln25.seq
249998874 gbpln26.seq
249472852 gbpln27.seq
221100868 gbpln28.seq
241343526 gbpln29.seq
249948110 gbpln3.seq
249951013 gbpln30.seq
246853724 gbpln31.seq
249999150 gbpln32.seq
249999324 gbpln33.seq
245668851 gbpln34.seq
249995400 gbpln35.seq
249998588 gbpln36.seq
249998532 gbpln37.seq
250000234 gbpln38.seq
142563490 gbpln39.seq
249894700 gbpln4.seq
249826526 gbpln40.seq
249853383 gbpln41.seq
249997520 gbpln42.seq
249999982 gbpln43.seq
249999187 gbpln44.seq
189394474 gbpln45.seq
249999237 gbpln46.seq
248399690 gbpln47.seq
249998824 gbpln48.seq
249997630 gbpln49.seq
249867158 gbpln5.seq
249998257 gbpln50.seq
249998650 gbpln51.seq
249912401 gbpln52.seq
249996918 gbpln53.seq
249998794 gbpln54.seq
57105586 gbpln55.seq
249895931 gbpln6.seq
249859070 gbpln7.seq
249998883 gbpln8.seq
33062871 gbpln9.seq
148952874 gbpri1.seq
249783195 gbpri10.seq
129741660 gbpri11.seq
249962747 gbpri12.seq
249896480 gbpri13.seq
249896770 gbpri14.seq
249947119 gbpri15.seq
249902483 gbpri16.seq
249876241 gbpri17.seq
249991978 gbpri18.seq
249903004 gbpri19.seq
249951019 gbpri2.seq
249948092 gbpri20.seq
249949220 gbpri21.seq
249999774 gbpri22.seq
30697664 gbpri23.seq
177481322 gbpri24.seq
249998934 gbpri25.seq
211358086 gbpri26.seq
249987118 gbpri27.seq
249988725 gbpri28.seq
249948820 gbpri29.seq
250000076 gbpri3.seq
249935405 gbpri30.seq
249945956 gbpri31.seq
249974525 gbpri32.seq
249821502 gbpri33.seq
250000227 gbpri34.seq
95881809 gbpri35.seq
249993971 gbpri36.seq
249998020 gbpri37.seq
249997182 gbpri38.seq
249995558 gbpri39.seq
249968482 gbpri4.seq
249998324 gbpri40.seq
181996994 gbpri41.seq
249998670 gbpri42.seq
249998835 gbpri43.seq
249821421 gbpri44.seq
2823579 gbpri45.seq
249956957 gbpri5.seq
249788332 gbpri6.seq
249806906 gbpri7.seq
249867498 gbpri8.seq
249957345 gbpri9.seq
327109 gbrel.txt
249731024 gbrod1.seq
249752589 gbrod10.seq
62793496 gbrod11.seq
249871284 gbrod12.seq
249783783 gbrod13.seq
249992872 gbrod14.seq
249651633 gbrod15.seq
249953778 gbrod16.seq
249885197 gbrod17.seq
249824125 gbrod18.seq
244529626 gbrod19.seq
249935265 gbrod2.seq
249768065 gbrod20.seq
249924095 gbrod21.seq
230194968 gbrod22.seq
249997417 gbrod23.seq
249998350 gbrod24.seq
249980494 gbrod25.seq
249698931 gbrod26.seq
249999786 gbrod27.seq
249997389 gbrod28.seq
205380887 gbrod29.seq
249991951 gbrod3.seq
249987556 gbrod4.seq
249882212 gbrod5.seq
249882945 gbrod6.seq
249748846 gbrod7.seq
249881291 gbrod8.seq
249819838 gbrod9.seq
4175287636 gbsdr1.txt
5811623920 gbsdr2.txt
2713719078 gbsdr3.txt
158159680 gbsec.idx
249999192 gbsts1.seq
249997720 gbsts10.seq
210919464 gbsts11.seq
249996524 gbsts12.seq
249999349 gbsts13.seq
249999266 gbsts14.seq
249999572 gbsts15.seq
24470469 gbsts16.seq
249999107 gbsts17.seq
249997897 gbsts18.seq
249999071 gbsts19.seq
249998220 gbsts2.seq
148702344 gbsts20.seq
249999008 gbsts3.seq
249998277 gbsts4.seq
39162150 gbsts5.seq
249997411 gbsts6.seq
249997774 gbsts7.seq
249997192 gbsts8.seq
249998706 gbsts9.seq
249999701 gbsyn1.seq
249999343 gbsyn2.seq
249947975 gbsyn3.seq
249993942 gbsyn4.seq
249973892 gbsyn5.seq
249963517 gbsyn6.seq
135898060 gbsyn7.seq
249999888 gbtsa1.seq
249996639 gbtsa10.seq
249999168 gbtsa11.seq
127105887 gbtsa12.seq
249997835 gbtsa13.seq
249999221 gbtsa14.seq
249998017 gbtsa15.seq
249997884 gbtsa16.seq
167500778 gbtsa17.seq
249998217 gbtsa18.seq
250000150 gbtsa19.seq
249997963 gbtsa2.seq
249998775 gbtsa20.seq
249998636 gbtsa21.seq
249998457 gbtsa22.seq
249998315 gbtsa23.seq
30034786 gbtsa24.seq
249998710 gbtsa25.seq
249998636 gbtsa26.seq
249991951 gbtsa27.seq
249997904 gbtsa28.seq
250000251 gbtsa29.seq
249998332 gbtsa3.seq
249999084 gbtsa30.seq
204335460 gbtsa31.seq
249998534 gbtsa32.seq
249999961 gbtsa33.seq
249999936 gbtsa34.seq
249997768 gbtsa35.seq
249999157 gbtsa36.seq
249998098 gbtsa37.seq
249998715 gbtsa38.seq
249999115 gbtsa39.seq
250000057 gbtsa4.seq
15553749 gbtsa40.seq
249998020 gbtsa41.seq
249998684 gbtsa42.seq
249999831 gbtsa43.seq
249998532 gbtsa44.seq
249997114 gbtsa45.seq
249998215 gbtsa46.seq
249997456 gbtsa47.seq
155688166 gbtsa48.seq
249997344 gbtsa49.seq
83183501 gbtsa5.seq
249997941 gbtsa50.seq
249996156 gbtsa51.seq
249999083 gbtsa52.seq
249998677 gbtsa53.seq
172935945 gbtsa54.seq
250000247 gbtsa55.seq
249999708 gbtsa56.seq
249999356 gbtsa57.seq
249999756 gbtsa58.seq
250000031 gbtsa59.seq
249999109 gbtsa6.seq
249999361 gbtsa60.seq
22687922 gbtsa61.seq
249997173 gbtsa62.seq
249999729 gbtsa63.seq
250000141 gbtsa64.seq
249998385 gbtsa65.seq
249996693 gbtsa66.seq
249999173 gbtsa67.seq
249999990 gbtsa68.seq
249996036 gbtsa69.seq
249996202 gbtsa7.seq
128381210 gbtsa70.seq
249998532 gbtsa8.seq
249999947 gbtsa9.seq
486108 gbuna1.seq
249998427 gbvrl1.seq
249999520 gbvrl10.seq
165621259 gbvrl11.seq
249993743 gbvrl12.seq
249997548 gbvrl13.seq
249996976 gbvrl14.seq
249991350 gbvrl15.seq
249993971 gbvrl16.seq
249844634 gbvrl17.seq
249999266 gbvrl18.seq
249993875 gbvrl19.seq
249999513 gbvrl2.seq
148266556 gbvrl20.seq
249997872 gbvrl3.seq
249997214 gbvrl4.seq
191368692 gbvrl5.seq
249999338 gbvrl6.seq
249998887 gbvrl7.seq
249998197 gbvrl8.seq
249999975 gbvrl9.seq
249938560 gbvrt1.seq
249762539 gbvrt10.seq
