Release Notes For GenBank Release 190
GBREL.TXT Genetic Sequence Data Bank
June 15 2012
NCBI-GenBank Flat File Release 190.0
Distribution Release Notes
154130210 loci, 141343240755 bases, from 154130210 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 190.0
1.2 Cutoff Date
1.3 Important Changes in Release 190.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 190.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for GenBank's web-based submission tool (BankIt) :
http://www.ncbi.nlm.nih.gov/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 190.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:
http://www.bio-mirror.net/
1.2 Cutoff Date
This full release, 190.0, incorporates data available to the collaborating
databases as of June 15, 2012 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 190.0
1.3.1 New /pseudogene qualifier
A new controlled-vocabulary /pseudogene qualifier which had been under
discussion within the INSDC since the May 2011 collaborative INSD meeting
is now supported as of the June 2012 GenBank release. The goal of the new
qualifier is to use it for the annotation of certain well-defined classes
of pseudogenes. The new qualifier's definition is as follows:
Qualifier /pseudogene=
Definition indicates that this feature is a pseudogene of the element
named by the feature key
Value format "TYPE"
where TYPE is one of the following:
processed, unprocessed, unitary, allelic, unknown
Example /pseudogene="processed"
/pseudogene="unprocessed"
/pseudogene="unitary"
/pseudogene="allelic"
/pseudogene="unknown"
Comment TYPE is a term taken from the INSDC controlled vocabulary for
pseudogenes:
processed: the pseudogene has arisen by reverse transcription
of a mRNA into cDNA, followed by reintegration into the genome.
Therefore, it has lost any intron/exon structure, and it might
have a pseudo-polyA-tail.
unprocessed: the pseudogene has arisen from a copy of the parent
gene by duplication followed by accumulation of random mutations.
The changes, compared to their functional homolog, include
insertions, deletions, premature stop codons, frameshifts and a
higher proportion of non-synonymous versus synonymous
substitutions.
unitary: the pseudogene has no parent. It is the original gene,
which is functional is some species but disrupted in some way
(indels, mutation, recombination) in another species or strain.
allelic: a (unitary) pseudogene that is stable in the population
but importantly it has a functional alternative allele also in
the population. i.e., one strain may have the gene, another
strain may have the pseudogene. MHC haplotypes have allelic
pseudogenes.
unknown: the submitter does not know the method of
pseudogenisation.
1.3.2 Legacy /pseudo qualifier likely to remain in use
In the Upcoming Changes announcement for the April 2012 GenBank 189.0
release, mention was made that the /pseudo qualifier would be deprecated,
given that a new /pseudogene qualifier would be available. However, in
subsequent discussions during the June 2012 INSDC meeting, it was decided
that a mechanism is still needed to flag certain Gene and CDS features as
non-functional or problematic. Since agreement could not be reached for the
name of a qualifier, it was suggested that /pseudo should be preserved,
with an update to its definition in the Feature Table document.
Although this is not a "change" in the normal sense, the fact that /pseudo
will be retained, and its usage clarified, seem important enough to
warrant mention here.
1.3.3 New representation for Transcriptome Shotgun Assembly (TSA) records.
As announced in the GenBank 189.0 release notes, the very first TSA
(Transcriptome Shotgun Assembly) project processed using a WGS-like
approach was made available by FTP between 189.0 and 190.0 . In the
genbank/tsa directory of the NCBI FTP site you will now find these files:
-rw-r--r-- 1 gbupdate gbproces 95 May 16 01:54 stats.tsa.GAAA
-rw-r--r-- 1 gbupdate gbproces 18479033 May 16 01:53 tsa.GAAA.1.fsa_nt.gz
-rw-r--r-- 1 gbupdate gbproces 31652938 May 16 01:53 tsa.GAAA.1.gbff.gz
-rw-r--r-- 1 gbupdate gbproces 1057 May 16 01:53 tsa.GAAA.mstr.gbff.gz
-rw-r--r-- 1 gbupdate gbproces 12 May 16 01:54 tsa.proj_list.2012.0516
And the ASN.1 version can be found in the ncbi-asn1/tsa FTP directory:
-rw-r--r-- 1 gbupdate gbproces 95 May 16 01:54 stats.tsa.GAAA
-rw-r--r-- 1 gbupdate gbproces 15773347 May 16 01:53 tsa.GAAA.1.bbs.gz
-rw-r--r-- 1 gbupdate gbproces 1081 May 16 01:53 tsa.GAAA.mstr.bse.gz
-rw-r--r-- 1 gbupdate gbproces 12 May 16 01:54 tsa.proj_list.2012.0516
TSA projects are assigned a four-letter project code starting with
the letter "G" (for example, GAAA). Individual mRNA sequences within a
project make use of the 4+2+6 accession number convention, familiar
to users of WGS data (for example, GAAA01000001). Unlike WGS, re-assembly
of the mRNAs for a TSA sequencing project is expected to be a very rare
occurrence, and we expect that the 2-digit assembly-version number will
almost always be "01" for TSA mRNAs. Similar to WGS, a TSA master record
provides a convenient overview of a TSA project, with an 'all-zeroes'
accession number (eg: GAAA00000000) .
1.3.4 Organizational changes
The total number of sequence data files increased by 32 with this release:
- the BCT division is now composed of 88 files (+3)
- the CON division is now composed of 169 files (+2)
- the ENV division is now composed of 54 files (+1)
- the EST division is now composed of 464 files (+3)
- the INV division is now composed of 31 files (+1)
- the PAT division is now composed of 180 files (+2)
- the PLN division is now composed of 57 files (+2)
- the PRI division is now composed of 45 files (+1)
- the TSA division is now composed of 86 files (+16)
- the VRL division is now composed of 21 files (+1)
The total number of 'index' files increased by 2 with this release:
- the AUT (author name) index is now composed of 99 files (+2)
1.3.5 Project DBLINKs transitioning to BioProject
The Genome Project Database resource at the NCBI was redesigned in
recent months, culminating in the implementation of a new BioProject
resource:
http://www.ncbi.nlm.nih.gov/bioproject
An article that describes the goals of BioProject is available:
http://www.ncbi.nlm.nih.gov/books/NBK54015/
BioProject is a collaborative effort of the International Nucleotide
Sequence Database Collaboration (INSDC), and project data are exchanged
with NCBI's partner INSDC institutions, EBI and DDBJ. A BioProject
website is also available at DDBJ:
http://trace.ddbj.nig.ac.jp/bioproject/index_e.shtml
BioProjects are uniquely identified by BioProject Accession Numbers,
which utilize this format:
"PRJ"
"E" or "N" or "D"
one letter
one or more digits
Examples of valid BioProject accessions are PRJNA12521 and PRJEB1 .
With BioProject now in operation, we are implementing links from
sequence records to this new resource. Previously, links to the
Genome Project Database were provided by numeric 'Project' DBLINKs .
Here's an example for a bacterial complete-genome record:
LOCUS CP002497 1110245 bp DNA linear PLN 14-NOV-2011
DEFINITION Eremothecium cymbalariae DBVPG#7215 chromosome 1, complete
sequence.
ACCESSION CP002497
VERSION CP002497.1 GI:356887709
DBLINK Project: 60715
As records like this are switched to BioProject accessions, the DBLINK
line will change slightly:
LOCUS CP002497 1110245 bp DNA linear PLN 14-NOV-2011
DEFINITION Eremothecium cymbalariae DBVPG#7215 chromosome 1, complete
sequence.
ACCESSION CP002497
VERSION CP002497.1 GI:356887709
DBLINK BioProject: PRJNA60715
In the coming months, many millions of sequence records will gradually
be modified, to make use of the new BioProject DBLINK. These modifications
will not be distributed via daily GenBank and RefSeq incremental-update
products.
The new BioProject links are also appearing on newly-submitted sequence
records, and have been present in GenBank and RefSeq release and
incremental-update products since December 2011.
1.3.6 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.7 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
103 of the GSS flatfiles in Release 190.0. Consider gbgss154.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
June 15 2012
NCBI-GenBank Flat File Release 190.0
GSS Sequences (Part 1)
87112 loci, 63991594 bases, from 87112 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "154" based on the number of files dumped from the other
system. We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.
1.4 Upcoming Changes
There are no upcoming changes for GenBank flatfile format or content
currently scheduled.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1824 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut60.idx - Index of the entries according to author name, part 60.
61. gbaut61.idx - Index of the entries according to author name, part 61.
62. gbaut62.idx - Index of the entries according to author name, part 62.
63. gbaut63.idx - Index of the entries according to author name, part 63.
64. gbaut64.idx - Index of the entries according to author name, part 64.
65. gbaut65.idx - Index of the entries according to author name, part 65.
66. gbaut66.idx - Index of the entries according to author name, part 66.
67. gbaut67.idx - Index of the entries according to author name, part 67.
68. gbaut68.idx - Index of the entries according to author name, part 68.
69. gbaut69.idx - Index of the entries according to author name, part 69.
70. gbaut7.idx - Index of the entries according to author name, part 7.
71. gbaut70.idx - Index of the entries according to author name, part 70.
72. gbaut71.idx - Index of the entries according to author name, part 71.
73. gbaut72.idx - Index of the entries according to author name, part 72.
74. gbaut73.idx - Index of the entries according to author name, part 73.
75. gbaut74.idx - Index of the entries according to author name, part 74.
76. gbaut75.idx - Index of the entries according to author name, part 75.
77. gbaut76.idx - Index of the entries according to author name, part 76.
78. gbaut77.idx - Index of the entries according to author name, part 77.
79. gbaut78.idx - Index of the entries according to author name, part 78.
80. gbaut79.idx - Index of the entries according to author name, part 79.
81. gbaut8.idx - Index of the entries according to author name, part 8.
82. gbaut80.idx - Index of the entries according to author name, part 80.
83. gbaut81.idx - Index of the entries according to author name, part 81.
84. gbaut82.idx - Index of the entries according to author name, part 82.
85. gbaut83.idx - Index of the entries according to author name, part 83.
86. gbaut84.idx - Index of the entries according to author name, part 84.
87. gbaut85.idx - Index of the entries according to author name, part 85.
88. gbaut86.idx - Index of the entries according to author name, part 86.
89. gbaut87.idx - Index of the entries according to author name, part 87.
90. gbaut88.idx - Index of the entries according to author name, part 88.
91. gbaut89.idx - Index of the entries according to author name, part 89.
92. gbaut9.idx - Index of the entries according to author name, part 9.
93. gbaut90.idx - Index of the entries according to author name, part 90.
94. gbaut91.idx - Index of the entries according to author name, part 91.
95. gbaut92.idx - Index of the entries according to author name, part 92.
96. gbaut93.idx - Index of the entries according to author name, part 93.
97. gbaut94.idx - Index of the entries according to author name, part 94.
98. gbaut95.idx - Index of the entries according to author name, part 95.
99. gbaut96.idx - Index of the entries according to author name, part 96.
100. gbaut97.idx - Index of the entries according to author name, part 97.
101. gbaut98.idx - Index of the entries according to author name, part 98.
102. gbaut99.idx - Index of the entries according to author name, part 99.
103. gbbct1.seq - Bacterial sequence entries, part 1.
104. gbbct10.seq - Bacterial sequence entries, part 10.
105. gbbct11.seq - Bacterial sequence entries, part 11.
106. gbbct12.seq - Bacterial sequence entries, part 12.
107. gbbct13.seq - Bacterial sequence entries, part 13.
108. gbbct14.seq - Bacterial sequence entries, part 14.
109. gbbct15.seq - Bacterial sequence entries, part 15.
110. gbbct16.seq - Bacterial sequence entries, part 16.
111. gbbct17.seq - Bacterial sequence entries, part 17.
112. gbbct18.seq - Bacterial sequence entries, part 18.
113. gbbct19.seq - Bacterial sequence entries, part 19.
114. gbbct2.seq - Bacterial sequence entries, part 2.
115. gbbct20.seq - Bacterial sequence entries, part 20.
116. gbbct21.seq - Bacterial sequence entries, part 21.
117. gbbct22.seq - Bacterial sequence entries, part 22.
118. gbbct23.seq - Bacterial sequence entries, part 23.
119. gbbct24.seq - Bacterial sequence entries, part 24.
120. gbbct25.seq - Bacterial sequence entries, part 25.
121. gbbct26.seq - Bacterial sequence entries, part 26.
122. gbbct27.seq - Bacterial sequence entries, part 27.
123. gbbct28.seq - Bacterial sequence entries, part 28.
124. gbbct29.seq - Bacterial sequence entries, part 29.
125. gbbct3.seq - Bacterial sequence entries, part 3.
126. gbbct30.seq - Bacterial sequence entries, part 30.
127. gbbct31.seq - Bacterial sequence entries, part 31.
128. gbbct32.seq - Bacterial sequence entries, part 32.
129. gbbct33.seq - Bacterial sequence entries, part 33.
130. gbbct34.seq - Bacterial sequence entries, part 34.
131. gbbct35.seq - Bacterial sequence entries, part 35.
132. gbbct36.seq - Bacterial sequence entries, part 36.
133. gbbct37.seq - Bacterial sequence entries, part 37.
134. gbbct38.seq - Bacterial sequence entries, part 38.
135. gbbct39.seq - Bacterial sequence entries, part 39.
136. gbbct4.seq - Bacterial sequence entries, part 4.
137. gbbct40.seq - Bacterial sequence entries, part 40.
138. gbbct41.seq - Bacterial sequence entries, part 41.
139. gbbct42.seq - Bacterial sequence entries, part 42.
140. gbbct43.seq - Bacterial sequence entries, part 43.
141. gbbct44.seq - Bacterial sequence entries, part 44.
142. gbbct45.seq - Bacterial sequence entries, part 45.
143. gbbct46.seq - Bacterial sequence entries, part 46.
144. gbbct47.seq - Bacterial sequence entries, part 47.
145. gbbct48.seq - Bacterial sequence entries, part 48.
146. gbbct49.seq - Bacterial sequence entries, part 49.
147. gbbct5.seq - Bacterial sequence entries, part 5.
148. gbbct50.seq - Bacterial sequence entries, part 50.
149. gbbct51.seq - Bacterial sequence entries, part 51.
150. gbbct52.seq - Bacterial sequence entries, part 52.
151. gbbct53.seq - Bacterial sequence entries, part 53.
152. gbbct54.seq - Bacterial sequence entries, part 54.
153. gbbct55.seq - Bacterial sequence entries, part 55.
154. gbbct56.seq - Bacterial sequence entries, part 56.
155. gbbct57.seq - Bacterial sequence entries, part 57.
156. gbbct58.seq - Bacterial sequence entries, part 58.
157. gbbct59.seq - Bacterial sequence entries, part 59.
158. gbbct6.seq - Bacterial sequence entries, part 6.
159. gbbct60.seq - Bacterial sequence entries, part 60.
160. gbbct61.seq - Bacterial sequence entries, part 61.
161. gbbct62.seq - Bacterial sequence entries, part 62.
162. gbbct63.seq - Bacterial sequence entries, part 63.
163. gbbct64.seq - Bacterial sequence entries, part 64.
164. gbbct65.seq - Bacterial sequence entries, part 65.
165. gbbct66.seq - Bacterial sequence entries, part 66.
166. gbbct67.seq - Bacterial sequence entries, part 67.
167. gbbct68.seq - Bacterial sequence entries, part 68.
168. gbbct69.seq - Bacterial sequence entries, part 69.
169. gbbct7.seq - Bacterial sequence entries, part 7.
170. gbbct70.seq - Bacterial sequence entries, part 70.