249940020 gbvrt11.seq
185678776 gbvrt12.seq
249995062 gbvrt13.seq
249964366 gbvrt14.seq
249996404 gbvrt15.seq
249998282 gbvrt16.seq
249998297 gbvrt17.seq
250000127 gbvrt18.seq
98577409 gbvrt19.seq
249995736 gbvrt2.seq
249995733 gbvrt20.seq
249997104 gbvrt21.seq
249979155 gbvrt22.seq
249999872 gbvrt23.seq
249999859 gbvrt24.seq
249999045 gbvrt25.seq
83838791 gbvrt26.seq
249934937 gbvrt3.seq
249768425 gbvrt4.seq
100497394 gbvrt5.seq
249996380 gbvrt6.seq
249995207 gbvrt7.seq
249833417 gbvrt8.seq
249951536 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 64162 86080328
BCT10 64 115520696
BCT11 93 115223175
BCT12 93 109185533
BCT13 7793 113444113
BCT14 8338 10075530
BCT15 53933 85390803
BCT16 93 110189094
BCT17 151 93915681
BCT18 61 112455059
BCT19 52 112042350
BCT2 4948 109068556
BCT20 46 114233015
BCT21 58 114931588
BCT22 67 111284815
BCT23 36 96325907
BCT24 40 106881287
BCT25 58 105533856
BCT26 74 111675186
BCT27 55 110045255
BCT28 63 106845575
BCT29 55 109391288
BCT3 52 112655257
BCT30 53 108650404
BCT31 46 110496749
BCT32 95 109522868
BCT33 59 110966729
BCT34 67 108616570
BCT35 124 106350090
BCT36 36 69419425
BCT37 202 109105429
BCT38 51 109861512
BCT39 40 106911174
BCT4 55 106656794
BCT40 54 104252121
BCT41 58 107350200
BCT42 44 110960713
BCT43 80 107599606
BCT44 52 108571742
BCT45 46 107138318
BCT46 63 108219635
BCT47 79 107098072
BCT48 62 73603411
BCT49 68 110616305
BCT5 38315 81647768
BCT50 66 105738712
BCT51 49 103628191
BCT52 53 107838942
BCT53 54 107298795
BCT54 66 110212402
BCT55 63 106817738
BCT56 51 108471276
BCT57 60 113686383
BCT58 68 109914717
BCT59 48 109532317
BCT6 39042 82648391
BCT60 61 90279038
BCT61 40 109701549
BCT62 52 113982100
BCT63 83 116758809
BCT64 220 98340538
BCT65 389 55259308
BCT66 1589 2511877
BCT67 3179 5215895
BCT68 6347 7901828
BCT69 12648 15076979
BCT7 5522 96143938
BCT70 25628 27748204
BCT71 50523 53996220
BCT72 76351 77609712
BCT73 71503 77181395
BCT74 9524 94049884
BCT75 5590 104225809
BCT76 3050 104489120
BCT77 65 115712583
BCT78 4225 110939141
BCT79 21695 99799637
BCT8 13867 90150583
BCT80 22504 23359041
BCT81 68103 85895421
BCT82 31596 111221264
BCT83 76398 79491548
BCT84 64653 85585361
BCT85 21105 40373993
BCT9 6748 96304913
ENV1 94213 70705785
ENV10 83201 87256788
ENV11 20310 17512135
ENV12 84823 80873858
ENV13 120494 43465331
ENV14 88806 78124204
ENV15 96617 67733009
ENV16 96143 63502826
ENV17 112423 66792917
ENV18 112950 70114238
ENV19 51886 70059059
ENV2 91585 69030501
ENV20 68113 87692396
ENV21 91170 74656692
ENV22 128361 34412396
ENV23 123053 29095263
ENV24 77642 17797356
ENV25 123134 49867851
ENV26 97603 67837218
ENV27 115950 56102521
ENV28 136476 52688249
ENV29 110004 58709432
ENV3 85163 75461795
ENV30 56068 46860816
ENV31 71058 96548027
ENV32 95504 69634320
ENV33 105832 43038437
ENV34 90015 65250644
ENV35 58832 38488756
ENV36 111420 47249247
ENV37 102063 61145968
ENV38 107479 64238692
ENV39 66718 95281124
ENV4 81850 84109517
ENV40 76838 85407221
ENV41 63898 86835521
ENV42 80136 85233862
ENV43 109372 47853380
ENV44 113829 56804287
ENV45 104169 61243608
ENV46 29564 22854086
ENV47 98105 43605859
ENV48 42795 53982085
ENV49 42416 55310678
ENV5 87667 86739492
ENV50 62894 61534026
ENV51 103562 56109276
ENV52 95970 67690424
ENV53 6211 6259708
ENV6 99659 61449435
ENV7 131779 31253773
ENV8 86336 70531906
ENV9 93292 72987644
EST1 158932 61578479
EST10 167384 72121450
EST100 232216 141229287
EST101 239049 125498755
EST102 191374 104203328
EST103 183073 101721433
EST104 100126 70188276
EST105 160250 119698853
EST106 172068 105366985
EST107 134990 84867353
EST108 64419 24043353
EST109 63773 22429095
EST11 169596 74019620
EST110 64301 23297395
EST111 64313 27058057
EST112 64822 23116602
EST113 65042 24777934
EST114 63924 27190827
EST115 64306 26428083
EST116 64500 27441777
EST117 64330 25261011
EST118 61689 34861993
EST119 142728 68764528
EST12 166774 70072448
EST120 160952 85082333
EST121 177247 92936236
EST122 149335 96411791
EST123 156344 91876388
EST124 120667 78448680
EST125 189547 90842635
EST126 156020 83044793
EST127 157432 84537112
EST128 156646 84683208
EST129 151526 85005646
EST13 72698 34849615
EST130 173194 92948381
EST131 183307 116945010
EST132 202644 102517014
EST133 159215 87090253
EST134 162949 82933097
EST135 142152 83534492
EST136 144874 89606793
EST137 100368 53537057
EST138 173661 98097819
EST139 245088 113014563
EST14 217838 109343769
EST140 154481 83530524
EST141 167281 92280675
EST142 150583 88021841
EST143 133673 81794901
EST144 154305 96690704
EST145 156263 85815443
EST146 124519 63480525
EST147 121486 65239362
EST148 128033 57985231
EST149 127406 51289631
EST15 168614 105338224
EST150 128746 51310533
EST151 114469 42656777
EST152 163868 82710511
EST153 176184 73808792
EST154 162268 110248270
EST155 200071 122703022
EST156 214234 121749827
EST157 175555 97199900
EST158 154925 108273694
EST159 141883 95228538
EST16 178896 112376702
EST160 154957 96144529
EST161 157570 82600116
EST162 139422 78454384
EST163 167646 93244672
EST164 71350 44389422
EST165 149811 91582172
EST166 191842 110270364
EST167 145792 83952102
EST168 142903 72445668
EST169 149074 87099616
EST17 195365 112888403
EST170 190815 104735686
EST171 156517 95970823
EST172 168611 82506591
EST173 125253 86481925
EST174 170276 99777392
EST175 173366 100656755
EST176 122297 68060030
EST177 156951 90277178
EST178 36435 21155183
EST179 169618 102489444
EST18 190600 121507798
EST180 180469 118990336
EST181 143358 116905604
EST182 196491 100136090
EST183 153069 103373147
EST184 154688 101408291
EST185 141172 81675743
EST186 176164 71359078
EST187 150729 84635825
EST188 157698 99727963
EST189 156026 96178675
EST19 159450 114180730
EST190 139836 83260089
EST191 162580 98242763
EST192 145211 92961851
EST193 128726 90041346
EST194 144593 88309627
EST195 135536 88230552
EST196 129452 92543992
EST197 162243 86661813
EST198 173907 95675577
EST199 173405 96487211
EST2 161860 61550624
EST20 186883 99412580
EST200 171644 95246748
EST201 168922 95195497
EST202 171337 95774906
EST203 173197 95031021
EST204 173938 95718287
EST205 27882 15128157
EST206 188685 105126478
EST207 204877 104651788
EST208 172463 102202121
EST209 180099 101691680
EST21 217103 106393398
EST210 200705 122501280
EST211 194157 112118853
EST212 193510 123876517
EST213 157228 103960657
EST214 218812 141916539
EST215 236736 114648394
EST216 145565 103218147
EST217 162226 109301975
EST218 147330 94845693
EST219 177610 98529905
EST22 198877 65990714
EST220 189865 118167864
EST221 111651 87750757
EST222 134717 121226788
EST223 160155 93104966
EST224 148125 95196766
EST225 195149 107691572
EST226 166256 104042756
EST227 134210 92480729
EST228 142126 105317535
EST229 120942 87056348
EST23 141018 40099130
EST230 89638 60475626
EST231 144652 89900997
EST232 132134 93891419
EST233 142317 101310212
EST234 120118 86587828
EST235 125365 84225893
EST236 155510 107959167
EST237 159403 115443099
EST238 119508 122109899
EST239 147901 88896939
EST24 103790 28102413
EST240 184180 119214969
EST241 151711 92267105
EST242 170272 107791482
EST243 168054 121398572
EST244 145113 107989812
EST245 12971 9678788
EST246 155326 99989843
EST247 211413 97479907
EST248 187717 111530409
EST249 152176 86808506
EST25 121275 50794232
EST250 220342 27649171
EST251 221258 90060306
EST252 163443 120935271
EST253 174677 102290813
EST254 161984 107654996
EST255 175937 115401707
EST256 156199 114473783
EST257 99499 53922294
EST258 185660 97472528
EST259 177331 104386043
EST26 213566 97094574
EST260 166017 119646227
EST261 213482 102960447
EST262 271899 118992630
EST263 210078 121329321
EST264 182172 40491392
EST265 244678 112790883
EST266 168758 97452125
EST267 168109 105525988
EST268 91815 57379176
EST269 165531 113935582
EST27 219263 110239962
EST270 198830 103245559
EST271 155624 106032716
EST272 195444 114980818
EST273 197340 49946108
EST274 208517 42424059
EST275 181446 103176132
EST276 169950 114892587
EST277 185717 115670542
EST278 181695 109078782
EST279 156905 101673582
EST28 190467 88601230
EST280 107841 37344621
EST281 143437 86877223
EST282 119164 79296267
EST283 155950 106083791
EST284 247076 37086158
EST285 263884 24185103
EST286 168415 90796834
EST287 167479 109886923
EST288 160595 103952503
EST289 147149 91760601
EST29 158040 68888392
EST290 263043 38157658
EST291 175731 96471944
EST292 66520 50120975
EST293 194329 110878674
EST294 143252 78825666
EST295 183170 119136871
EST296 183197 112461528
EST297 153683 111903121
EST298 192137 107429859
EST299 177874 99893228
EST3 153644 54437600
EST30 171553 69641748
EST300 174773 110155639
EST301 188995 63437396
EST302 187078 69016528
EST303 187611 72818786
EST304 125214 45373251
EST305 191230 89846078
EST306 181275 127352574
EST307 158963 92977616
EST308 155334 90429819
EST309 127297 99048519
EST31 148836 63210737
EST310 148700 98828921
EST311 165608 100460210
EST312 164646 92448828
EST313 171502 102942707
EST314 150258 99210294
EST315 150184 101493034
EST316 164803 107898001
EST317 149771 103689492
EST318 180085 152161556
EST319 173044 113514303
EST32 168367 76122216
EST320 141883 76119370
EST321 143240 97613552
EST322 144927 99502657
EST323 132590 89349450
EST324 149633 99767529
EST325 150477 102011689
EST326 177873 111144016
EST327 151506 83743122
EST328 150733 86371983
EST329 151967 107655438
EST33 173906 66567681
EST330 156361 97008880
EST331 75681 45956729
EST332 142968 90532883
EST333 142929 89593066
EST334 209440 112527130
EST335 130092 71832987
EST336 92275 55615610
EST337 131689 87120460
EST338 137935 87525775
EST339 124440 79213874
EST34 122965 43326123
EST340 167383 85570246
EST341 212777 84744392
EST342 166953 88179181
EST343 175088 104703910
EST344 161773 96782545
EST345 83522 55747465
EST346 133360 88905721
EST347 136677 89442710
EST348 190452 121408611
EST349 157008 96398834
EST35 97391 29892325
EST350 162320 81745164
EST351 185155 130451837
EST352 109805 74759981
EST353 73473 43625440
EST354 142284 79069193
EST355 130779 78156939
EST356 150483 53762921
EST357 158498 32718808
EST358 158573 32533413
EST359 184296 113495154
EST36 97797 30582586
EST360 5944 4240922
EST361 229390 116859858
EST362 250944 114663016
EST363 197334 103799271
EST364 146743 94472859
EST365 136180 87024305
EST366 147045 87147523
EST367 184176 114018990