171. gbbct71.seq - Bacterial sequence entries, part 71.
172. gbbct72.seq - Bacterial sequence entries, part 72.
173. gbbct73.seq - Bacterial sequence entries, part 73.
174. gbbct74.seq - Bacterial sequence entries, part 74.
175. gbbct75.seq - Bacterial sequence entries, part 75.
176. gbbct76.seq - Bacterial sequence entries, part 76.
177. gbbct77.seq - Bacterial sequence entries, part 77.
178. gbbct78.seq - Bacterial sequence entries, part 78.
179. gbbct79.seq - Bacterial sequence entries, part 79.
180. gbbct8.seq - Bacterial sequence entries, part 8.
181. gbbct80.seq - Bacterial sequence entries, part 80.
182. gbbct81.seq - Bacterial sequence entries, part 81.
183. gbbct82.seq - Bacterial sequence entries, part 82.
184. gbbct83.seq - Bacterial sequence entries, part 83.
185. gbbct84.seq - Bacterial sequence entries, part 84.
186. gbbct85.seq - Bacterial sequence entries, part 85.
187. gbbct86.seq - Bacterial sequence entries, part 86.
188. gbbct87.seq - Bacterial sequence entries, part 87.
189. gbbct88.seq - Bacterial sequence entries, part 88.
190. gbbct9.seq - Bacterial sequence entries, part 9.
191. gbchg.txt - Accession numbers of entries updated since the previous release.
192. gbcon1.seq - Constructed sequence entries, part 1.
193. gbcon10.seq - Constructed sequence entries, part 10.
194. gbcon100.seq - Constructed sequence entries, part 100.
195. gbcon101.seq - Constructed sequence entries, part 101.
196. gbcon102.seq - Constructed sequence entries, part 102.
197. gbcon103.seq - Constructed sequence entries, part 103.
198. gbcon104.seq - Constructed sequence entries, part 104.
199. gbcon105.seq - Constructed sequence entries, part 105.
200. gbcon106.seq - Constructed sequence entries, part 106.
201. gbcon107.seq - Constructed sequence entries, part 107.
202. gbcon108.seq - Constructed sequence entries, part 108.
203. gbcon109.seq - Constructed sequence entries, part 109.
204. gbcon11.seq - Constructed sequence entries, part 11.
205. gbcon110.seq - Constructed sequence entries, part 110.
206. gbcon111.seq - Constructed sequence entries, part 111.
207. gbcon112.seq - Constructed sequence entries, part 112.
208. gbcon113.seq - Constructed sequence entries, part 113.
209. gbcon114.seq - Constructed sequence entries, part 114.
210. gbcon115.seq - Constructed sequence entries, part 115.
211. gbcon116.seq - Constructed sequence entries, part 116.
212. gbcon117.seq - Constructed sequence entries, part 117.
213. gbcon118.seq - Constructed sequence entries, part 118.
214. gbcon119.seq - Constructed sequence entries, part 119.
215. gbcon12.seq - Constructed sequence entries, part 12.
216. gbcon120.seq - Constructed sequence entries, part 120.
217. gbcon121.seq - Constructed sequence entries, part 121.
218. gbcon122.seq - Constructed sequence entries, part 122.
219. gbcon123.seq - Constructed sequence entries, part 123.
220. gbcon124.seq - Constructed sequence entries, part 124.
221. gbcon125.seq - Constructed sequence entries, part 125.
222. gbcon126.seq - Constructed sequence entries, part 126.
223. gbcon127.seq - Constructed sequence entries, part 127.
224. gbcon128.seq - Constructed sequence entries, part 128.
225. gbcon129.seq - Constructed sequence entries, part 129.
226. gbcon13.seq - Constructed sequence entries, part 13.
227. gbcon130.seq - Constructed sequence entries, part 130.
228. gbcon131.seq - Constructed sequence entries, part 131.
229. gbcon132.seq - Constructed sequence entries, part 132.
230. gbcon133.seq - Constructed sequence entries, part 133.
231. gbcon134.seq - Constructed sequence entries, part 134.
232. gbcon135.seq - Constructed sequence entries, part 135.
233. gbcon136.seq - Constructed sequence entries, part 136.
234. gbcon137.seq - Constructed sequence entries, part 137.
235. gbcon138.seq - Constructed sequence entries, part 138.
236. gbcon139.seq - Constructed sequence entries, part 139.
237. gbcon14.seq - Constructed sequence entries, part 14.
238. gbcon140.seq - Constructed sequence entries, part 140.
239. gbcon141.seq - Constructed sequence entries, part 141.
240. gbcon142.seq - Constructed sequence entries, part 142.
241. gbcon143.seq - Constructed sequence entries, part 143.
242. gbcon144.seq - Constructed sequence entries, part 144.
243. gbcon145.seq - Constructed sequence entries, part 145.
244. gbcon146.seq - Constructed sequence entries, part 146.
245. gbcon147.seq - Constructed sequence entries, part 147.
246. gbcon148.seq - Constructed sequence entries, part 148.
247. gbcon149.seq - Constructed sequence entries, part 149.
248. gbcon15.seq - Constructed sequence entries, part 15.
249. gbcon150.seq - Constructed sequence entries, part 150.
250. gbcon151.seq - Constructed sequence entries, part 151.
251. gbcon152.seq - Constructed sequence entries, part 152.
252. gbcon153.seq - Constructed sequence entries, part 153.
253. gbcon154.seq - Constructed sequence entries, part 154.
254. gbcon155.seq - Constructed sequence entries, part 155.
255. gbcon156.seq - Constructed sequence entries, part 156.
256. gbcon157.seq - Constructed sequence entries, part 157.
257. gbcon158.seq - Constructed sequence entries, part 158.
258. gbcon159.seq - Constructed sequence entries, part 159.
259. gbcon16.seq - Constructed sequence entries, part 16.
260. gbcon160.seq - Constructed sequence entries, part 160.
261. gbcon161.seq - Constructed sequence entries, part 161.
262. gbcon162.seq - Constructed sequence entries, part 162.
263. gbcon163.seq - Constructed sequence entries, part 163.
264. gbcon164.seq - Constructed sequence entries, part 164.
265. gbcon165.seq - Constructed sequence entries, part 165.
266. gbcon166.seq - Constructed sequence entries, part 166.
267. gbcon167.seq - Constructed sequence entries, part 167.
268. gbcon168.seq - Constructed sequence entries, part 168.
269. gbcon169.seq - Constructed sequence entries, part 169.
270. gbcon17.seq - Constructed sequence entries, part 17.
271. gbcon18.seq - Constructed sequence entries, part 18.
272. gbcon19.seq - Constructed sequence entries, part 19.
273. gbcon2.seq - Constructed sequence entries, part 2.
274. gbcon20.seq - Constructed sequence entries, part 20.
275. gbcon21.seq - Constructed sequence entries, part 21.
276. gbcon22.seq - Constructed sequence entries, part 22.
277. gbcon23.seq - Constructed sequence entries, part 23.
278. gbcon24.seq - Constructed sequence entries, part 24.
279. gbcon25.seq - Constructed sequence entries, part 25.
280. gbcon26.seq - Constructed sequence entries, part 26.
281. gbcon27.seq - Constructed sequence entries, part 27.
282. gbcon28.seq - Constructed sequence entries, part 28.
283. gbcon29.seq - Constructed sequence entries, part 29.
284. gbcon3.seq - Constructed sequence entries, part 3.
285. gbcon30.seq - Constructed sequence entries, part 30.
286. gbcon31.seq - Constructed sequence entries, part 31.
287. gbcon32.seq - Constructed sequence entries, part 32.
288. gbcon33.seq - Constructed sequence entries, part 33.
289. gbcon34.seq - Constructed sequence entries, part 34.
290. gbcon35.seq - Constructed sequence entries, part 35.
291. gbcon36.seq - Constructed sequence entries, part 36.
292. gbcon37.seq - Constructed sequence entries, part 37.
293. gbcon38.seq - Constructed sequence entries, part 38.
294. gbcon39.seq - Constructed sequence entries, part 39.
295. gbcon4.seq - Constructed sequence entries, part 4.
296. gbcon40.seq - Constructed sequence entries, part 40.
297. gbcon41.seq - Constructed sequence entries, part 41.
298. gbcon42.seq - Constructed sequence entries, part 42.
299. gbcon43.seq - Constructed sequence entries, part 43.
300. gbcon44.seq - Constructed sequence entries, part 44.
301. gbcon45.seq - Constructed sequence entries, part 45.
302. gbcon46.seq - Constructed sequence entries, part 46.
303. gbcon47.seq - Constructed sequence entries, part 47.
304. gbcon48.seq - Constructed sequence entries, part 48.
305. gbcon49.seq - Constructed sequence entries, part 49.
306. gbcon5.seq - Constructed sequence entries, part 5.
307. gbcon50.seq - Constructed sequence entries, part 50.
308. gbcon51.seq - Constructed sequence entries, part 51.
309. gbcon52.seq - Constructed sequence entries, part 52.
310. gbcon53.seq - Constructed sequence entries, part 53.
311. gbcon54.seq - Constructed sequence entries, part 54.
312. gbcon55.seq - Constructed sequence entries, part 55.
313. gbcon56.seq - Constructed sequence entries, part 56.
314. gbcon57.seq - Constructed sequence entries, part 57.
315. gbcon58.seq - Constructed sequence entries, part 58.
316. gbcon59.seq - Constructed sequence entries, part 59.
317. gbcon6.seq - Constructed sequence entries, part 6.
318. gbcon60.seq - Constructed sequence entries, part 60.
319. gbcon61.seq - Constructed sequence entries, part 61.
320. gbcon62.seq - Constructed sequence entries, part 62.
321. gbcon63.seq - Constructed sequence entries, part 63.
322. gbcon64.seq - Constructed sequence entries, part 64.
323. gbcon65.seq - Constructed sequence entries, part 65.
324. gbcon66.seq - Constructed sequence entries, part 66.
325. gbcon67.seq - Constructed sequence entries, part 67.
326. gbcon68.seq - Constructed sequence entries, part 68.
327. gbcon69.seq - Constructed sequence entries, part 69.
328. gbcon7.seq - Constructed sequence entries, part 7.
329. gbcon70.seq - Constructed sequence entries, part 70.
330. gbcon71.seq - Constructed sequence entries, part 71.
331. gbcon72.seq - Constructed sequence entries, part 72.
332. gbcon73.seq - Constructed sequence entries, part 73.
333. gbcon74.seq - Constructed sequence entries, part 74.
334. gbcon75.seq - Constructed sequence entries, part 75.
335. gbcon76.seq - Constructed sequence entries, part 76.
336. gbcon77.seq - Constructed sequence entries, part 77.
337. gbcon78.seq - Constructed sequence entries, part 78.
338. gbcon79.seq - Constructed sequence entries, part 79.
339. gbcon8.seq - Constructed sequence entries, part 8.
340. gbcon80.seq - Constructed sequence entries, part 80.
341. gbcon81.seq - Constructed sequence entries, part 81.
342. gbcon82.seq - Constructed sequence entries, part 82.
343. gbcon83.seq - Constructed sequence entries, part 83.
344. gbcon84.seq - Constructed sequence entries, part 84.
345. gbcon85.seq - Constructed sequence entries, part 85.
346. gbcon86.seq - Constructed sequence entries, part 86.
347. gbcon87.seq - Constructed sequence entries, part 87.
348. gbcon88.seq - Constructed sequence entries, part 88.
349. gbcon89.seq - Constructed sequence entries, part 89.
350. gbcon9.seq - Constructed sequence entries, part 9.
351. gbcon90.seq - Constructed sequence entries, part 90.
352. gbcon91.seq - Constructed sequence entries, part 91.
353. gbcon92.seq - Constructed sequence entries, part 92.
354. gbcon93.seq - Constructed sequence entries, part 93.
355. gbcon94.seq - Constructed sequence entries, part 94.
356. gbcon95.seq - Constructed sequence entries, part 95.
357. gbcon96.seq - Constructed sequence entries, part 96.
358. gbcon97.seq - Constructed sequence entries, part 97.
359. gbcon98.seq - Constructed sequence entries, part 98.
360. gbcon99.seq - Constructed sequence entries, part 99.
361. gbdel.txt - Accession numbers of entries deleted since the previous release.
362. gbenv1.seq - Environmental sampling sequence entries, part 1.
363. gbenv10.seq - Environmental sampling sequence entries, part 10.
364. gbenv11.seq - Environmental sampling sequence entries, part 11.
365. gbenv12.seq - Environmental sampling sequence entries, part 12.
366. gbenv13.seq - Environmental sampling sequence entries, part 13.
367. gbenv14.seq - Environmental sampling sequence entries, part 14.
368. gbenv15.seq - Environmental sampling sequence entries, part 15.
369. gbenv16.seq - Environmental sampling sequence entries, part 16.
370. gbenv17.seq - Environmental sampling sequence entries, part 17.
371. gbenv18.seq - Environmental sampling sequence entries, part 18.
372. gbenv19.seq - Environmental sampling sequence entries, part 19.
373. gbenv2.seq - Environmental sampling sequence entries, part 2.
374. gbenv20.seq - Environmental sampling sequence entries, part 20.
375. gbenv21.seq - Environmental sampling sequence entries, part 21.
376. gbenv22.seq - Environmental sampling sequence entries, part 22.
377. gbenv23.seq - Environmental sampling sequence entries, part 23.
378. gbenv24.seq - Environmental sampling sequence entries, part 24.
379. gbenv25.seq - Environmental sampling sequence entries, part 25.
380. gbenv26.seq - Environmental sampling sequence entries, part 26.
381. gbenv27.seq - Environmental sampling sequence entries, part 27.
382. gbenv28.seq - Environmental sampling sequence entries, part 28.
383. gbenv29.seq - Environmental sampling sequence entries, part 29.
384. gbenv3.seq - Environmental sampling sequence entries, part 3.
385. gbenv30.seq - Environmental sampling sequence entries, part 30.
386. gbenv31.seq - Environmental sampling sequence entries, part 31.
387. gbenv32.seq - Environmental sampling sequence entries, part 32.
388. gbenv33.seq - Environmental sampling sequence entries, part 33.
389. gbenv34.seq - Environmental sampling sequence entries, part 34.
390. gbenv35.seq - Environmental sampling sequence entries, part 35.
391. gbenv36.seq - Environmental sampling sequence entries, part 36.
392. gbenv37.seq - Environmental sampling sequence entries, part 37.
393. gbenv38.seq - Environmental sampling sequence entries, part 38.
394. gbenv39.seq - Environmental sampling sequence entries, part 39.
395. gbenv4.seq - Environmental sampling sequence entries, part 4.
396. gbenv40.seq - Environmental sampling sequence entries, part 40.
397. gbenv41.seq - Environmental sampling sequence entries, part 41.
398. gbenv42.seq - Environmental sampling sequence entries, part 42.
399. gbenv43.seq - Environmental sampling sequence entries, part 43.
400. gbenv44.seq - Environmental sampling sequence entries, part 44.
401. gbenv45.seq - Environmental sampling sequence entries, part 45.
402. gbenv46.seq - Environmental sampling sequence entries, part 46.
403. gbenv47.seq - Environmental sampling sequence entries, part 47.
404. gbenv48.seq - Environmental sampling sequence entries, part 48.
405. gbenv49.seq - Environmental sampling sequence entries, part 49.
406. gbenv5.seq - Environmental sampling sequence entries, part 5.
407. gbenv50.seq - Environmental sampling sequence entries, part 50.
408. gbenv51.seq - Environmental sampling sequence entries, part 51.
409. gbenv52.seq - Environmental sampling sequence entries, part 52.
410. gbenv53.seq - Environmental sampling sequence entries, part 53.
411. gbenv54.seq - Environmental sampling sequence entries, part 54.
412. gbenv6.seq - Environmental sampling sequence entries, part 6.
413. gbenv7.seq - Environmental sampling sequence entries, part 7.
414. gbenv8.seq - Environmental sampling sequence entries, part 8.
415. gbenv9.seq - Environmental sampling sequence entries, part 9.
416. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
417. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
418. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
419. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
420. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
421. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
422. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
423. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
424. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
425. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
426. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
427. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
428. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
429. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
430. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
431. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
432. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
433. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
434. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
435. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
436. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
437. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
438. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
439. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
440. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
441. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
442. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
443. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
444. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
445. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
446. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
447. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
448. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
449. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
450. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
451. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
452. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
453. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
454. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
455. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
456. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
457. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
458. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
459. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
460. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
461. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
462. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
463. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
464. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
465. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
466. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
467. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
468. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
469. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
470. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
471. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
472. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
473. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
474. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
475. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
476. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
477. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
478. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
479. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
480. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
481. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
482. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
483. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
484. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
485. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
486. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
487. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
488. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
489. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
490. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
491. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
492. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
493. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
494. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
495. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
496. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
497. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
498. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
499. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
500. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
501. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
502. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
503. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
504. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
505. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
506. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
507. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
508. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
509. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
510. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
511. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
512. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
513. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
514. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
515. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
516. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
517. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
518. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
519. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
520. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
521. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
522. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
523. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
524. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
525. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
526. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
527. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
528. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
529. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
530. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
531. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
532. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
533. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
534. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
535. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
536. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
537. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
538. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
539. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
540. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
541. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
542. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
543. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
544. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
545. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
546. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
547. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
548. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
549. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
550. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
551. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
552. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
553. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
554. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
555. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
556. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
557. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
558. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
559. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
560. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
561. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
562. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
563. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
564. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
565. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
566. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
567. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
568. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
569. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
570. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
571. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
572. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
573. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
574. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
575. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
576. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
577. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
578. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
579. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
580. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
581. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
582. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
583. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
584. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
585. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
586. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
587. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
588. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
589. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
590. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
591. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
592. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
593. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
594. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
595. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
596. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
597. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
598. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
599. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
600. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
601. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
602. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
603. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
604. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
605. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
606. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
607. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
608. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
609. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
610. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
611. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
612. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
613. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
614. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
615. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
616. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
617. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
618. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
619. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
620. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
621. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
622. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
623. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
624. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
625. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
626. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
627. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
628. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
629. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
630. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
631. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
632. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
633. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
634. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
635. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
636. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
637. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
638. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
639. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
640. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
641. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
642. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
643. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
644. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
645. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
646. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
647. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
648. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
649. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
650. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
651. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
652. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
653. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
654. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
655. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
656. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
657. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
658. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
659. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
660. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
661. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
662. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
663. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
664. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
665. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
666. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
667. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
668. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
669. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
670. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
671. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
672. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
673. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
674. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
675. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
676. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
677. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
678. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
679. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
680. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
681. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
682. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
683. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
684. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
685. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
686. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
687. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
688. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
689. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
690. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
691. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
692. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
693. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
694. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
695. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
696. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
697. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
698. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
699. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
700. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
701. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
702. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
703. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
704. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
705. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
706. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
707. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
708. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
709. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
710. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
711. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
712. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
713. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
714. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
715. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
716. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
717. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
718. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
719. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
720. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
721. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
722. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
723. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
724. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
725. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
726. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
727. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
728. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
729. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
730. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
731. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
732. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
733. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
734. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
735. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
736. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
737. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
738. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
739. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
740. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
741. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
742. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
743. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
744. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
745. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
746. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
747. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
748. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
749. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
750. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
751. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
752. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
753. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
754. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
755. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
756. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
757. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
758. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
759. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
760. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
761. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
762. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
763. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
764. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
765. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
766. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
767. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
768. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
769. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
770. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
771. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
772. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
773. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
774. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
775. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
776. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
777. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
778. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
779. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
780. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
781. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
782. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
783. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
784. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
785. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
786. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
787. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
788. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
789. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
790. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
791. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
792. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
793. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
794. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
795. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
796. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
797. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
798. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
799. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
800. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
801. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
802. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
803. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
804. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
805. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
806. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
807. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
808. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
809. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
810. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
811. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
812. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
813. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
814. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
815. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
816. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
817. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
818. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
819. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
820. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
821. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
822. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
823. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
824. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
825. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
826. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
827. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
828. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
829. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
830. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
831. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
832. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
833. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
834. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
835. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
836. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
837. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
838. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
839. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
840. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
841. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
842. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
843. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
844. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
845. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
846. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
847. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
848. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
849. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
850. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
851. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
852. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
853. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
854. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
855. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
856. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
857. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
858. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
859. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
860. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
861. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
862. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
863. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
864. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
865. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
866. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
867. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
868. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
869. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
870. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
871. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
872. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
873. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
874. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
875. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
876. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
877. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
878. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
879. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
880. gbgen.idx - Index of the entries according to gene symbols.
881. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
882. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
883. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
884. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
885. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
886. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
887. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
888. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
889. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
890. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
891. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
892. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
893. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
894. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
895. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
896. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
897. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
898. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
899. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
900. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
901. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
902. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
903. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
904. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
905. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
906. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
907. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
908. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
909. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
910. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
911. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
912. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
913. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
914. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
915. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
916. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
917. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
918. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
919. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
920. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
921. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
922. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
923. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
924. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
925. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
926. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
927. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
928. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
929. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
930. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
931. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
932. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
933. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
934. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
935. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
936. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
937. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
938. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
939. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
940. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
941. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
942. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
943. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
944. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
945. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
946. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
947. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
948. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
949. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
950. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
951. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
952. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
953. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
954. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
955. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
956. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
957. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
958. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
959. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
960. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
961. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
962. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
963. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
964. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
965. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
966. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
967. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
968. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
969. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
970. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
971. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
972. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
973. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
974. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
975. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
976. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
977. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
978. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
979. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
980. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
981. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
982. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
983. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
984. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
985. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
986. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
987. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
988. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
989. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
990. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
991. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
992. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
993. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
994. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
995. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
996. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
997. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
998. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
999. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1000. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1001. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1002. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1003. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1004. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1005. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1006. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1007. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1008. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1009. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1010. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1011. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1012. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1013. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1014. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1015. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1016. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1017. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1018. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1019. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1020. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1021. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1022. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1023. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1024. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1025. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1026. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1027. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1028. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1029. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1030. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1031. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1032. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1033. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1034. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1035. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1036. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1037. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1038. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1039. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1040. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1041. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1042. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1043. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1044. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1045. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1046. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1047. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1048. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1049. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1050. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1051. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1052. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1053. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1054. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1055. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1056. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1057. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1058. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1059. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1060. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1061. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1062. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1063. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1064. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1065. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1066. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1067. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1068. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1069. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1070. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1071. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1072. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1073. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1074. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1075. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1076. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1077. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1078. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1079. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1080. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1081. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1082. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1083. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1084. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1085. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1086. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1087. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1088. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1089. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1090. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1091. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1092. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1093. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1094. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1095. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1096. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1097. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1098. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1099. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1100. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1101. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1102. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1103. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1104. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1105. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1106. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1107. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1108. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1109. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1110. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1111. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1112. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1113. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1114. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1115. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1116. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1117. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1118. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1119. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1120. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1121. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1122. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1123. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1124. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1125. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1126. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1127. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1128. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1129. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1130. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1131. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1132. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1133. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1134. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1135. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1136. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1137. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1138. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1139. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1140. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1141. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1142. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1143. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1144. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1145. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1146. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1147. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1148. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1149. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1150. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1151. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1152. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1153. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1154. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1155. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1156. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1157. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1158. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1159. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1160. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1161. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1162. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1163. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1164. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1165. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1166. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1167. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1168. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1169. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1170. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1171. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1172. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1173. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1174. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1175. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1176. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1177. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1178. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1179. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1180. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1181. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1182. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1183. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1184. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1185. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1186. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1187. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1188. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1189. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1190. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1191. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1192. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1193. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1194. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1195. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1196. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1197. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1198. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1199. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1200. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1201. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1202. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1203. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1204. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1205. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1206. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1207. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1208. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1209. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1210. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1211. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1212. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1213. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1214. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1215. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1216. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1217. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1218. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1219. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1220. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1221. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1222. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1223. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1224. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1225. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1226. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1227. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1228. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1229. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1230. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1231. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1232. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1233. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1234. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1235. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1236. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1237. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1238. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1239. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1240. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1241. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1242. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1243. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1244. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1245. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1246. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1247. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1248. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1249. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1250. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1251. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1252. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1253. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1254. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1255. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1256. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1257. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1258. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1259. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1260. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1261. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1262. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1263. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1264. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1265. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1266. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1267. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1268. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1269. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1270. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1271. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1272. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1273. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1274. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1275. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1276. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1277. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1278. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1279. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1280. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1281. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1282. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1283. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1284. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1285. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1286. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1287. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1288. gbinv1.seq - Invertebrate sequence entries, part 1.
1289. gbinv10.seq - Invertebrate sequence entries, part 10.
1290. gbinv11.seq - Invertebrate sequence entries, part 11.
1291. gbinv12.seq - Invertebrate sequence entries, part 12.
1292. gbinv13.seq - Invertebrate sequence entries, part 13.
1293. gbinv14.seq - Invertebrate sequence entries, part 14.
1294. gbinv15.seq - Invertebrate sequence entries, part 15.
1295. gbinv16.seq - Invertebrate sequence entries, part 16.
1296. gbinv17.seq - Invertebrate sequence entries, part 17.
1297. gbinv18.seq - Invertebrate sequence entries, part 18.
1298. gbinv19.seq - Invertebrate sequence entries, part 19.
1299. gbinv2.seq - Invertebrate sequence entries, part 2.
1300. gbinv20.seq - Invertebrate sequence entries, part 20.
1301. gbinv21.seq - Invertebrate sequence entries, part 21.
1302. gbinv22.seq - Invertebrate sequence entries, part 22.
1303. gbinv23.seq - Invertebrate sequence entries, part 23.
1304. gbinv24.seq - Invertebrate sequence entries, part 24.
1305. gbinv25.seq - Invertebrate sequence entries, part 25.
1306. gbinv26.seq - Invertebrate sequence entries, part 26.
1307. gbinv27.seq - Invertebrate sequence entries, part 27.
1308. gbinv28.seq - Invertebrate sequence entries, part 28.
1309. gbinv29.seq - Invertebrate sequence entries, part 29.
1310. gbinv3.seq - Invertebrate sequence entries, part 3.
1311. gbinv30.seq - Invertebrate sequence entries, part 30.
1312. gbinv31.seq - Invertebrate sequence entries, part 31.
1313. gbinv4.seq - Invertebrate sequence entries, part 4.
1314. gbinv5.seq - Invertebrate sequence entries, part 5.
1315. gbinv6.seq - Invertebrate sequence entries, part 6.
1316. gbinv7.seq - Invertebrate sequence entries, part 7.
1317. gbinv8.seq - Invertebrate sequence entries, part 8.
1318. gbinv9.seq - Invertebrate sequence entries, part 9.
1319. gbjou1.idx - Index of the entries according to journal citation, part 1.
1320. gbjou10.idx - Index of the entries according to journal citation, part 10.
1321. gbjou11.idx - Index of the entries according to journal citation, part 11.
1322. gbjou12.idx - Index of the entries according to journal citation, part 12.
1323. gbjou13.idx - Index of the entries according to journal citation, part 13.
1324. gbjou2.idx - Index of the entries according to journal citation, part 2.
1325. gbjou3.idx - Index of the entries according to journal citation, part 3.
1326. gbjou4.idx - Index of the entries according to journal citation, part 4.
1327. gbjou5.idx - Index of the entries according to journal citation, part 5.
1328. gbjou6.idx - Index of the entries according to journal citation, part 6.
1329. gbjou7.idx - Index of the entries according to journal citation, part 7.
1330. gbjou8.idx - Index of the entries according to journal citation, part 8.
1331. gbjou9.idx - Index of the entries according to journal citation, part 9.
1332. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1333. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1334. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1335. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1336. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1337. gbkey6.idx - Index of the entries according to keyword phrase, part 6.
1338. gbmam1.seq - Other mammalian sequence entries, part 1.
1339. gbmam2.seq - Other mammalian sequence entries, part 2.
1340. gbmam3.seq - Other mammalian sequence entries, part 3.
1341. gbmam4.seq - Other mammalian sequence entries, part 4.
1342. gbmam5.seq - Other mammalian sequence entries, part 5.
1343. gbmam6.seq - Other mammalian sequence entries, part 6.
1344. gbmam7.seq - Other mammalian sequence entries, part 7.
1345. gbmam8.seq - Other mammalian sequence entries, part 8.
1346. gbnew.txt - Accession numbers of entries new since the previous release.
1347. gbpat1.seq - Patent sequence entries, part 1.
1348. gbpat10.seq - Patent sequence entries, part 10.
1349. gbpat100.seq - Patent sequence entries, part 100.
1350. gbpat101.seq - Patent sequence entries, part 101.
1351. gbpat102.seq - Patent sequence entries, part 102.
1352. gbpat103.seq - Patent sequence entries, part 103.
1353. gbpat104.seq - Patent sequence entries, part 104.
1354. gbpat105.seq - Patent sequence entries, part 105.
1355. gbpat106.seq - Patent sequence entries, part 106.
1356. gbpat107.seq - Patent sequence entries, part 107.
1357. gbpat108.seq - Patent sequence entries, part 108.
1358. gbpat109.seq - Patent sequence entries, part 109.
1359. gbpat11.seq - Patent sequence entries, part 11.
1360. gbpat110.seq - Patent sequence entries, part 110.
1361. gbpat111.seq - Patent sequence entries, part 111.
1362. gbpat112.seq - Patent sequence entries, part 112.
1363. gbpat113.seq - Patent sequence entries, part 113.
1364. gbpat114.seq - Patent sequence entries, part 114.
1365. gbpat115.seq - Patent sequence entries, part 115.
1366. gbpat116.seq - Patent sequence entries, part 116.
1367. gbpat117.seq - Patent sequence entries, part 117.
1368. gbpat118.seq - Patent sequence entries, part 118.
1369. gbpat119.seq - Patent sequence entries, part 119.
1370. gbpat12.seq - Patent sequence entries, part 12.
1371. gbpat120.seq - Patent sequence entries, part 120.
1372. gbpat121.seq - Patent sequence entries, part 121.
1373. gbpat122.seq - Patent sequence entries, part 122.
1374. gbpat123.seq - Patent sequence entries, part 123.
1375. gbpat124.seq - Patent sequence entries, part 124.
1376. gbpat125.seq - Patent sequence entries, part 125.
1377. gbpat126.seq - Patent sequence entries, part 126.
1378. gbpat127.seq - Patent sequence entries, part 127.
1379. gbpat128.seq - Patent sequence entries, part 128.
1380. gbpat129.seq - Patent sequence entries, part 129.
1381. gbpat13.seq - Patent sequence entries, part 13.
1382. gbpat130.seq - Patent sequence entries, part 130.
1383. gbpat131.seq - Patent sequence entries, part 131.
1384. gbpat132.seq - Patent sequence entries, part 132.
1385. gbpat133.seq - Patent sequence entries, part 133.
1386. gbpat134.seq - Patent sequence entries, part 134.