EST368 226122 77353113
EST369 186892 101073109
EST37 96710 29348028
EST370 218905 121337885
EST371 151563 82314691
EST372 142507 68433019
EST373 199233 122171561
EST374 157519 99832226
EST375 170798 130274295
EST376 182956 145228897
EST377 156546 92572171
EST378 164006 104988610
EST379 187202 110523212
EST38 98629 29837400
EST380 204906 111409963
EST381 194291 108828240
EST382 194308 119343915
EST383 125727 85044258
EST384 198427 131830846
EST385 217600 135159191
EST386 205354 145904795
EST387 212892 163640002
EST388 183880 102530994
EST389 197353 112297908
EST39 99434 31229774
EST390 171286 27391125
EST391 161919 13428167
EST392 156606 22685352
EST393 158379 32997219
EST394 159072 31337631
EST395 55864 11768444
EST396 148102 86461114
EST397 182280 108234299
EST398 163132 112984807
EST399 167467 97716955
EST4 170812 67108330
EST40 23076 5878878
EST400 153312 105825247
EST401 140402 97828221
EST402 144760 95397091
EST403 169649 115356572
EST404 144020 100951684
EST405 174765 103245347
EST406 172427 39945743
EST407 165924 54733358
EST408 145525 101972834
EST409 161718 102245438
EST41 101025 52987591
EST410 166833 108337388
EST411 146842 87896829
EST412 196333 118509890
EST413 148879 102218512
EST414 133043 91209877
EST415 148050 92560237
EST416 157439 94648882
EST417 172254 93463866
EST418 165951 97433605
EST419 160408 95293501
EST42 119533 50861384
EST420 173374 106250071
EST421 140211 88340943
EST422 3222 2352708
EST423 100982 72232372
EST424 79364 60984652
EST425 106713 70193438
EST426 157348 86185580
EST427 126609 77274050
EST428 138419 90773398
EST429 141557 83185898
EST43 165833 91749823
EST430 166222 97085662
EST431 157058 87718862
EST432 195619 116483683
EST433 128248 85149841
EST434 184319 95268657
EST435 182259 89097858
EST436 158984 88820755
EST437 6764 4158502
EST438 169306 98874762
EST439 218749 127919676
EST44 170254 72255064
EST440 162392 110852156
EST441 167018 102578121
EST442 139959 90695380
EST443 136087 92151576
EST444 179446 79397611
EST445 189617 80345705
EST446 205876 86982162
EST447 201312 81493580
EST448 185050 104291938
EST449 124260 72424615
EST45 167198 84830922
EST450 206089 117628498
EST451 182198 112973501
EST452 178651 105126404
EST453 204660 124535646
EST454 137220 96354805
EST455 171931 106093648
EST456 176670 90431009
EST457 152926 86853240
EST458 165186 81815547
EST459 163132 58562700
EST46 168551 86869652
EST460 165424 62323855
EST461 45229 16088356
EST47 163230 87813268
EST48 162128 83269409
EST49 160116 91087098
EST5 168996 66194437
EST50 161625 88116218
EST51 157094 98901838
EST52 159519 69790594
EST53 145842 81630665
EST54 78052 50559365
EST55 167014 69863326
EST56 164649 74766409
EST57 164313 90712748
EST58 159162 97164593
EST59 156445 101474952
EST6 171504 66930687
EST60 164599 98904437
EST61 160080 107988987
EST62 171064 81471700
EST63 173205 92438726
EST64 155564 84205658
EST65 148960 81892229
EST66 158939 98557318
EST67 136005 77105049
EST68 149391 91669478
EST69 194646 107924049
EST7 169836 72796204
EST70 180856 95084462
EST71 221056 121160612
EST72 185403 110480451
EST73 204179 121541284
EST74 163378 90078078
EST75 133985 61439025
EST76 139684 68748140
EST77 154630 93999495
EST78 157915 100353546
EST79 141961 78477477
EST8 179388 72855972
EST80 52901 24643225
EST81 164341 100577778
EST82 212015 114868978
EST83 223666 123667556
EST84 200284 94211847
EST85 211020 93283331
EST86 162181 92865248
EST87 144102 86825952
EST88 164167 81090941
EST89 158119 79855149
EST9 168560 69305073
EST90 152928 102062112
EST91 152072 88946380
EST92 135050 87111324
EST93 156082 113065452
EST94 142345 104168873
EST95 143183 102383840
EST96 141176 97543929
EST97 147010 80970712
EST98 178650 111235772
EST99 225716 136688083
GSS1 200062 87617305
GSS10 132040 60283336
GSS100 145362 114337340
GSS101 141643 116113759
GSS102 143263 116656493
GSS103 167238 128921102
GSS104 149783 82569304
GSS105 191527 120854119
GSS106 167747 112125081
GSS107 197328 115524481
GSS108 204975 134770173
GSS109 209812 138225285
GSS11 137026 73963213
GSS110 207577 140849031
GSS111 206236 142443188
GSS112 205251 143737895
GSS113 205176 143937947
GSS114 202120 146641028
GSS115 182321 139890075
GSS116 18414 10874742
GSS117 132848 84052151
GSS118 169611 80019194
GSS119 184271 79450634
GSS12 147892 75892246
GSS120 170296 148327490
GSS121 177223 120247442
GSS122 184849 149514379
GSS123 192486 124724450
GSS124 187593 137833036
GSS125 192178 126797998
GSS126 190607 95460230
GSS127 166251 152986683
GSS128 164115 115658040
GSS129 66249 42508121
GSS13 145394 68606713
GSS130 171037 155489454
GSS131 172571 154290391
GSS132 172231 155358474
GSS133 173848 154157454
GSS134 172390 153324435
GSS135 184233 143887127
GSS136 182583 147198604
GSS137 163082 115404420
GSS138 206481 88587184
GSS139 265738 40933031
GSS14 169809 84775223
GSS140 265732 40962041
GSS141 57710 8854914
GSS142 256185 58367796
GSS143 253136 60903252
GSS144 193384 82083564
GSS145 194899 73133724
GSS146 185020 152902506
GSS147 179265 156889003
GSS148 172604 159200600
GSS149 193906 127560270
GSS15 161099 97662972
GSS150 245528 58765606
GSS151 210577 101885451
GSS152 92169 20153568
GSS153 87113 63992234