1387. gbpat135.seq - Patent sequence entries, part 135.
1388. gbpat136.seq - Patent sequence entries, part 136.
1389. gbpat137.seq - Patent sequence entries, part 137.
1390. gbpat138.seq - Patent sequence entries, part 138.
1391. gbpat139.seq - Patent sequence entries, part 139.
1392. gbpat14.seq - Patent sequence entries, part 14.
1393. gbpat140.seq - Patent sequence entries, part 140.
1394. gbpat141.seq - Patent sequence entries, part 141.
1395. gbpat142.seq - Patent sequence entries, part 142.
1396. gbpat143.seq - Patent sequence entries, part 143.
1397. gbpat144.seq - Patent sequence entries, part 144.
1398. gbpat145.seq - Patent sequence entries, part 145.
1399. gbpat146.seq - Patent sequence entries, part 146.
1400. gbpat147.seq - Patent sequence entries, part 147.
1401. gbpat148.seq - Patent sequence entries, part 148.
1402. gbpat149.seq - Patent sequence entries, part 149.
1403. gbpat15.seq - Patent sequence entries, part 15.
1404. gbpat150.seq - Patent sequence entries, part 150.
1405. gbpat151.seq - Patent sequence entries, part 151.
1406. gbpat152.seq - Patent sequence entries, part 152.
1407. gbpat153.seq - Patent sequence entries, part 153.
1408. gbpat154.seq - Patent sequence entries, part 154.
1409. gbpat155.seq - Patent sequence entries, part 155.
1410. gbpat156.seq - Patent sequence entries, part 156.
1411. gbpat157.seq - Patent sequence entries, part 157.
1412. gbpat158.seq - Patent sequence entries, part 158.
1413. gbpat159.seq - Patent sequence entries, part 159.
1414. gbpat16.seq - Patent sequence entries, part 16.
1415. gbpat160.seq - Patent sequence entries, part 160.
1416. gbpat161.seq - Patent sequence entries, part 161.
1417. gbpat162.seq - Patent sequence entries, part 162.
1418. gbpat163.seq - Patent sequence entries, part 163.
1419. gbpat164.seq - Patent sequence entries, part 164.
1420. gbpat165.seq - Patent sequence entries, part 165.
1421. gbpat166.seq - Patent sequence entries, part 166.
1422. gbpat167.seq - Patent sequence entries, part 167.
1423. gbpat168.seq - Patent sequence entries, part 168.
1424. gbpat169.seq - Patent sequence entries, part 169.
1425. gbpat17.seq - Patent sequence entries, part 17.
1426. gbpat170.seq - Patent sequence entries, part 170.
1427. gbpat171.seq - Patent sequence entries, part 171.
1428. gbpat172.seq - Patent sequence entries, part 172.
1429. gbpat173.seq - Patent sequence entries, part 173.
1430. gbpat174.seq - Patent sequence entries, part 174.
1431. gbpat175.seq - Patent sequence entries, part 175.
1432. gbpat176.seq - Patent sequence entries, part 176.
1433. gbpat177.seq - Patent sequence entries, part 177.
1434. gbpat178.seq - Patent sequence entries, part 178.
1435. gbpat179.seq - Patent sequence entries, part 179.
1436. gbpat18.seq - Patent sequence entries, part 18.
1437. gbpat180.seq - Patent sequence entries, part 180.
1438. gbpat19.seq - Patent sequence entries, part 19.
1439. gbpat2.seq - Patent sequence entries, part 2.
1440. gbpat20.seq - Patent sequence entries, part 20.
1441. gbpat21.seq - Patent sequence entries, part 21.
1442. gbpat22.seq - Patent sequence entries, part 22.
1443. gbpat23.seq - Patent sequence entries, part 23.
1444. gbpat24.seq - Patent sequence entries, part 24.
1445. gbpat25.seq - Patent sequence entries, part 25.
1446. gbpat26.seq - Patent sequence entries, part 26.
1447. gbpat27.seq - Patent sequence entries, part 27.
1448. gbpat28.seq - Patent sequence entries, part 28.
1449. gbpat29.seq - Patent sequence entries, part 29.
1450. gbpat3.seq - Patent sequence entries, part 3.
1451. gbpat30.seq - Patent sequence entries, part 30.
1452. gbpat31.seq - Patent sequence entries, part 31.
1453. gbpat32.seq - Patent sequence entries, part 32.
1454. gbpat33.seq - Patent sequence entries, part 33.
1455. gbpat34.seq - Patent sequence entries, part 34.
1456. gbpat35.seq - Patent sequence entries, part 35.
1457. gbpat36.seq - Patent sequence entries, part 36.
1458. gbpat37.seq - Patent sequence entries, part 37.
1459. gbpat38.seq - Patent sequence entries, part 38.
1460. gbpat39.seq - Patent sequence entries, part 39.
1461. gbpat4.seq - Patent sequence entries, part 4.
1462. gbpat40.seq - Patent sequence entries, part 40.
1463. gbpat41.seq - Patent sequence entries, part 41.
1464. gbpat42.seq - Patent sequence entries, part 42.
1465. gbpat43.seq - Patent sequence entries, part 43.
1466. gbpat44.seq - Patent sequence entries, part 44.
1467. gbpat45.seq - Patent sequence entries, part 45.
1468. gbpat46.seq - Patent sequence entries, part 46.
1469. gbpat47.seq - Patent sequence entries, part 47.
1470. gbpat48.seq - Patent sequence entries, part 48.
1471. gbpat49.seq - Patent sequence entries, part 49.
1472. gbpat5.seq - Patent sequence entries, part 5.
1473. gbpat50.seq - Patent sequence entries, part 50.
1474. gbpat51.seq - Patent sequence entries, part 51.
1475. gbpat52.seq - Patent sequence entries, part 52.
1476. gbpat53.seq - Patent sequence entries, part 53.
1477. gbpat54.seq - Patent sequence entries, part 54.
1478. gbpat55.seq - Patent sequence entries, part 55.
1479. gbpat56.seq - Patent sequence entries, part 56.
1480. gbpat57.seq - Patent sequence entries, part 57.
1481. gbpat58.seq - Patent sequence entries, part 58.
1482. gbpat59.seq - Patent sequence entries, part 59.
1483. gbpat6.seq - Patent sequence entries, part 6.
1484. gbpat60.seq - Patent sequence entries, part 60.
1485. gbpat61.seq - Patent sequence entries, part 61.
1486. gbpat62.seq - Patent sequence entries, part 62.
1487. gbpat63.seq - Patent sequence entries, part 63.
1488. gbpat64.seq - Patent sequence entries, part 64.
1489. gbpat65.seq - Patent sequence entries, part 65.
1490. gbpat66.seq - Patent sequence entries, part 66.
1491. gbpat67.seq - Patent sequence entries, part 67.
1492. gbpat68.seq - Patent sequence entries, part 68.
1493. gbpat69.seq - Patent sequence entries, part 69.
1494. gbpat7.seq - Patent sequence entries, part 7.
1495. gbpat70.seq - Patent sequence entries, part 70.
1496. gbpat71.seq - Patent sequence entries, part 71.
1497. gbpat72.seq - Patent sequence entries, part 72.
1498. gbpat73.seq - Patent sequence entries, part 73.
1499. gbpat74.seq - Patent sequence entries, part 74.
1500. gbpat75.seq - Patent sequence entries, part 75.
1501. gbpat76.seq - Patent sequence entries, part 76.
1502. gbpat77.seq - Patent sequence entries, part 77.
1503. gbpat78.seq - Patent sequence entries, part 78.
1504. gbpat79.seq - Patent sequence entries, part 79.
1505. gbpat8.seq - Patent sequence entries, part 8.
1506. gbpat80.seq - Patent sequence entries, part 80.
1507. gbpat81.seq - Patent sequence entries, part 81.
1508. gbpat82.seq - Patent sequence entries, part 82.
1509. gbpat83.seq - Patent sequence entries, part 83.
1510. gbpat84.seq - Patent sequence entries, part 84.
1511. gbpat85.seq - Patent sequence entries, part 85.
1512. gbpat86.seq - Patent sequence entries, part 86.
1513. gbpat87.seq - Patent sequence entries, part 87.
1514. gbpat88.seq - Patent sequence entries, part 88.
1515. gbpat89.seq - Patent sequence entries, part 89.
1516. gbpat9.seq - Patent sequence entries, part 9.
1517. gbpat90.seq - Patent sequence entries, part 90.
1518. gbpat91.seq - Patent sequence entries, part 91.
1519. gbpat92.seq - Patent sequence entries, part 92.
1520. gbpat93.seq - Patent sequence entries, part 93.
1521. gbpat94.seq - Patent sequence entries, part 94.
1522. gbpat95.seq - Patent sequence entries, part 95.
1523. gbpat96.seq - Patent sequence entries, part 96.
1524. gbpat97.seq - Patent sequence entries, part 97.
1525. gbpat98.seq - Patent sequence entries, part 98.
1526. gbpat99.seq - Patent sequence entries, part 99.
1527. gbphg1.seq - Phage sequence entries, part 1.
1528. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1529. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1530. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1531. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1532. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1533. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1534. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1535. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1536. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1537. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1538. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1539. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1540. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1541. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1542. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1543. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1544. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1545. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1546. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1547. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1548. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1549. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1550. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1551. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1552. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1553. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1554. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1555. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1556. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1557. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1558. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1559. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1560. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1561. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1562. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1563. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1564. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1565. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1566. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1567. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1568. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1569. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1570. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1571. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1572. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1573. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1574. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1575. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1576. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
1577. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
1578. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
1579. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
1580. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
1581. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1582. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1583. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1584. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1585. gbpri1.seq - Primate sequence entries, part 1.
1586. gbpri10.seq - Primate sequence entries, part 10.
1587. gbpri11.seq - Primate sequence entries, part 11.
1588. gbpri12.seq - Primate sequence entries, part 12.
1589. gbpri13.seq - Primate sequence entries, part 13.
1590. gbpri14.seq - Primate sequence entries, part 14.
1591. gbpri15.seq - Primate sequence entries, part 15.
1592. gbpri16.seq - Primate sequence entries, part 16.
1593. gbpri17.seq - Primate sequence entries, part 17.
1594. gbpri18.seq - Primate sequence entries, part 18.
1595. gbpri19.seq - Primate sequence entries, part 19.
1596. gbpri2.seq - Primate sequence entries, part 2.
1597. gbpri20.seq - Primate sequence entries, part 20.
1598. gbpri21.seq - Primate sequence entries, part 21.
1599. gbpri22.seq - Primate sequence entries, part 22.
1600. gbpri23.seq - Primate sequence entries, part 23.
1601. gbpri24.seq - Primate sequence entries, part 24.
1602. gbpri25.seq - Primate sequence entries, part 25.
1603. gbpri26.seq - Primate sequence entries, part 26.
1604. gbpri27.seq - Primate sequence entries, part 27.
1605. gbpri28.seq - Primate sequence entries, part 28.
1606. gbpri29.seq - Primate sequence entries, part 29.
1607. gbpri3.seq - Primate sequence entries, part 3.
1608. gbpri30.seq - Primate sequence entries, part 30.
1609. gbpri31.seq - Primate sequence entries, part 31.
1610. gbpri32.seq - Primate sequence entries, part 32.
1611. gbpri33.seq - Primate sequence entries, part 33.
1612. gbpri34.seq - Primate sequence entries, part 34.
1613. gbpri35.seq - Primate sequence entries, part 35.
1614. gbpri36.seq - Primate sequence entries, part 36.
1615. gbpri37.seq - Primate sequence entries, part 37.
1616. gbpri38.seq - Primate sequence entries, part 38.
1617. gbpri39.seq - Primate sequence entries, part 39.
1618. gbpri4.seq - Primate sequence entries, part 4.
1619. gbpri40.seq - Primate sequence entries, part 40.
1620. gbpri41.seq - Primate sequence entries, part 41.
1621. gbpri42.seq - Primate sequence entries, part 42.
1622. gbpri43.seq - Primate sequence entries, part 43.
1623. gbpri44.seq - Primate sequence entries, part 44.
1624. gbpri45.seq - Primate sequence entries, part 45.
1625. gbpri5.seq - Primate sequence entries, part 5.
1626. gbpri6.seq - Primate sequence entries, part 6.
1627. gbpri7.seq - Primate sequence entries, part 7.
1628. gbpri8.seq - Primate sequence entries, part 8.
1629. gbpri9.seq - Primate sequence entries, part 9.
1630. gbrel.txt - Release notes (this document).
1631. gbrod1.seq - Rodent sequence entries, part 1.
1632. gbrod10.seq - Rodent sequence entries, part 10.
1633. gbrod11.seq - Rodent sequence entries, part 11.
1634. gbrod12.seq - Rodent sequence entries, part 12.
1635. gbrod13.seq - Rodent sequence entries, part 13.
1636. gbrod14.seq - Rodent sequence entries, part 14.
1637. gbrod15.seq - Rodent sequence entries, part 15.
1638. gbrod16.seq - Rodent sequence entries, part 16.
1639. gbrod17.seq - Rodent sequence entries, part 17.
1640. gbrod18.seq - Rodent sequence entries, part 18.
1641. gbrod19.seq - Rodent sequence entries, part 19.
1642. gbrod2.seq - Rodent sequence entries, part 2.
1643. gbrod20.seq - Rodent sequence entries, part 20.
1644. gbrod21.seq - Rodent sequence entries, part 21.
1645. gbrod22.seq - Rodent sequence entries, part 22.
1646. gbrod23.seq - Rodent sequence entries, part 23.
1647. gbrod24.seq - Rodent sequence entries, part 24.
1648. gbrod25.seq - Rodent sequence entries, part 25.
1649. gbrod26.seq - Rodent sequence entries, part 26.
1650. gbrod27.seq - Rodent sequence entries, part 27.
1651. gbrod28.seq - Rodent sequence entries, part 28.
1652. gbrod29.seq - Rodent sequence entries, part 29.
1653. gbrod3.seq - Rodent sequence entries, part 3.
1654. gbrod4.seq - Rodent sequence entries, part 4.
1655. gbrod5.seq - Rodent sequence entries, part 5.
1656. gbrod6.seq - Rodent sequence entries, part 6.
1657. gbrod7.seq - Rodent sequence entries, part 7.
1658. gbrod8.seq - Rodent sequence entries, part 8.
1659. gbrod9.seq - Rodent sequence entries, part 9.
1660. gbsdr1.txt - Short directory of the data bank, part 1.
1661. gbsdr2.txt - Short directory of the data bank, part 2.
1662. gbsdr3.txt - Short directory of the data bank, part 3.
1663. gbsec.idx - Index of the entries according to secondary accession number.
1664. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1665. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1666. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1667. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1668. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1669. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1670. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1671. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1672. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1673. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1674. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1675. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1676. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1677. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1678. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1679. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1680. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1681. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1682. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1683. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1684. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1685. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1686. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1687. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
1688. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
1689. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
1690. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
1691. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1692. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1693. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1694. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1695. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1696. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1697. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1698. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1699. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1700. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1701. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1702. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1703. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1704. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1705. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1706. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1707. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1708. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1709. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1710. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1711. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1712. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1713. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1714. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1715. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
1716. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
1717. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
1718. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
1719. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
1720. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
1721. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
1722. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
1723. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
1724. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1725. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
1726. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
1727. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
1728. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
1729. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
1730. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
1731. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
1732. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
1733. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
1734. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
1735. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1736. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
1737. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
1738. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
1739. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
1740. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
1741. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
1742. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
1743. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
1744. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
1745. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
1746. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1747. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
1748. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
1749. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
1750. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
1751. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
1752. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
1753. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
1754. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
1755. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
1756. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
1757. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1758. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
1759. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
1760. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
1761. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
1762. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
1763. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
1764. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
1765. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
1766. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
1767. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
1768. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1769. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
1770. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
1771. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
1772. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
1773. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
1774. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
1775. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
1776. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1777. gbuna1.seq - Unannotated sequence entries, part 1.