GSS154 83556 62806277
GSS155 103676 48621279
GSS156 68586 58475820
GSS157 7685 7033032
GSS158 68591 57924394
GSS159 69224 56650935
GSS16 172836 87033449
GSS160 69460 56187403
GSS161 71202 55998401
GSS162 68561 51865315
GSS163 75915 58209304
GSS164 87237 74898207
GSS165 81830 44609896
GSS166 92262 44834024
GSS167 63624 47799159
GSS168 77435 61351403
GSS169 69655 58699293
GSS17 183522 113500748
GSS170 67711 62706526
GSS171 61946 53348157
GSS172 95612 42935517
GSS173 21104 4920928
GSS174 112937 70876701
GSS175 823 560132
GSS176 23226 28867035
GSS177 109043 70652585
GSS178 84533 34668223
GSS179 35815 22222733
GSS18 192358 114306485
GSS180 103304 62490220
GSS181 102329 63761256
GSS182 104268 67656826
GSS183 82099 41276456
GSS184 83102 54651503
GSS185 95673 61335435
GSS186 107323 78547443
GSS187 106375 76684757
GSS188 106058 79947480
GSS189 103996 80016519
GSS19 114078 52104778
GSS190 76374 51039123
GSS191 104572 63292187
GSS192 109868 66415305
GSS193 106205 59313311
GSS194 68379 37446344
GSS195 69573 38736929
GSS196 37145 17774305
GSS197 85481 46023427
GSS198 97119 55907586
GSS199 94982 49597190
GSS2 182294 92190593
GSS20 181789 101771260
GSS200 96286 55922591
GSS201 42132 23615490
GSS202 114638 43642267
GSS203 117085 39368203
GSS204 108676 55514545
GSS205 101471 78372335
GSS206 71604 45899517
GSS207 95891 36542252
GSS208 95417 37268709
GSS209 96671 35161518
GSS21 166208 114173594
GSS210 94285 39167432
GSS211 37736 17626556
GSS212 103939 66277823
GSS213 94551 61190929
GSS214 95128 60357048
GSS215 94773 60868501
GSS216 75675 70017159
GSS217 75117 74330280
GSS218 4473 7127270
GSS219 83736 28233267
GSS22 169506 97609042
GSS220 84219 27346468
GSS221 84926 25909272
GSS222 14851 4422302
GSS223 16547 7508221
GSS224 92377 59458826
GSS225 84657 52502700
GSS226 94076 50770605
GSS227 88581 48350254
GSS228 10980 5983348
GSS229 90648 56882510
GSS23 187251 126687349
GSS230 89662 61882079
GSS231 88553 63641206
GSS232 89283 62505584
GSS233 9890 7129098
GSS234 87995 63795538
GSS235 90217 62488977
GSS236 94643 59915214
GSS237 74331 63055090
GSS238 84246 78879440
GSS239 83027 80589521
GSS24 194057 130219707
GSS240 70483 52650376
GSS241 117650 64297121
GSS242 108874 55446727
GSS243 107533 52125503
GSS244 96658 43251344
GSS245 109801 49060015
GSS246 98194 46325477
GSS247 73059 72225597
GSS248 76682 71142435
GSS249 72980 46435649
GSS25 177481 105207105
GSS250 94787 57200301
GSS251 93517 59081345
GSS252 93900 58510429
GSS253 94714 57307691
GSS254 94197 58070562
GSS255 10381 4888399
GSS26 185918 107808246
GSS27 170600 151419573
GSS28 190494 146229226
GSS29 151147 106441309
GSS3 174946 87827370
GSS30 192451 132131298
GSS31 13629 8773195
GSS32 196044 127318947
GSS33 216659 116231837
GSS34 218573 113602417
GSS35 219720 112025390
GSS36 213958 121897898
GSS37 198560 156434224
GSS38 194984 146797396
GSS39 197244 73372753
GSS4 167155 85101061
GSS40 185067 97681159
GSS41 189782 125958599
GSS42 170343 158770231
GSS43 9057 5889153
GSS44 183999 100320381
GSS45 173032 121667203
GSS46 185089 124655109
GSS47 190835 122398633
GSS48 70733 62564650
GSS49 171799 101963548
GSS5 53445 31617730
GSS50 167647 103037030
GSS51 167798 102616122
GSS52 184194 121477291
GSS53 184774 116632196
GSS54 181686 122485290
GSS55 187531 113994336
GSS56 189392 134519036
GSS57 178947 104938173
GSS58 195714 120562148
GSS59 179925 133347010
GSS6 161617 84471320
GSS60 1899 1719195
GSS61 172844 138948397
GSS62 161635 111553347
GSS63 161673 111572480
GSS64 158827 107592995
GSS65 156768 129062324
GSS66 170185 142553826
GSS67 179844 117096102
GSS68 204911 127968663
GSS69 193332 110756601
GSS7 165322 79361222
GSS70 243921 125965583
GSS71 160206 106329772
GSS72 159349 119781671
GSS73 162663 124539163
GSS74 162629 124600831
GSS75 175106 108958250
GSS76 190310 140120691
GSS77 13118 7645896
GSS78 199135 126616367
GSS79 170370 111603100
GSS8 165782 88979718
GSS80 200718 131518447
GSS81 211575 85835271
GSS82 187842 98659368
GSS83 131802 92017231
GSS84 146986 118083551
GSS85 139587 116995322
GSS86 142817 114062378
GSS87 144008 119847686
GSS88 141842 115691442
GSS89 106718 88926972
GSS9 137999 67157765
GSS90 149425 122240891
GSS91 147663 117692857
GSS92 143995 113064403
GSS93 142869 115422868
GSS94 144203 119656289
GSS95 148069 121684067
GSS96 147696 117745472
GSS97 146077 121054040
GSS98 146145 120923099
GSS99 146569 120073651
HTC1 25057 27045808
HTC10 54086 70649526
HTC11 81570 70440536
HTC12 4578 5328118
HTC13 66993 60073171
HTC14 68556 69499762
HTC15 23915 16110324
HTC2 16086 36243320
HTC3 16029 36627693
HTC4 16251 35560357
HTC5 15980 40344457
HTC6 16068 37474845
HTC7 53834 31477922
HTC8 31137 19451907
HTC9 60867 78012683
HTG1 1318 188771164
HTG10 1298 186340737
HTG100 990 189440077
HTG101 996 189331054
HTG102 985 189419172
HTG103 1161 190585510
HTG104 30 4314892
HTG105 1087 189830459
HTG106 1045 189717260
HTG107 1388 191466263
HTG108 1297 190889828
HTG109 1631 191092465
HTG11 6 837687
HTG110 1345 192062486
HTG111 1298 191976235
HTG112 1307 190136719
HTG113 1057 186193849
HTG114 787 126039234
HTG115 1507 182670439
HTG116 1000 191646810
HTG117 928 180615941
HTG118 1077 193771910
HTG119 1103 193021003