1778. gbvrl1.seq - Viral sequence entries, part 1.
1779. gbvrl10.seq - Viral sequence entries, part 10.
1780. gbvrl11.seq - Viral sequence entries, part 11.
1781. gbvrl12.seq - Viral sequence entries, part 12.
1782. gbvrl13.seq - Viral sequence entries, part 13.
1783. gbvrl14.seq - Viral sequence entries, part 14.
1784. gbvrl15.seq - Viral sequence entries, part 15.
1785. gbvrl16.seq - Viral sequence entries, part 16.
1786. gbvrl17.seq - Viral sequence entries, part 17.
1787. gbvrl18.seq - Viral sequence entries, part 18.
1788. gbvrl19.seq - Viral sequence entries, part 19.
1789. gbvrl2.seq - Viral sequence entries, part 2.
1790. gbvrl20.seq - Viral sequence entries, part 20.
1791. gbvrl21.seq - Viral sequence entries, part 21.
1792. gbvrl3.seq - Viral sequence entries, part 3.
1793. gbvrl4.seq - Viral sequence entries, part 4.
1794. gbvrl5.seq - Viral sequence entries, part 5.
1795. gbvrl6.seq - Viral sequence entries, part 6.
1796. gbvrl7.seq - Viral sequence entries, part 7.
1797. gbvrl8.seq - Viral sequence entries, part 8.
1798. gbvrl9.seq - Viral sequence entries, part 9.
1799. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1800. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1801. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1802. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1803. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1804. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1805. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1806. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1807. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1808. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1809. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1810. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1811. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1812. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1813. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1814. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1815. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1816. gbvrt25.seq - Other vertebrate sequence entries, part 25.
1817. gbvrt26.seq - Other vertebrate sequence entries, part 26.
1818. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1819. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1820. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1821. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1822. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1823. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1824. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 190.0 flatfiles require roughly 553 GB (sequence
files only) or 595 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
2044852570 gbacc1.idx
2415664515 gbacc2.idx
848527752 gbacc3.idx
185421350 gbaut1.idx
184392335 gbaut10.idx
184264005 gbaut11.idx
184620379 gbaut12.idx
186026701 gbaut13.idx
187347158 gbaut14.idx
183895460 gbaut15.idx
190145846 gbaut16.idx
190964581 gbaut17.idx
185818125 gbaut18.idx
246586990 gbaut19.idx
251952312 gbaut2.idx
189963780 gbaut20.idx
185462589 gbaut21.idx
183919833 gbaut22.idx
216922016 gbaut23.idx
188106542 gbaut24.idx
184113217 gbaut25.idx
184297510 gbaut26.idx
186520333 gbaut27.idx
184965954 gbaut28.idx
187484093 gbaut29.idx
224319905 gbaut3.idx
198214632 gbaut30.idx
195621744 gbaut31.idx
219320842 gbaut32.idx
224899136 gbaut33.idx
183949192 gbaut34.idx
194148008 gbaut35.idx
208578955 gbaut36.idx
183870384 gbaut37.idx
191491819 gbaut38.idx
184530335 gbaut39.idx
183997366 gbaut4.idx
202000366 gbaut40.idx
185293208 gbaut41.idx
185157022 gbaut42.idx
187444112 gbaut43.idx
188146741 gbaut44.idx
184117010 gbaut45.idx
183810312 gbaut46.idx
185733688 gbaut47.idx
206064385 gbaut48.idx
183936703 gbaut49.idx
254855678 gbaut5.idx
184563710 gbaut50.idx
184483774 gbaut51.idx
187076337 gbaut52.idx
205044241 gbaut53.idx
187387952 gbaut54.idx
184582804 gbaut55.idx
190950833 gbaut56.idx
184645088 gbaut57.idx
184385903 gbaut58.idx
245127099 gbaut59.idx
208699189 gbaut6.idx
184402025 gbaut60.idx
183919198 gbaut61.idx
184000264 gbaut62.idx
187583149 gbaut63.idx
183873946 gbaut64.idx
213552878 gbaut65.idx
183854230 gbaut66.idx
185134916 gbaut67.idx
184236973 gbaut68.idx
186781187 gbaut69.idx
188797534 gbaut7.idx
235376470 gbaut70.idx
194370833 gbaut71.idx
184122396 gbaut72.idx
187679140 gbaut73.idx
184043136 gbaut74.idx
184206776 gbaut75.idx
184709093 gbaut76.idx
205726900 gbaut77.idx
235131661 gbaut78.idx
222030024 gbaut79.idx
184402781 gbaut8.idx
184051272 gbaut80.idx
186470472 gbaut81.idx
183908610 gbaut82.idx
187047378 gbaut83.idx
183990677 gbaut84.idx
201132434 gbaut85.idx
195295249 gbaut86.idx
248712445 gbaut87.idx
184061738 gbaut88.idx
184213804 gbaut89.idx
203801420 gbaut9.idx
183877934 gbaut90.idx
200775865 gbaut91.idx
184049976 gbaut92.idx
199064588 gbaut93.idx
184590059 gbaut94.idx
188003483 gbaut95.idx
211333928 gbaut96.idx
187057119 gbaut97.idx
189726762 gbaut98.idx
31933974 gbaut99.idx
250000180 gbbct1.seq
248267367 gbbct10.seq
248781226 gbbct11.seq
238005077 gbbct12.seq
249996924 gbbct13.seq
55049918 gbbct14.seq
243170751 gbbct15.seq
249783342 gbbct16.seq
245552146 gbbct17.seq
248629037 gbbct18.seq
248242267 gbbct19.seq
248881985 gbbct2.seq
249282033 gbbct20.seq
246198766 gbbct21.seq
245693484 gbbct22.seq
217807523 gbbct23.seq
242803907 gbbct24.seq
241841159 gbbct25.seq
248677491 gbbct26.seq
247875393 gbbct27.seq
249388317 gbbct28.seq
244186125 gbbct29.seq
247570692 gbbct3.seq
247337080 gbbct30.seq
249996823 gbbct31.seq
249761469 gbbct32.seq
249791029 gbbct33.seq
242886692 gbbct34.seq
241636446 gbbct35.seq
164818069 gbbct36.seq
243024940 gbbct37.seq
244319012 gbbct38.seq
244939796 gbbct39.seq
241184768 gbbct4.seq
235925835 gbbct40.seq
246706138 gbbct41.seq
248039724 gbbct42.seq
246778832 gbbct43.seq
231062264 gbbct44.seq
243873251 gbbct45.seq
249854455 gbbct46.seq
235954696 gbbct47.seq
231580036 gbbct48.seq
249922026 gbbct49.seq
213987193 gbbct5.seq
247105195 gbbct50.seq
241662950 gbbct51.seq
245557908 gbbct52.seq
244123130 gbbct53.seq
240008572 gbbct54.seq
241268712 gbbct55.seq
249301542 gbbct56.seq
249373846 gbbct57.seq
247134592 gbbct58.seq
242978877 gbbct59.seq
242137198 gbbct6.seq
242457662 gbbct60.seq
45359479 gbbct61.seq
247983762 gbbct62.seq
229930428 gbbct63.seq
242702827 gbbct64.seq
249715641 gbbct65.seq
245213927 gbbct66.seq
243140196 gbbct67.seq
29465664 gbbct68.seq
6888220 gbbct69.seq
244097584 gbbct7.seq
14097435 gbbct70.seq
23202049 gbbct71.seq
45101216 gbbct72.seq
87786070 gbbct73.seq
170123232 gbbct74.seq
249998228 gbbct75.seq
249998024 gbbct76.seq
243975663 gbbct77.seq
239379383 gbbct78.seq
247410755 gbbct79.seq
229621289 gbbct8.seq
248640310 gbbct80.seq
249437581 gbbct81.seq
249998318 gbbct82.seq
105443708 gbbct83.seq
249839347 gbbct84.seq
249999049 gbbct85.seq
249999820 gbbct86.seq
249999785 gbbct87.seq
226018478 gbbct88.seq
245129482 gbbct9.seq
24939851 gbchg.txt
249998031 gbcon1.seq
249997677 gbcon10.seq
249994223 gbcon100.seq
249995660 gbcon101.seq
249998605 gbcon102.seq
249998936 gbcon103.seq
250000223 gbcon104.seq
156342446 gbcon105.seq
249996812 gbcon106.seq
249993767 gbcon107.seq
249992301 gbcon108.seq
249998253 gbcon109.seq
249620021 gbcon11.seq
71761075 gbcon110.seq
213032643 gbcon111.seq
250000256 gbcon112.seq
250000098 gbcon113.seq
249995503 gbcon114.seq
249986388 gbcon115.seq
109734089 gbcon116.seq
249914315 gbcon117.seq
249998919 gbcon118.seq
180318680 gbcon119.seq
247541115 gbcon12.seq
249997285 gbcon120.seq
250000198 gbcon121.seq
249998745 gbcon122.seq
222379519 gbcon123.seq
249624887 gbcon124.seq
249970373 gbcon125.seq
249856213 gbcon126.seq
249999989 gbcon127.seq
250000179 gbcon128.seq
249994568 gbcon129.seq
248688966 gbcon13.seq
27918785 gbcon130.seq
249966898 gbcon131.seq
249999302 gbcon132.seq
249996205 gbcon133.seq
249897273 gbcon134.seq
249952724 gbcon135.seq
249989812 gbcon136.seq
249979778 gbcon137.seq
233694874 gbcon138.seq
246632492 gbcon139.seq
250000019 gbcon14.seq
247106152 gbcon140.seq
249710173 gbcon141.seq
249974201 gbcon142.seq
108900727 gbcon143.seq
250000100 gbcon144.seq
249759495 gbcon145.seq
249994840 gbcon146.seq
249882748 gbcon147.seq
249997548 gbcon148.seq
249997824 gbcon149.seq
65047734 gbcon15.seq
249984507 gbcon150.seq
249999751 gbcon151.seq
203507428 gbcon152.seq
249976952 gbcon153.seq
249999146 gbcon154.seq
249999767 gbcon155.seq
249936790 gbcon156.seq
250000041 gbcon157.seq
130404362 gbcon158.seq
250000007 gbcon159.seq
248523003 gbcon16.seq
249982484 gbcon160.seq
249998652 gbcon161.seq
249997399 gbcon162.seq
249999113 gbcon163.seq
249974608 gbcon164.seq
249958025 gbcon165.seq
249919532 gbcon166.seq
249993346 gbcon167.seq
142933131 gbcon168.seq
18856950 gbcon169.seq
249997898 gbcon17.seq
249790103 gbcon18.seq
57840649 gbcon19.seq
248936838 gbcon2.seq
249997878 gbcon20.seq
249747589 gbcon21.seq
116219457 gbcon22.seq
249999291 gbcon23.seq
120224101 gbcon24.seq
249998895 gbcon25.seq
249823610 gbcon26.seq
250000223 gbcon27.seq
249997453 gbcon28.seq
186630076 gbcon29.seq
249787214 gbcon3.seq
249999756 gbcon30.seq
249997224 gbcon31.seq
249999813 gbcon32.seq
249999952 gbcon33.seq
248008966 gbcon34.seq
232565670 gbcon35.seq
249999237 gbcon36.seq
249996869 gbcon37.seq
249995921 gbcon38.seq
249996351 gbcon39.seq
249992212 gbcon4.seq
249999450 gbcon40.seq
249997210 gbcon41.seq
61183731 gbcon42.seq
249997486 gbcon43.seq
249994070 gbcon44.seq
249999391 gbcon45.seq
249997743 gbcon46.seq
249994859 gbcon47.seq
43089049 gbcon48.seq
249993995 gbcon49.seq
249999297 gbcon5.seq
249996310 gbcon50.seq
249994442 gbcon51.seq
249997248 gbcon52.seq
250000078 gbcon53.seq
36404971 gbcon54.seq
249993185 gbcon55.seq
249998119 gbcon56.seq
249995170 gbcon57.seq
249998154 gbcon58.seq
249998078 gbcon59.seq
249999478 gbcon6.seq
152679523 gbcon60.seq
249999955 gbcon61.seq
249999066 gbcon62.seq
249997558 gbcon63.seq
249998625 gbcon64.seq
183609322 gbcon65.seq
249999870 gbcon66.seq
249997967 gbcon67.seq
249997138 gbcon68.seq
249995207 gbcon69.seq
249952781 gbcon7.seq
245488804 gbcon70.seq
250000182 gbcon71.seq
249998695 gbcon72.seq
249998372 gbcon73.seq
249996966 gbcon74.seq
250000007 gbcon75.seq
96627683 gbcon76.seq
249993448 gbcon77.seq
249997901 gbcon78.seq
249999306 gbcon79.seq
249993269 gbcon8.seq
249998084 gbcon80.seq
249998231 gbcon81.seq
63991927 gbcon82.seq
249999058 gbcon83.seq
249997187 gbcon84.seq
249997685 gbcon85.seq
249997978 gbcon86.seq
249999931 gbcon87.seq
23617925 gbcon88.seq
249997115 gbcon89.seq
249998986 gbcon9.seq
249995538 gbcon90.seq
249998987 gbcon91.seq
249999150 gbcon92.seq
199759401 gbcon93.seq
249998078 gbcon94.seq
249998929 gbcon95.seq
249997180 gbcon96.seq
249997829 gbcon97.seq
249999974 gbcon98.seq
133578884 gbcon99.seq
72435 gbdel.txt
249999575 gbenv1.seq
250000185 gbenv10.seq
56503904 gbenv11.seq
249999642 gbenv12.seq
249998684 gbenv13.seq
249999911 gbenv14.seq
249999049 gbenv15.seq
249999687 gbenv16.seq
249999958 gbenv17.seq
249997180 gbenv18.seq
209169909 gbenv19.seq
249998261 gbenv2.seq
250000259 gbenv20.seq
250000154 gbenv21.seq
249998998 gbenv22.seq
249999430 gbenv23.seq
156315060 gbenv24.seq
249998860 gbenv25.seq
249997133 gbenv26.seq
249999398 gbenv27.seq
250000134 gbenv28.seq
249998129 gbenv29.seq
249998727 gbenv3.seq
168375285 gbenv30.seq
250000150 gbenv31.seq