HTG12 1452 184004673
HTG120 225 42236728
HTG121 1029 189520679
HTG122 1054 192676832
HTG123 1164 192084660
HTG124 1083 192945775
HTG125 1083 192937725
HTG126 590 104030016
HTG127 1122 192568597
HTG128 1080 192404608
HTG129 1078 192329473
HTG13 875 191786413
HTG130 1167 192001881
HTG131 1561 191903933
HTG132 1069 192200929
HTG133 1070 192324820
HTG134 1129 191775935
HTG135 1434 188074063
HTG136 410 54193644
HTG14 753 191921309
HTG15 745 191963148
HTG16 785 191933231
HTG17 796 191351096
HTG18 775 192103394
HTG19 2069 170638342
HTG2 2470 186037380
HTG20 1096 187413748
HTG21 887 180042173
HTG22 785 191651644
HTG23 928 190141652
HTG24 907 190491600
HTG25 811 191323929
HTG26 784 191771279
HTG27 874 191079273
HTG28 896 190515178
HTG29 939 189959636
HTG3 2513 185208586
HTG30 911 190941779
HTG31 841 171449145
HTG32 875 191097680
HTG33 968 189501635
HTG34 884 191025385
HTG35 868 191276405
HTG36 825 191702609
HTG37 949 189868158
HTG38 949 190351720
HTG39 940 190045229
HTG4 2550 188439001
HTG40 1049 189067591
HTG41 1089 167537350
HTG42 1256 188119418
HTG43 1169 188010117
HTG44 1150 188080035
HTG45 1117 191232412
HTG46 1269 190634433
HTG47 1176 190820695
HTG48 1128 191224702
HTG49 1046 191244150
HTG5 1283 185453274
HTG50 1030 189619303
HTG51 1042 178756613
HTG52 968 190052338
HTG53 1105 190148899
HTG54 1046 190158403
HTG55 1014 189831932
HTG56 969 189170679
HTG57 81 14306584
HTG58 1010 189338312
HTG59 1031 189990377
HTG6 1273 185124562
HTG60 1078 187304761
HTG61 1125 188306505
HTG62 988 170992054
HTG63 1085 189487801
HTG64 1064 189415560
HTG65 1169 188798107
HTG66 1179 187545797
HTG67 1282 184397923
HTG68 94 12194080
HTG69 1221 185314622
HTG7 1276 185375030
HTG70 1239 184674446
HTG71 1244 184625496
HTG72 1183 187688486
HTG73 1019 170126516
HTG74 1118 188293510
HTG75 1103 190775743
HTG76 1135 190789237
HTG77 1182 190871034
HTG78 1096 185997580
HTG79 1171 190202119
HTG8 1459 184608562
HTG80 1115 190063261
HTG81 1213 189874691
HTG82 1120 189645029
HTG83 959 164682536
HTG84 1229 188409093
HTG85 1250 187741728
HTG86 1141 189879061
HTG87 1144 189686641
HTG88 978 167870813
HTG89 1182 189961005
HTG9 1200 186916809
HTG90 1104 190233697
HTG91 1146 190217975
HTG92 1109 190471215
HTG93 962 159420591
HTG94 1056 190751235
HTG95 1160 190986098
HTG96 1031 189156227
HTG97 1071 189497493
HTG98 684 127508859
HTG99 1018 189641315
INV1 94030 48425184
INV10 58410 86358231
INV11 83450 65367671
INV12 55761 44093490
INV13 84914 66260819
INV14 80842 66937694
INV15 78403 68066612
INV16 45955 42207642
INV17 33789 109968824
INV18 2848 147829211
INV19 47139 107525912
INV2 20175 157140059
INV20 77367 55604224
INV21 69166 59605112
INV22 20263 125328512
INV23 6 133712559
INV24 53996 99286268
INV25 79019 53690720
INV26 24490 18580231
INV27 79338 56093644
INV28 78405 61339525
INV29 71848 45444078
INV3 1591 157167189
INV30 30770 73804443
INV4 3882 133970248
INV5 78846 73618689
INV6 55455 96067466
INV7 53617 88152477
INV8 5327 4862617
INV9 80576 71773092
MAM1 15788 161831171
MAM2 20030 157499285
MAM3 58763 82886123
MAM4 8181 184063878
MAM5 79439 74704525
MAM6 52115 121062132
MAM7 72484 64821841
MAM8 982 1010908
PAT1 222552 70120341
PAT10 124455 102575240
PAT100 178185 3385515
PAT101 132610 2848492
PAT102 342935 8573375
PAT103 188806 88519660
PAT104 111348 132068608
PAT105 3850 194703659
PAT106 131292 110979300
PAT107 158599 54826034
PAT108 224730 34113420
PAT109 250080 15844360
PAT11 98617 64109656
PAT110 180680 63677151
PAT111 51648 26046194
PAT112 114183 110462028
PAT113 137705 83279098
PAT114 164161 99347886
PAT115 158877 103325984
PAT116 137417 114988187
PAT117 42311 27994848
PAT118 193712 81686401
PAT119 150217 108404022
PAT12 142065 62828791
PAT120 356051 11379688
PAT121 257211 57607099
PAT122 138161 48226925
PAT123 322021 22795469
PAT124 155639 102753887
PAT125 132727 110696284
PAT126 128341 121313309
PAT127 21664 184390005
PAT128 144888 112900567
PAT129 171997 96403773
PAT13 105888 59875034
PAT130 44618 171217879
PAT131 9167 47581637
PAT132 33645 178334734
PAT133 153558 109675196
PAT134 178705 90913377
PAT135 136049 115324159
PAT136 120392 123342367
PAT137 8527 8992390
PAT138 155429 101473147
PAT139 184764 88815933
PAT14 103642 50160321
PAT140 182409 85292093
PAT141 158459 76051815
PAT142 203662 47737230
PAT143 277828 9627968
PAT144 220409 46465135
PAT145 106719 2881142
PAT146 270386 21672571
PAT147 186751 61239638
PAT148 109801 106056999
PAT149 47516 9550419
PAT15 121148 53317075
PAT150 87299 88249520
PAT151 78465 95588128
PAT152 145199 77694828
PAT153 167500 71382695
PAT154 121465 92942668
PAT155 102978 85383928
PAT156 165566 46016231
PAT157 270022 5130418
PAT158 269978 5129582
PAT159 269978 5129582
PAT16 113137 61274458
PAT160 237888 4519872
PAT161 269396 5118524
PAT162 235480 25575098
PAT163 203734 47154417
PAT164 12033 422577
PAT165 165317 74871979
PAT166 91686 126656173
PAT167 172589 71662882
PAT168 137861 72260460
PAT169 9532 13982682
PAT17 39159 16235508
PAT170 93111 87244841
PAT171 91681 79829797
PAT172 83213 91467896
PAT173 109151 53717404
PAT174 137256 66884705
PAT175 91439 135332665
PAT176 160046 76731776
PAT177 219126 42906029
PAT178 107286 49462344