249998347 gbenv32.seq
249999049 gbenv33.seq
249997022 gbenv34.seq
185875694 gbenv35.seq
249999717 gbenv36.seq
249999103 gbenv37.seq
249997083 gbenv38.seq
249997894 gbenv39.seq
250000220 gbenv4.seq
249996689 gbenv40.seq
249996831 gbenv41.seq
21888207 gbenv42.seq
249999002 gbenv43.seq
249998549 gbenv44.seq
249998178 gbenv45.seq
249999252 gbenv46.seq
167938448 gbenv47.seq
249997838 gbenv48.seq
249999471 gbenv49.seq
249998701 gbenv5.seq
249996304 gbenv50.seq
249999127 gbenv51.seq
249998713 gbenv52.seq
249999871 gbenv53.seq
183666247 gbenv54.seq
240962733 gbenv6.seq
249997397 gbenv7.seq
249999216 gbenv8.seq
249997830 gbenv9.seq
524292008 gbest1.seq
524288804 gbest10.seq
524288818 gbest100.seq
524290484 gbest101.seq
524290989 gbest102.seq
524288825 gbest103.seq
360266833 gbest104.seq
524291148 gbest105.seq
524288844 gbest106.seq
524292352 gbest107.seq
385897526 gbest108.seq
389627022 gbest109.seq
524291005 gbest11.seq
383480158 gbest110.seq
384129224 gbest111.seq
381044237 gbest112.seq
385319121 gbest113.seq
390042794 gbest114.seq
388183097 gbest115.seq
387287058 gbest116.seq
383873517 gbest117.seq
407574183 gbest118.seq
511503823 gbest119.seq
524290913 gbest12.seq
524289208 gbest120.seq
524289368 gbest121.seq
524289152 gbest122.seq
524290278 gbest123.seq
428160305 gbest124.seq
524289395 gbest125.seq
524291003 gbest126.seq
524289206 gbest127.seq
524288788 gbest128.seq
524292302 gbest129.seq
156598007 gbest13.seq
524290254 gbest130.seq
524288989 gbest131.seq
524291260 gbest132.seq
524289953 gbest133.seq
524292326 gbest134.seq
524289013 gbest135.seq
524290520 gbest136.seq
299893019 gbest137.seq
524290513 gbest138.seq
524289694 gbest139.seq
524289958 gbest14.seq
524288973 gbest140.seq
524290363 gbest141.seq
524293655 gbest142.seq
524289734 gbest143.seq
524290694 gbest144.seq
524290459 gbest145.seq
524291200 gbest146.seq
524291784 gbest147.seq
524289899 gbest148.seq
524288888 gbest149.seq
524291437 gbest15.seq
524291140 gbest150.seq
465419493 gbest151.seq
524290089 gbest152.seq
524291577 gbest153.seq
524288928 gbest154.seq
524288878 gbest155.seq
524290400 gbest156.seq
524289353 gbest157.seq
524291205 gbest158.seq
524289380 gbest159.seq
524289303 gbest16.seq
524290761 gbest160.seq
524289178 gbest161.seq
524288730 gbest162.seq
524290933 gbest163.seq
245079342 gbest164.seq
524289428 gbest165.seq
524290492 gbest166.seq
524291139 gbest167.seq
524290360 gbest168.seq
524290893 gbest169.seq
524291325 gbest17.seq
524289558 gbest170.seq
524290613 gbest171.seq
524290355 gbest172.seq
524289228 gbest173.seq
524290186 gbest174.seq
524290536 gbest175.seq
524288940 gbest176.seq
524292341 gbest177.seq
111192436 gbest178.seq
524290449 gbest179.seq
524290068 gbest18.seq
524290245 gbest180.seq
524289032 gbest181.seq
524290805 gbest182.seq
524290975 gbest183.seq
524290572 gbest184.seq
524292060 gbest185.seq
524289570 gbest186.seq
524290463 gbest187.seq
524289124 gbest188.seq
524291002 gbest189.seq
524292240 gbest19.seq
524289736 gbest190.seq
467468230 gbest191.seq
524292836 gbest192.seq
524289584 gbest193.seq
524289688 gbest194.seq
524290421 gbest195.seq
524291331 gbest196.seq
524290000 gbest197.seq
524290120 gbest198.seq
524289941 gbest199.seq
524289694 gbest2.seq
524289440 gbest20.seq
524290799 gbest200.seq
524291059 gbest201.seq
524289743 gbest202.seq
524291709 gbest203.seq
524290922 gbest204.seq
78323409 gbest205.seq
524290998 gbest206.seq
524289308 gbest207.seq
524290738 gbest208.seq
524289458 gbest209.seq
524290938 gbest21.seq
524292317 gbest210.seq
524289332 gbest211.seq
524290236 gbest212.seq
524288826 gbest213.seq
524288730 gbest214.seq
524290086 gbest215.seq
419061324 gbest216.seq
524291312 gbest217.seq
524292660 gbest218.seq
524289985 gbest219.seq
511473455 gbest22.seq
524290465 gbest220.seq
524288877 gbest221.seq
524289271 gbest222.seq
524292296 gbest223.seq
524290436 gbest224.seq
524289296 gbest225.seq
524288978 gbest226.seq
524290505 gbest227.seq
524290541 gbest228.seq
524292348 gbest229.seq
500459870 gbest23.seq
348447235 gbest230.seq
524288851 gbest231.seq
524289665 gbest232.seq
524289697 gbest233.seq
524288722 gbest234.seq
524292658 gbest235.seq
524289802 gbest236.seq
524291322 gbest237.seq
524289521 gbest238.seq
524290452 gbest239.seq
509316969 gbest24.seq
524290068 gbest240.seq
524290546 gbest241.seq
524289110 gbest242.seq
524291672 gbest243.seq
524291052 gbest244.seq
48098032 gbest245.seq
524290789 gbest246.seq
524289809 gbest247.seq
524291785 gbest248.seq
524290787 gbest249.seq
318221390 gbest25.seq
524288904 gbest250.seq
524290074 gbest251.seq
524289617 gbest252.seq
524292072 gbest253.seq
524291092 gbest254.seq
524289670 gbest255.seq
524291387 gbest256.seq
260315307 gbest257.seq
524289205 gbest258.seq
524290518 gbest259.seq
524289786 gbest26.seq
524289209 gbest260.seq
524290324 gbest261.seq
524289231 gbest262.seq
524290692 gbest263.seq
524290618 gbest264.seq
524289350 gbest265.seq
524290766 gbest266.seq
524292392 gbest267.seq
296849686 gbest268.seq
524289652 gbest269.seq
524290608 gbest27.seq
524290620 gbest270.seq
524288728 gbest271.seq
524289720 gbest272.seq
524290852 gbest273.seq
524291105 gbest274.seq
524288912 gbest275.seq
524290060 gbest276.seq
524288862 gbest277.seq
524291602 gbest278.seq
524292455 gbest279.seq
524290267 gbest28.seq
302201519 gbest280.seq
524292997 gbest281.seq
524288962 gbest282.seq
524289504 gbest283.seq
524290600 gbest284.seq
524289318 gbest285.seq
524290164 gbest286.seq
524289230 gbest287.seq
524291333 gbest288.seq
524289850 gbest289.seq
524290004 gbest29.seq
524290445 gbest290.seq
524291756 gbest291.seq
227738575 gbest292.seq
524288789 gbest293.seq
524289637 gbest294.seq
524290096 gbest295.seq
524292128 gbest296.seq
524291196 gbest297.seq
524290208 gbest298.seq
524290154 gbest299.seq
497701912 gbest3.seq
524292588 gbest30.seq
524288840 gbest300.seq
477430888 gbest301.seq
485388879 gbest302.seq
487643262 gbest303.seq
320034000 gbest304.seq
524291386 gbest305.seq
524290165 gbest306.seq
524292927 gbest307.seq
524289307 gbest308.seq
524292226 gbest309.seq
524290499 gbest31.seq
524292112 gbest310.seq
524290451 gbest311.seq
524290048 gbest312.seq
524290484 gbest313.seq
524290293 gbest314.seq
524290387 gbest315.seq
524291914 gbest316.seq
497672470 gbest317.seq
524290018 gbest318.seq
524291635 gbest319.seq
524291105 gbest32.seq
524290461 gbest320.seq
524291229 gbest321.seq
524289371 gbest322.seq
524291825 gbest323.seq
524290125 gbest324.seq
524290035 gbest325.seq
524291136 gbest326.seq
524114479 gbest327.seq
524290817 gbest328.seq
524291046 gbest329.seq
524289163 gbest33.seq
524290311 gbest330.seq
250277380 gbest331.seq
524288866 gbest332.seq
524290019 gbest333.seq
524290178 gbest334.seq
524293206 gbest335.seq
501679664 gbest336.seq
524289164 gbest337.seq
524290950 gbest338.seq
524291691 gbest339.seq
519995576 gbest34.seq
524289435 gbest340.seq
524291244 gbest341.seq
524292163 gbest342.seq
524289348 gbest343.seq
524292124 gbest344.seq
344037444 gbest345.seq
524290826 gbest346.seq
524290153 gbest347.seq
524290301 gbest348.seq
524289021 gbest349.seq
492752443 gbest35.seq
524289883 gbest350.seq
524289255 gbest351.seq
524290258 gbest352.seq
524292881 gbest353.seq
524291885 gbest354.seq
524291474 gbest355.seq
524290706 gbest356.seq
524291844 gbest357.seq
524291922 gbest358.seq
524288931 gbest359.seq
494461889 gbest36.seq
23569950 gbest360.seq
524288752 gbest361.seq
524290986 gbest362.seq
524291467 gbest363.seq
524290555 gbest364.seq
524291695 gbest365.seq
524289885 gbest366.seq
524290151 gbest367.seq
524290226 gbest368.seq
524290837 gbest369.seq
493329100 gbest37.seq
524290488 gbest370.seq
386815583 gbest371.seq
524289237 gbest372.seq
524288899 gbest373.seq
524290516 gbest374.seq
524291457 gbest375.seq
524289052 gbest376.seq
524291580 gbest377.seq
524289198 gbest378.seq
524291118 gbest379.seq
487992523 gbest38.seq
524289322 gbest380.seq
524290962 gbest381.seq
524290805 gbest382.seq
342053922 gbest383.seq
524289067 gbest384.seq
524289146 gbest385.seq
524288752 gbest386.seq
524289317 gbest387.seq
524288961 gbest388.seq
524292348 gbest389.seq
493187931 gbest39.seq
524289085 gbest390.seq
524290160 gbest391.seq
524290764 gbest392.seq
524289444 gbest393.seq
524290079 gbest394.seq
61522159 gbest395.seq
524289249 gbest396.seq
524289216 gbest397.seq
524289670 gbest398.seq
524290267 gbest399.seq
524288944 gbest4.seq
112853555 gbest40.seq
524290202 gbest400.seq
524290252 gbest401.seq
524292014 gbest402.seq
524288877 gbest403.seq
524289957 gbest404.seq
524289922 gbest405.seq
524290394 gbest406.seq
524289348 gbest407.seq
484177592 gbest408.seq
524289812 gbest409.seq
524294013 gbest41.seq
524289705 gbest410.seq
524289420 gbest411.seq
524291025 gbest412.seq
524291458 gbest413.seq
524290483 gbest414.seq
524292475 gbest415.seq
524289421 gbest416.seq
524291735 gbest417.seq
524291381 gbest418.seq
524290155 gbest419.seq
524292378 gbest42.seq
524289129 gbest420.seq
486207566 gbest421.seq
524290939 gbest422.seq
524291326 gbest423.seq
524291321 gbest424.seq
524289762 gbest425.seq
524290372 gbest426.seq
524289413 gbest427.seq
524289874 gbest428.seq
524291260 gbest429.seq
524291152 gbest43.seq
524290912 gbest430.seq
524290057 gbest431.seq
524290498 gbest432.seq
524293648 gbest433.seq
524290014 gbest434.seq
524290211 gbest435.seq
84614311 gbest436.seq
524290862 gbest437.seq
524288939 gbest438.seq
524289644 gbest439.seq
524291055 gbest44.seq
524291690 gbest440.seq
524290578 gbest441.seq
524289510 gbest442.seq
524291974 gbest443.seq
524290738 gbest444.seq
524290766 gbest445.seq
524289893 gbest446.seq
524289258 gbest447.seq
433310930 gbest448.seq
524289173 gbest449.seq
524289238 gbest45.seq
524291143 gbest450.seq
524289693 gbest451.seq
524289086 gbest452.seq
524290878 gbest453.seq
524289515 gbest454.seq
524290201 gbest455.seq
524289595 gbest456.seq
524289554 gbest457.seq
524290008 gbest458.seq
524292517 gbest459.seq
524290835 gbest46.seq
257179200 gbest460.seq
524290282 gbest461.seq
524291959 gbest462.seq
524289607 gbest463.seq
247932027 gbest464.seq
524291007 gbest47.seq
524290466 gbest48.seq
524290144 gbest49.seq
524289625 gbest5.seq
524290479 gbest50.seq
524290055 gbest51.seq
524288929 gbest52.seq
524288811 gbest53.seq
253344689 gbest54.seq
524289570 gbest55.seq
524289580 gbest56.seq
524291000 gbest57.seq
524289394 gbest58.seq
524290388 gbest59.seq
524288762 gbest6.seq
524290340 gbest60.seq
524291470 gbest61.seq
524289195 gbest62.seq
524291539 gbest63.seq
524289624 gbest64.seq
524289234 gbest65.seq
524289537 gbest66.seq
462233312 gbest67.seq
524289050 gbest68.seq
524289702 gbest69.seq
524288977 gbest7.seq
524290845 gbest70.seq
524289719 gbest71.seq
524289761 gbest72.seq
524292289 gbest73.seq
524289181 gbest74.seq
524289131 gbest75.seq
524294841 gbest76.seq
524291384 gbest77.seq
524292274 gbest78.seq
524290205 gbest79.seq
524290062 gbest8.seq
189165514 gbest80.seq
524290308 gbest81.seq
524289330 gbest82.seq
524289924 gbest83.seq
524289535 gbest84.seq
524290767 gbest85.seq
524289277 gbest86.seq
524289276 gbest87.seq
524292778 gbest88.seq
524291975 gbest89.seq
524291254 gbest9.seq
524289841 gbest90.seq
524289188 gbest91.seq
461500840 gbest92.seq
524290500 gbest93.seq
524292054 gbest94.seq
524291571 gbest95.seq
524289444 gbest96.seq
524290291 gbest97.seq
524289582 gbest98.seq
524290127 gbest99.seq
187813575 gbgen.idx
524290527 gbgss1.seq