PAT18 146771 52594264
PAT19 153705 78039102
PAT2 194525 84650653
PAT20 104995 118172564
PAT21 133550 95503155
PAT22 84598 79322013
PAT23 123563 103405415
PAT24 119415 105656371
PAT25 145486 86670068
PAT26 175165 64299073
PAT27 71371 1784275
PAT28 102171 77387698
PAT29 93955 87644560
PAT3 171981 95897120
PAT30 119942 61673191
PAT31 96645 78968068
PAT32 128387 55025904
PAT33 92210 51123413
PAT34 111297 78150994
PAT35 138100 29119820
PAT36 158503 24081830
PAT37 114681 49019496
PAT38 44867 54579973
PAT39 95732 83191686
PAT4 153748 106056406
PAT40 100232 70984798
PAT41 136206 39303264
PAT42 143774 35446826
PAT43 123731 64736974
PAT44 104361 81207665
PAT45 93445 74211542
PAT46 113255 66591457
PAT47 65218 54831902
PAT48 135193 108001084
PAT49 167081 97032398
PAT5 57146 23927792
PAT50 116397 127555645
PAT51 196343 76722711
PAT52 80302 127991032
PAT53 27631 180872621
PAT54 185408 93066629
PAT55 274259 6856475
PAT56 129447 31627433
PAT57 161320 77719729
PAT58 92811 89402778
PAT59 106516 74782837
PAT6 170642 91909261
PAT60 122361 64031080
PAT61 67427 30298000
PAT62 70750 109767817
PAT63 87947 82758966
PAT64 92971 78937516
PAT65 93166 72441718
PAT66 93384 75085880
PAT67 115775 60531183
PAT68 102736 9941783
PAT69 175933 10547809
PAT7 154777 88234848
PAT70 171510 10872561
PAT71 171496 10866737
PAT72 99859 86225043
PAT73 99 196466297
PAT74 67 192869889
PAT75 103 195600591
PAT76 1137 196318757
PAT77 97599 5772236
PAT78 151009 9636510
PAT79 151022 9621259
PAT8 131210 96916575
PAT80 151024 9622125
PAT81 151021 9620837
PAT82 94633 88060720
PAT83 93689 93464843
PAT84 34072 33980702
PAT85 83459 93185861
PAT86 15570 180450165
PAT87 164898 19209900
PAT88 178944 3399936
PAT89 177434 3371246
PAT9 129384 101126296
PAT90 175305 3330795
PAT91 101391 1926429
PAT92 169171 12412246
PAT93 178699 3395281
PAT94 178691 3395129
PAT95 178677 3394863
PAT96 140780 2674820
PAT97 178683 3394977
PAT98 178342 3388498
PAT99 178198 3385762
PHG1 6491 76133941
PLN1 59913 93484134
PLN10 73070 75870744
PLN11 37424 49319698
PLN12 40274 65682533
PLN13 22520 123858969
PLN14 21104 99666209
PLN15 17578 144865462
PLN16 17634 146278605
PLN17 17564 146392665
PLN18 24636 128667828
PLN19 6000 149205408
PLN2 43093 112069053
PLN20 1266 170315035
PLN21 14133 155912002
PLN22 7127 8366760
PLN23 67254 69760900
PLN24 29374 31573527
PLN25 76952 76375515
PLN26 65428 81393596
PLN27 44752 113983780
PLN28 42 85481108
PLN29 12 89108600
PLN3 1365 175807729
PLN30 1105 146780237
PLN31 26200 129369586
PLN32 53176 99017179
PLN33 74531 77751661
PLN34 96678 54025462
PLN35 80386 71664752
PLN36 77898 75915989
PLN37 80012 70526751
PLN38 82166 75440715
PLN39 57726 31573435
PLN4 1806 185612416
PLN40 98608 55062825
PLN41 81868 69076883
PLN42 46045 98458875
PLN43 26654 123344127
PLN44 24992 131748389
PLN45 59373 56637024
PLN46 81582 72158051
PLN47 62521 82550375
PLN48 46248 95940195
PLN49 84620 62791229
PLN5 1873 193897887
PLN50 93467 60393156
PLN51 76116 76755699
PLN52 67885 81583272
PLN53 75729 72787010
PLN54 65638 82828990
PLN55 10004 21876904
PLN6 1694 194475169
PLN7 14096 158201938
PLN8 75669 79697544
PLN9 9723 10086297
PRI1 23017 59647552
PRI10 1272 179275558
PRI11 775 94029396
PRI12 1278 179183454
PRI13 1451 177770436
PRI14 1589 180081042
PRI15 1591 181937113
PRI16 1285 191720215
PRI17 1137 193666240
PRI18 1099 194310776
PRI19 1166 193657185
PRI2 18386 149285375
PRI20 1737 191818169
PRI21 2646 189791628
PRI22 16648 165526679
PRI23 4197 16004489
PRI24 31573 84616058
PRI25 61951 78207697
PRI26 31350 70628098
PRI27 8521 161801360
PRI28 2251 180645625
PRI29 1618 181509288
PRI3 1433 175278790
PRI30 2007 181705860
PRI31 1958 180727178
PRI32 13185 156524900
PRI33 1327 183635528
PRI34 41712 106643745
PRI35 22922 33120663
PRI36 32189 63608729
PRI37 20141 117697460
PRI38 18567 147180178
PRI39 66637 86857087
PRI4 1282 185555745
PRI40 49476 89674633
PRI41 40090 73818007
PRI42 45895 95119257
PRI43 21236 107095517
PRI44 60645 97495867
PRI45 95 1849462
PRI5 1325 184390308
PRI6 1180 179907324
PRI7 1246 180917243
PRI8 1212 178442526
PRI9 1367 174647124
ROD1 32911 139685926
ROD10 988 181377551
ROD11 239 45370799
ROD12 1034 185475616
ROD13 940 182703335
ROD14 1040 189324025
ROD15 950 180306408
ROD16 967 182057152
ROD17 991 185811349
ROD18 1189 190476978
ROD19 16761 153123318
ROD2 916 175508672
ROD20 20349 148361192
ROD21 1132 182075942
ROD22 1079 168189648
ROD23 13589 162647066
ROD24 38849 69272202
ROD25 21814 104561488
ROD26 1508 187599166
ROD27 134648 36929290
ROD28 84665 70585729
ROD29 56078 61772543
ROD3 906 173439055
ROD4 901 173910839
ROD5 921 174293473
ROD6 966 178089033
ROD7 969 179528121
ROD8 978 181261578
ROD9 993 181732614
STS1 85283 36763581
STS10 57907 44420267
STS11 48910 37503235
STS12 57924 43637361
STS13 64284 42850769
STS14 93606 34184225
STS15 104286 26517062
STS16 10116 2741066
STS17 103611 27476228
STS18 86929 34448302
STS19 99733 33367597
STS2 84354 49850025
STS20 54946 21015272
STS3 66846 26362760
STS4 76989 36945836
STS5 8457 4958885
STS6 54259 31650966
STS7 54162 31838227
STS8 54316 31957697
STS9 55716 37767321
SYN1 42774 77230624
SYN2 49398 68092607
SYN3 11297 159509957
SYN4 4599 176558803
SYN5 4596 176481519
SYN6 4600 176574698
SYN7 5730 91406667
TSA1 120472 38235688
TSA10 108480 37671630
TSA11 82649 29706806
TSA12 63000 19185998
TSA13 86486 70566494
TSA14 121991 38853496
TSA15 134870 35826510
TSA16 61036 79698424
TSA17 39468 53516874
TSA18 70282 97466599
TSA19 100897 57123531
TSA2 113532 41666458
TSA20 110668 52338593
TSA21 102984 53513191
TSA22 103695 52518403
TSA23 100966 47107597
TSA24 10786 6455891
TSA25 66573 59369298
TSA26 93236 68475106
TSA27 91230 65647744
TSA28 81583 80063334
TSA29 106309 44169463
TSA3 110396 41019325
TSA30 111906 40187704
TSA31 74352 59868448
TSA32 94911 35699810
TSA33 83189 31995816
TSA34 110188 45124503
TSA35 114753 50951737
TSA36 103616 51971055
TSA37 100207 56361687
TSA38 94449 65161201
TSA39 94183 70028525
TSA4 110949 45737681
TSA40 7555 2060048
TSA41 90902 71737996
TSA42 97659 54669853
TSA43 63227 108203943
TSA44 89918 77978879
TSA45 87807 65963439
TSA46 86501 67914552
TSA47 77483 79677214
TSA48 40419 62590589
TSA49 90931 66884444
TSA5 43179 10927440
TSA50 76043 84732155
TSA51 71912 78529712
TSA52 87476 82320347
TSA53 85577 88524564
TSA54 52282 74036179
TSA55 83432 74232816
TSA56 92894 50247879
TSA57 99796 54211962
TSA58 75921 66574803
TSA59 100099 60680015
TSA6 112457 59449948
TSA60 101952 51211507
TSA61 10383 4882421
TSA62 99281 63957845
TSA63 88688 72428374
TSA64 94761 54801841
TSA65 64452 76231537
TSA66 63187 106522299
TSA67 97306 76738816
TSA68 119366 49283699
TSA69 64143 75536862
TSA7 95611 66253193
TSA70 26123 41424160
TSA8 105744 68773673
TSA9 105928 64845351
UNA1 239 125812
VRL1 68000 69111339
VRL10 63739 70922566
VRL11 35161 49335789
VRL12 62840 71114135
VRL13 57409 72810185
VRL14 63333 65144477
VRL15 56981 73339527
VRL16 58036 71828142
VRL17 57087 71440499
VRL18 56541 72565031
VRL19 54703 74372382
VRL2 73436 64286574
VRL20 42809 41838740
VRL3 69820 60872960
VRL4 68448 69802524
VRL5 49830 52120412
VRL6 48193 77586401
VRL7 47199 72783245
VRL8 59487 73393468
VRL9 69158 66834206
VRT1 41751 123661295
VRT10 1256 189144082
VRT11 8274 177844568
VRT12 3994 136790703
VRT13 13095 170781188
VRT14 5348 182619924
VRT15 3936 186026494
VRT16 37596 134587584
VRT17 79811 68470121
VRT18 78293 66432750
VRT19 30908 24954989
VRT2 1924 193292342
VRT20 71345 77340392
VRT21 47242 120548901
VRT22 77529 63451720
VRT23 79408 61820374
VRT24 82261 56136815
VRT25 103632 65082902
VRT26 24107 23908914
VRT3 71806 78786905
VRT4 8447 170157397
VRT5 31318 27682745
VRT6 73011 66719150
VRT7 31732 63525748
VRT8 30652 111958169
VRT9 1202 189984871
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 189.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:
Entries Bases Species
19592636 16097851246 Homo sapiens
9696453 9972466215 Mus musculus
2187786 6514195133 Rattus norvegicus
2200303 5384282799 Bos taurus
3932778 5060128699 Zea mays
3285539 4884132947 Sus scrofa
1712969 3123157778 Danio rerio
257393 1435010041 Strongylocentrotus purpuratus
1348170 1254391972 Oryza sativa Japonica Group
1774072 1197076779 Nicotiana tabacum
1424382 1147263423 Xenopus (Silurana) tropicalis
2329477 1143557236 Arabidopsis thaliana
1229441 1084849933 Drosophila melanogaster
216600 1008269679 Pan troglodytes
766620 998781168 Vitis vinifera
1455547 950994954 Canis lupus familiaris
142432 926878984 Macaca mulatta
1902736 906521373 Glycine max
814914 899255531 Gallus gallus
1426357 896790717 Triticum aestivum
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
187 Dec 2011 135117731375 146413798
188 Feb 2012 137384889783 149819246
189 Apr 2012 139266481398 151824421
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
187 Dec 2011 239868309609 73729553
188 Feb 2012 261370512675 78656704
189 Apr 2012 272693351548 80905298
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
October 15 2010
NCBI-GenBank Flat File Release 189.0
Bacterial Sequences (Part 1)
51396 loci, 92682287 bases, from 51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
or 2010.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
April 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA).
Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
DBLINK Project:18787
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK Project:100,200,300
DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:
http://www.ncbi.nlm.nih.gov/genomes/static/gprj_help.html#introduction
As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 189.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Jianli Dai, Michel Eschenbrenner, Irene Fang,
Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Beverly Underwood,
Melissa Wright, and Linda Yankie
Data Management and Preparation
Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
Ilya Dondoshansky, WonHee Jang, Jonathan Kans, Leonid Khotomliansky,
Michael Kimelman, Jim Ostell, Denis Sinyakov, Karl Sirotkin,
Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov
Database Administration
Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
Ben Slade, Constantin Vasilyev
User Support
Peter Cooper, Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris,
Steve Pechous, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