524292173 gbgss10.seq
524292593 gbgss100.seq
524289703 gbgss101.seq
524291138 gbgss102.seq
524290642 gbgss103.seq
418354253 gbgss104.seq
524290801 gbgss105.seq
524290070 gbgss106.seq
524290718 gbgss107.seq
524288733 gbgss108.seq
524288767 gbgss109.seq
524291375 gbgss11.seq
524289084 gbgss110.seq
524290809 gbgss111.seq
524289971 gbgss112.seq
524291028 gbgss113.seq
524291069 gbgss114.seq
524289142 gbgss115.seq
55578194 gbgss116.seq
524289720 gbgss117.seq
524288912 gbgss118.seq
524289210 gbgss119.seq
524290109 gbgss12.seq
524289140 gbgss120.seq
524290683 gbgss121.seq
524289663 gbgss122.seq
524289754 gbgss123.seq
524289869 gbgss124.seq
524290826 gbgss125.seq
524289630 gbgss126.seq
524289664 gbgss127.seq
524289492 gbgss128.seq
212391980 gbgss129.seq
524289051 gbgss13.seq
524289179 gbgss130.seq
524289525 gbgss131.seq
524289495 gbgss132.seq
524291043 gbgss133.seq
524288845 gbgss134.seq
524289778 gbgss135.seq
524289824 gbgss136.seq
524288865 gbgss137.seq
524289151 gbgss138.seq
516020805 gbgss139.seq
524289106 gbgss14.seq
515998318 gbgss140.seq
138159804 gbgss141.seq
524289872 gbgss142.seq
524291315 gbgss143.seq
524290700 gbgss144.seq
524291307 gbgss145.seq
524290782 gbgss146.seq
524289701 gbgss147.seq
524289366 gbgss148.seq
524291141 gbgss149.seq
524291452 gbgss15.seq
524290962 gbgss150.seq
524290372 gbgss151.seq
322462715 gbgss152.seq
120680411 gbgss153.seq
249998816 gbgss154.seq
249999537 gbgss155.seq
249999830 gbgss156.seq
249998731 gbgss157.seq
28697781 gbgss158.seq
249997137 gbgss159.seq
524290551 gbgss16.seq
250000033 gbgss160.seq
249998542 gbgss161.seq
249998333 gbgss162.seq
224919493 gbgss163.seq
249998415 gbgss164.seq
249998761 gbgss165.seq
249998880 gbgss166.seq
249998198 gbgss167.seq
190065974 gbgss168.seq
249999433 gbgss169.seq
524288946 gbgss17.seq
249998390 gbgss170.seq
249999267 gbgss171.seq
249997904 gbgss172.seq
249996938 gbgss173.seq
76835987 gbgss174.seq
249998100 gbgss175.seq
2079852 gbgss176.seq
79542394 gbgss177.seq
249999009 gbgss178.seq
250000259 gbgss179.seq
524291200 gbgss18.seq
87380505 gbgss180.seq
249999685 gbgss181.seq
249998355 gbgss182.seq
249998984 gbgss183.seq
202719103 gbgss184.seq
249999232 gbgss185.seq
249999013 gbgss186.seq
249998851 gbgss187.seq
246250899 gbgss188.seq
249999268 gbgss189.seq
314849258 gbgss19.seq
249997406 gbgss190.seq
249999279 gbgss191.seq
243520281 gbgss192.seq
249999336 gbgss193.seq
249997150 gbgss194.seq
249998209 gbgss195.seq
249998771 gbgss196.seq
122182588 gbgss197.seq
249998013 gbgss198.seq
250000031 gbgss199.seq
524289034 gbgss2.seq
524288952 gbgss20.seq
249999974 gbgss200.seq
249998152 gbgss201.seq
94058788 gbgss202.seq
249998892 gbgss203.seq
249999850 gbgss204.seq
249998239 gbgss205.seq
249999582 gbgss206.seq
180350984 gbgss207.seq
249999236 gbgss208.seq
249997993 gbgss209.seq
524289034 gbgss21.seq
249998006 gbgss210.seq
249999353 gbgss211.seq
95926739 gbgss212.seq
249999461 gbgss213.seq
249999350 gbgss214.seq
249998406 gbgss215.seq
249998619 gbgss216.seq
249999398 gbgss217.seq
249999343 gbgss218.seq
37281900 gbgss219.seq
524291398 gbgss22.seq
249999424 gbgss220.seq
249999963 gbgss221.seq
249997369 gbgss222.seq
43648880 gbgss223.seq
52862187 gbgss224.seq
249999126 gbgss225.seq
249999236 gbgss226.seq
249997873 gbgss227.seq
249998364 gbgss228.seq
30976250 gbgss229.seq
524291152 gbgss23.seq
249997670 gbgss230.seq
249997588 gbgss231.seq
249999018 gbgss232.seq
250000000 gbgss233.seq
28042636 gbgss234.seq
249997661 gbgss235.seq
249998578 gbgss236.seq
249999135 gbgss237.seq
249997568 gbgss238.seq
249999380 gbgss239.seq
524291392 gbgss24.seq
250000153 gbgss240.seq
178837789 gbgss241.seq
249999812 gbgss242.seq
249998926 gbgss243.seq
249999095 gbgss244.seq
220154622 gbgss245.seq
250000034 gbgss246.seq
249997956 gbgss247.seq
250000074 gbgss248.seq
249998729 gbgss249.seq
524290581 gbgss25.seq
195288113 gbgss250.seq
249999561 gbgss251.seq
249998751 gbgss252.seq
249999600 gbgss253.seq
249999029 gbgss254.seq
249999913 gbgss255.seq
31601752 gbgss256.seq
524290713 gbgss26.seq
524289900 gbgss27.seq
524288854 gbgss28.seq
524289528 gbgss29.seq
524289102 gbgss3.seq
524290730 gbgss30.seq
38753639 gbgss31.seq
524289097 gbgss32.seq
524290723 gbgss33.seq
524288828 gbgss34.seq
524289728 gbgss35.seq
524289696 gbgss36.seq
524289533 gbgss37.seq
524290149 gbgss38.seq
509095937 gbgss39.seq
524290615 gbgss4.seq
524288831 gbgss40.seq
524291401 gbgss41.seq
524289030 gbgss42.seq
26828782 gbgss43.seq
524288946 gbgss44.seq
524290506 gbgss45.seq
524290220 gbgss46.seq
524289800 gbgss47.seq
209756868 gbgss48.seq
524291863 gbgss49.seq
168350020 gbgss5.seq
524291582 gbgss50.seq
524290401 gbgss51.seq
524290464 gbgss52.seq
524289775 gbgss53.seq
524289825 gbgss54.seq
524290727 gbgss55.seq
524288905 gbgss56.seq
524290387 gbgss57.seq
524290533 gbgss58.seq
524290102 gbgss59.seq
524290951 gbgss6.seq
5949935 gbgss60.seq
524289023 gbgss61.seq
524290882 gbgss62.seq
524290246 gbgss63.seq
457238462 gbgss64.seq
524291294 gbgss65.seq
524291022 gbgss66.seq
524290625 gbgss67.seq
524289509 gbgss68.seq
524291296 gbgss69.seq
524289102 gbgss7.seq
524290162 gbgss70.seq
524290176 gbgss71.seq
524290850 gbgss72.seq
524289394 gbgss73.seq
524291500 gbgss74.seq
524290572 gbgss75.seq
524290538 gbgss76.seq
32490242 gbgss77.seq
524289537 gbgss78.seq
524291931 gbgss79.seq
524291704 gbgss8.seq
524289482 gbgss80.seq
524290727 gbgss81.seq
524289703 gbgss82.seq
524289751 gbgss83.seq
524289336 gbgss84.seq
524290248 gbgss85.seq
524289011 gbgss86.seq
524292247 gbgss87.seq
524290044 gbgss88.seq
376569727 gbgss89.seq
524290120 gbgss9.seq
524292172 gbgss90.seq
524291677 gbgss91.seq
524291807 gbgss92.seq
524292003 gbgss93.seq
524289134 gbgss94.seq
524289592 gbgss95.seq
524289866 gbgss96.seq
524291875 gbgss97.seq
524291048 gbgss98.seq
524291620 gbgss99.seq
249991127 gbhtc1.seq
249998926 gbhtc10.seq
249999236 gbhtc11.seq
29682109 gbhtc12.seq
249997534 gbhtc13.seq
249993980 gbhtc14.seq
65451009 gbhtc15.seq
249992681 gbhtc2.seq
249996913 gbhtc3.seq
249991889 gbhtc4.seq
249985674 gbhtc5.seq
249997743 gbhtc6.seq
249996123 gbhtc7.seq
83873876 gbhtc8.seq
249996616 gbhtc9.seq
249904748 gbhtg1.seq
249868447 gbhtg10.seq
249917503 gbhtg100.seq
249844944 gbhtg101.seq
249902534 gbhtg102.seq
249987029 gbhtg103.seq
5671243 gbhtg104.seq
249895732 gbhtg105.seq
249878049 gbhtg106.seq
249902764 gbhtg107.seq
249967594 gbhtg108.seq
250000226 gbhtg109.seq
1107147 gbhtg11.seq
249971813 gbhtg110.seq
249766220 gbhtg111.seq
249788603 gbhtg112.seq
249946647 gbhtg113.seq
163821012 gbhtg114.seq
249665693 gbhtg115.seq
249919591 gbhtg116.seq
249991374 gbhtg117.seq
249871063 gbhtg118.seq
249882155 gbhtg119.seq
249888383 gbhtg12.seq
32773126 gbhtg120.seq
249935891 gbhtg121.seq
249834856 gbhtg122.seq
249978158 gbhtg123.seq
249875691 gbhtg124.seq
249782400 gbhtg125.seq
134760056 gbhtg126.seq
249831507 gbhtg127.seq
249847301 gbhtg128.seq
249810840 gbhtg129.seq
249970424 gbhtg13.seq
249939487 gbhtg130.seq
249795004 gbhtg131.seq
249944091 gbhtg132.seq
249805283 gbhtg133.seq
249923506 gbhtg134.seq
249884211 gbhtg135.seq
83860778 gbhtg136.seq
249587437 gbhtg14.seq
249775919 gbhtg15.seq
249742391 gbhtg16.seq
249169910 gbhtg17.seq
249983662 gbhtg18.seq
249677291 gbhtg19.seq
249994630 gbhtg2.seq
249988730 gbhtg20.seq
237145184 gbhtg21.seq
249760624 gbhtg22.seq
249868408 gbhtg23.seq
249987789 gbhtg24.seq
249921752 gbhtg25.seq
249761207 gbhtg26.seq
249891641 gbhtg27.seq
249961480 gbhtg28.seq
249841969 gbhtg29.seq
249950135 gbhtg3.seq
249992987 gbhtg30.seq
225324756 gbhtg31.seq
249827828 gbhtg32.seq
249920767 gbhtg33.seq
249929437 gbhtg34.seq
249919058 gbhtg35.seq
249858205 gbhtg36.seq
249814604 gbhtg37.seq
249767419 gbhtg38.seq
249627604 gbhtg39.seq
249984089 gbhtg4.seq
249839726 gbhtg40.seq
224363115 gbhtg41.seq
249889211 gbhtg42.seq
249786793 gbhtg43.seq
249972417 gbhtg44.seq
249775813 gbhtg45.seq
249912462 gbhtg46.seq
249597716 gbhtg47.seq
249864529 gbhtg48.seq
249792865 gbhtg49.seq
249882044 gbhtg5.seq
249923827 gbhtg50.seq
235040386 gbhtg51.seq
249732627 gbhtg52.seq
249917686 gbhtg53.seq
249773162 gbhtg54.seq
249971346 gbhtg55.seq
249962497 gbhtg56.seq
18795863 gbhtg57.seq
249861195 gbhtg58.seq
249823462 gbhtg59.seq
249898460 gbhtg6.seq
249990521 gbhtg60.seq
249920304 gbhtg61.seq
225327613 gbhtg62.seq
249853600 gbhtg63.seq
249787648 gbhtg64.seq
249883720 gbhtg65.seq
249980269 gbhtg66.seq
249833261 gbhtg67.seq
16614633 gbhtg68.seq
249960711 gbhtg69.seq
249933725 gbhtg7.seq
249973591 gbhtg70.seq
249953795 gbhtg71.seq
249976832 gbhtg72.seq
225068155 gbhtg73.seq
249811067 gbhtg74.seq
249874983 gbhtg75.seq
249800230 gbhtg76.seq
249959810 gbhtg77.seq
244236211 gbhtg78.seq
249883527 gbhtg79.seq
249933567 gbhtg8.seq
249989775 gbhtg80.seq
249839558 gbhtg81.seq
249838461 gbhtg82.seq
216751380 gbhtg83.seq
249966974 gbhtg84.seq
249803194 gbhtg85.seq
249757813 gbhtg86.seq
249849111 gbhtg87.seq
220831145 gbhtg88.seq
249970053 gbhtg89.seq
249923766 gbhtg9.seq
249954204 gbhtg90.seq
249999447 gbhtg91.seq
249963669 gbhtg92.seq
208918917 gbhtg93.seq
249870295 gbhtg94.seq
249947521 gbhtg95.seq
249904005 gbhtg96.seq
249769960 gbhtg97.seq
167889754 gbhtg98.seq
249744688 gbhtg99.seq
249998196 gbinv1.seq
249971413 gbinv10.seq
249999663 gbinv11.seq
178020684 gbinv12.seq
249996424 gbinv13.seq
249999446 gbinv14.seq
249794292 gbinv15.seq
156055946 gbinv16.seq
249999193 gbinv17.seq
248106359 gbinv18.seq
250000004 gbinv19.seq
249881826 gbinv2.seq
249997669 gbinv20.seq
242506515 gbinv21.seq
221960400 gbinv22.seq
175506919 gbinv23.seq
249999938 gbinv24.seq
249998505 gbinv25.seq
86697952 gbinv26.seq
249997122 gbinv27.seq
250000035 gbinv28.seq
249999724 gbinv29.seq
216030968 gbinv3.seq
249967282 gbinv30.seq
44843228 gbinv31.seq
249998743 gbinv4.seq
249998816 gbinv5.seq
247823946 gbinv6.seq
249998641 gbinv7.seq
24808013 gbinv8.seq
249996598 gbinv9.seq
139558808 gbjou1.idx
300645084 gbjou10.idx
264796486 gbjou11.idx
266713528 gbjou12.idx
62151405 gbjou13.idx
142225583 gbjou2.idx
190783414 gbjou3.idx
175873186 gbjou4.idx
268676133 gbjou5.idx
279400150 gbjou6.idx
282355688 gbjou7.idx
276975775 gbjou8.idx
304416879 gbjou9.idx
343324353 gbkey1.idx
180082557 gbkey2.idx
181042928 gbkey3.idx
209164388 gbkey4.idx
327484336 gbkey5.idx
137245763 gbkey6.idx
249786132 gbmam1.seq
249998468 gbmam2.seq
249997934 gbmam3.seq
249999579 gbmam4.seq
249998094 gbmam5.seq
249999879 gbmam6.seq
249999172 gbmam7.seq
24501114 gbmam8.seq
36627826 gbnew.txt
250000194 gbpat1.seq
249999920 gbpat10.seq
249999793 gbpat100.seq
149112469 gbpat101.seq
249999880 gbpat102.seq
249999565 gbpat103.seq
249929731 gbpat104.seq
249824879 gbpat105.seq
249998856 gbpat106.seq
192934528 gbpat107.seq
249999767 gbpat108.seq
249999625 gbpat109.seq
179561584 gbpat11.seq
249997130 gbpat110.seq
80125899 gbpat111.seq
249999944 gbpat112.seq
249999404 gbpat113.seq
249986882 gbpat114.seq
250000102 gbpat115.seq
249868822 gbpat116.seq
66835452 gbpat117.seq
249999441 gbpat118.seq
249999845 gbpat119.seq
249999061 gbpat12.seq
249999888 gbpat120.seq
249999095 gbpat121.seq
160256390 gbpat122.seq
249999974 gbpat123.seq
249999633 gbpat124.seq
234784218 gbpat125.seq
249991591 gbpat126.seq
249970935 gbpat127.seq
249999681 gbpat128.seq
249997397 gbpat129.seq
249999948 gbpat13.seq
249997452 gbpat130.seq
66832984 gbpat131.seq
249992315 gbpat132.seq
249999867 gbpat133.seq
250000197 gbpat134.seq
249999821 gbpat135.seq
249998337 gbpat136.seq
18437114 gbpat137.seq
249999655 gbpat138.seq
249998828 gbpat139.seq
250000225 gbpat14.seq
249999803 gbpat140.seq
250000264 gbpat141.seq
159550039 gbpat142.seq
249998039 gbpat143.seq
250000068 gbpat144.seq
250000023 gbpat145.seq
86028783 gbpat146.seq
249999922 gbpat147.seq
249998037 gbpat148.seq
249999931 gbpat149.seq
249998083 gbpat15.seq
63543776 gbpat150.seq
249999473 gbpat151.seq
249998942 gbpat152.seq
249999889 gbpat153.seq
249998615 gbpat154.seq
249999177 gbpat155.seq
250000056 gbpat156.seq
222233558 gbpat157.seq
250000249 gbpat158.seq
249999893 gbpat159.seq
249999193 gbpat16.seq
249999893 gbpat160.seq
220539897 gbpat161.seq
249999753 gbpat162.seq
249999412 gbpat163.seq
249999708 gbpat164.seq
12386037 gbpat165.seq
249997136 gbpat166.seq
249998441 gbpat167.seq
250000105 gbpat168.seq
249997481 gbpat169.seq
65904774 gbpat17.seq
35349941 gbpat170.seq
249998550 gbpat171.seq
249999207 gbpat172.seq
249999813 gbpat173.seq
249999107 gbpat174.seq
250000129 gbpat175.seq
60940687 gbpat176.seq
249999894 gbpat177.seq
250000245 gbpat178.seq
249998983 gbpat179.seq
250000027 gbpat18.seq
140563884 gbpat180.seq
249999801 gbpat19.seq
249998573 gbpat2.seq
249999076 gbpat20.seq
249997674 gbpat21.seq
185825467 gbpat22.seq
249999474 gbpat23.seq
249939239 gbpat24.seq
250000128 gbpat25.seq
249999993 gbpat26.seq
71191909 gbpat27.seq
249988299 gbpat28.seq
249999952 gbpat29.seq
249999135 gbpat3.seq
249998601 gbpat30.seq
249999272 gbpat31.seq
249994457 gbpat32.seq
180203249 gbpat33.seq
249999898 gbpat34.seq
249999720 gbpat35.seq
249999956 gbpat36.seq
249999157 gbpat37.seq
130537101 gbpat38.seq
249996412 gbpat39.seq
249997195 gbpat4.seq
249994275 gbpat40.seq
249998998 gbpat41.seq
249999990 gbpat42.seq
249997347 gbpat43.seq
249843553 gbpat44.seq
249999190 gbpat45.seq
250000004 gbpat46.seq
171468358 gbpat47.seq
249999830 gbpat48.seq
249998527 gbpat49.seq
71727149 gbpat5.seq
249999531 gbpat50.seq
250000197 gbpat51.seq
222934467 gbpat52.seq
249999057 gbpat53.seq
249999815 gbpat54.seq
250000246 gbpat55.seq
164990304 gbpat56.seq
249884985 gbpat57.seq
249999231 gbpat58.seq
249998872 gbpat59.seq
249999527 gbpat6.seq
249998842 gbpat60.seq
134937218 gbpat61.seq
249998879 gbpat62.seq
249999978 gbpat63.seq
249999690 gbpat64.seq
249998210 gbpat65.seq
249999753 gbpat66.seq
249999505 gbpat67.seq
144886744 gbpat68.seq
250000113 gbpat69.seq
249999387 gbpat7.seq
249999899 gbpat70.seq
249998837 gbpat71.seq
244399444 gbpat72.seq
248969066 gbpat73.seq
244459261 gbpat74.seq
247875799 gbpat75.seq
249999901 gbpat76.seq
160624439 gbpat77.seq
250000121 gbpat78.seq
249999657 gbpat79.seq
249994298 gbpat8.seq
249999470 gbpat80.seq
249999644 gbpat81.seq
249998023 gbpat82.seq
249998684 gbpat83.seq
93332873 gbpat84.seq
249155856 gbpat85.seq
249999530 gbpat86.seq
249999198 gbpat87.seq
249999368 gbpat88.seq
249999290 gbpat89.seq
249999221 gbpat9.seq
249999957 gbpat90.seq
145297619 gbpat91.seq
249999807 gbpat92.seq
249998984 gbpat93.seq
249999939 gbpat94.seq
250000257 gbpat95.seq
196963512 gbpat96.seq
249999051 gbpat97.seq
249998995 gbpat98.seq
249999064 gbpat99.seq
192023833 gbphg1.seq
249998378 gbpln1.seq
249998252 gbpln10.seq
249992188 gbpln11.seq
249998791 gbpln12.seq
249839762 gbpln13.seq
214566828 gbpln14.seq
249998215 gbpln15.seq
249985349 gbpln16.seq
249996352 gbpln17.seq
249710406 gbpln18.seq
249991116 gbpln19.seq
249971155 gbpln2.seq
249606656 gbpln20.seq
249999321 gbpln21.seq
33784496 gbpln22.seq
249993045 gbpln23.seq
97681487 gbpln24.seq
249998414 gbpln25.seq
249997064 gbpln26.seq
247837359 gbpln27.seq
221260108 gbpln28.seq
181007284 gbpln29.seq
249943940 gbpln3.seq
249073855 gbpln30.seq
249999561 gbpln31.seq
249999783 gbpln32.seq
249999448 gbpln33.seq
249999579 gbpln34.seq
111258266 gbpln35.seq
250000051 gbpln36.seq
249997989 gbpln37.seq
249999202 gbpln38.seq
249997953 gbpln39.seq
249921383 gbpln4.seq
142776015 gbpln40.seq
249872320 gbpln41.seq
249867875 gbpln42.seq
249999762 gbpln43.seq
249999374 gbpln44.seq
249999098 gbpln45.seq
192364741 gbpln46.seq
249999101 gbpln47.seq
249999190 gbpln48.seq
249999711 gbpln49.seq
249951839 gbpln5.seq
249999774 gbpln50.seq
211294463 gbpln51.seq
249992097 gbpln52.seq
249999888 gbpln53.seq
249998948 gbpln54.seq
249999242 gbpln55.seq
249991527 gbpln56.seq
88517405 gbpln57.seq
249863036 gbpln6.seq
249999449 gbpln7.seq
249998269 gbpln8.seq
52769111 gbpln9.seq
148952883 gbpri1.seq
249995439 gbpri10.seq
130148157 gbpri11.seq
249962747 gbpri12.seq
249896480 gbpri13.seq
249896770 gbpri14.seq
249947119 gbpri15.seq
249902483 gbpri16.seq
249876241 gbpri17.seq
249991978 gbpri18.seq
249903031 gbpri19.seq
249826385 gbpri2.seq
249948227 gbpri20.seq
249999807 gbpri21.seq
249999534 gbpri22.seq
39023869 gbpri23.seq
177481322 gbpri24.seq
249998934 gbpri25.seq
211358086 gbpri26.seq
249987118 gbpri27.seq
249988725 gbpri28.seq
249948820 gbpri29.seq
249848091 gbpri3.seq
249935405 gbpri30.seq
249945956 gbpri31.seq
249978441 gbpri32.seq
249821502 gbpri33.seq
249997105 gbpri34.seq
95885141 gbpri35.seq
249993971 gbpri36.seq
249999413 gbpri37.seq
249925671 gbpri38.seq
249993015 gbpri39.seq
249800914 gbpri4.seq
249998242 gbpri40.seq
182911266 gbpri41.seq
249995638 gbpri42.seq
249993419 gbpri43.seq
249998475 gbpri44.seq
28057567 gbpri45.seq
249741329 gbpri5.seq
249854494 gbpri6.seq
249967390 gbpri7.seq
249797768 gbpri8.seq
249977029 gbpri9.seq
330986 gbrel.txt
249911775 gbrod1.seq
249959654 gbrod10.seq
62793496 gbrod11.seq
249871284 gbrod12.seq
249783783 gbrod13.seq
249992872 gbrod14.seq
249651633 gbrod15.seq
249953778 gbrod16.seq
249885197 gbrod17.seq
249824125 gbrod18.seq
244529626 gbrod19.seq
249934846 gbrod2.seq
249768074 gbrod20.seq
249924095 gbrod21.seq
230194968 gbrod22.seq
249999329 gbrod23.seq
249998217 gbrod24.seq
249961043 gbrod25.seq
249948002 gbrod26.seq
250000050 gbrod27.seq
249998171 gbrod28.seq
215222423 gbrod29.seq
249793562 gbrod3.seq
249905352 gbrod4.seq
249860023 gbrod5.seq
249987740 gbrod6.seq
249952469 gbrod7.seq
249821325 gbrod8.seq
249934220 gbrod9.seq
4302518243 gbsdr1.txt
5866224920 gbsdr2.txt
2720814184 gbsdr3.txt
159729197 gbsec.idx
250000193 gbsts1.seq
249997720 gbsts10.seq
210919464 gbsts11.seq
249996524 gbsts12.seq
249998383 gbsts13.seq
249999027 gbsts14.seq
249999569 gbsts15.seq
24453604 gbsts16.seq
249999107 gbsts17.seq
249999933 gbsts18.seq
249998484 gbsts19.seq
249998716 gbsts2.seq
148720073 gbsts20.seq
249999648 gbsts3.seq
249999221 gbsts4.seq
39162150 gbsts5.seq
249997411 gbsts6.seq
249997774 gbsts7.seq
249997192 gbsts8.seq
249999074 gbsts9.seq
249996919 gbsyn1.seq
249998676 gbsyn2.seq
249984839 gbsyn3.seq
249988648 gbsyn4.seq
249976649 gbsyn5.seq
249964341 gbsyn6.seq
138439152 gbsyn7.seq
249999888 gbtsa1.seq
249997515 gbtsa10.seq
249999922 gbtsa11.seq
249997490 gbtsa12.seq
39984221 gbtsa13.seq
249997835 gbtsa14.seq
249999221 gbtsa15.seq
249998017 gbtsa16.seq
249997884 gbtsa17.seq
167500778 gbtsa18.seq
249998217 gbtsa19.seq
249997963 gbtsa2.seq
250000150 gbtsa20.seq
249998775 gbtsa21.seq
249998636 gbtsa22.seq
249998457 gbtsa23.seq
249998483 gbtsa24.seq
30034786 gbtsa25.seq
249998710 gbtsa26.seq
249998636 gbtsa27.seq
249991951 gbtsa28.seq
249997752 gbtsa29.seq
249998332 gbtsa3.seq
249998363 gbtsa30.seq
249999333 gbtsa31.seq
247719174 gbtsa32.seq
249998423 gbtsa33.seq
249998727 gbtsa34.seq
250000232 gbtsa35.seq
249999354 gbtsa36.seq
56599156 gbtsa37.seq
249998575 gbtsa38.seq
249997559 gbtsa39.seq
250000057 gbtsa4.seq
249998639 gbtsa40.seq
249999946 gbtsa41.seq
68324433 gbtsa42.seq
249998020 gbtsa43.seq
249997337 gbtsa44.seq
249998879 gbtsa45.seq
249999784 gbtsa46.seq
249999196 gbtsa47.seq
249999771 gbtsa48.seq
249998897 gbtsa49.seq
83183501 gbtsa5.seq
156843520 gbtsa50.seq
249997344 gbtsa51.seq
249997941 gbtsa52.seq
249996156 gbtsa53.seq
249999832 gbtsa54.seq
249999123 gbtsa55.seq
249998027 gbtsa56.seq
182093741 gbtsa57.seq
249998357 gbtsa58.seq
249999635 gbtsa59.seq
249999109 gbtsa6.seq
249998417 gbtsa60.seq
249999041 gbtsa61.seq
249998132 gbtsa62.seq
249998657 gbtsa63.seq
28554900 gbtsa64.seq
249991369 gbtsa65.seq
249999885 gbtsa66.seq
249996980 gbtsa67.seq
249998351 gbtsa68.seq
249999876 gbtsa69.seq
249999908 gbtsa7.seq
149602824 gbtsa70.seq
249999711 gbtsa71.seq
249998412 gbtsa72.seq
249999619 gbtsa73.seq
250000023 gbtsa74.seq
249998667 gbtsa75.seq
249998227 gbtsa76.seq
249996710 gbtsa77.seq
53047104 gbtsa78.seq
249998567 gbtsa79.seq
249998215 gbtsa8.seq
249998239 gbtsa80.seq
249998574 gbtsa81.seq
249990348 gbtsa82.seq
249993314 gbtsa83.seq
249999289 gbtsa84.seq
249998485 gbtsa85.seq
162227299 gbtsa86.seq
249998758 gbtsa9.seq
486393 gbuna1.seq
249997987 gbvrl1.seq
249999349 gbvrl10.seq
194910543 gbvrl11.seq
249999997 gbvrl12.seq
249986348 gbvrl13.seq
249998134 gbvrl14.seq
250000000 gbvrl15.seq
249997685 gbvrl16.seq
249998140 gbvrl17.seq
249998491 gbvrl18.seq
249997828 gbvrl19.seq
249999495 gbvrl2.seq
249999989 gbvrl20.seq
4317778 gbvrl21.seq
249999737 gbvrl3.seq
250000011 gbvrl4.seq
194181785 gbvrl5.seq
249996753 gbvrl6.seq
249996561 gbvrl7.seq
249986929 gbvrl8.seq
249999699 gbvrl9.seq
249917291 gbvrt1.seq
249855514 gbvrt10.seq
249996015 gbvrt11.seq
185114157 gbvrt12.seq
249994619 gbvrt13.seq
249897444 gbvrt14.seq
249972959 gbvrt15.seq
249998113 gbvrt16.seq
249999249 gbvrt17.seq
249999767 gbvrt18.seq
98711589 gbvrt19.seq
249889656 gbvrt2.seq
249923064 gbvrt20.seq
249999995 gbvrt21.seq
249998130 gbvrt22.seq
249998559 gbvrt23.seq
249999049 gbvrt24.seq
249999595 gbvrt25.seq
157120154 gbvrt26.seq
249836913 gbvrt3.seq
249987335 gbvrt4.seq
104132849 gbvrt5.seq
249999974 gbvrt6.seq
249998316 gbvrt7.seq
249826314 gbvrt8.seq
249952345 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 64114 86193075
BCT10 66 116730258
BCT11 78 117322765
BCT12 112 109949651
BCT13 1802 116295933
BCT14 14334 18583499
BCT15 53933 85390803
BCT16 93 110189094
BCT17 151 93915681
BCT18 61 112455059
BCT19 52 112042350
BCT2 5844 110241480
BCT20 46 114233015
BCT21 58 114931588
BCT22 67 111284815
BCT23 36 96325907
BCT24 40 106881287
BCT25 58 105533856
BCT26 74 111675186
BCT27 55 110045255
BCT28 63 106845575
BCT29 55 109391288
BCT3 52 112655257
BCT30 53 108650404
BCT31 46 110496749
BCT32 95 109522868
BCT33 59 110966729
BCT34 67 108616570
BCT35 124 106350090
BCT36 37 71643089
BCT37 200 108779787
BCT38 53 109969009
BCT39 40 106880984
BCT4 55 106656794
BCT40 55 103457820
BCT41 56 107056790
BCT42 45 111019867
BCT43 76 108801182
BCT44 58 100715765
BCT45 45 107106306
BCT46 59 109333038
BCT47 79 105369104
BCT48 76 103598262
BCT49 68 110616305
BCT5 38315 81650227
BCT50 66 105738712
BCT51 49 103628191
BCT52 53 107838942
BCT53 54 106293899
BCT54 66 108084602
BCT55 61 103087702
BCT56 51 108151942
BCT57 61 114343592
BCT58 71 111004332
BCT59 48 107623817
BCT6 39042 82648391
BCT60 56 110929046
BCT61 20 19969670
BCT62 40 109856401
BCT63 47 105944778
BCT64 55 110357422
BCT65 91 116463611
BCT66 255 105732175
BCT67 68 95118811
BCT68 322 10801608
BCT69 1589 2511877
BCT7 5518 94828825
BCT70 3179 5215895
BCT71 6347 7901828
BCT72 12648 15076979
BCT73 25628 27748204
BCT74 50523 53996220
BCT75 76345 77606795
BCT76 71405 77195984
BCT77 9653 94123533
BCT78 5443 100112703
BCT79 3197 106879231
BCT8 13774 81523996
BCT80 38 115045720
BCT81 3642 110685095
BCT82 14192 102295841
BCT83 30726 31670589
BCT84 68105 85901130
BCT85 27758 113032352
BCT86 75707 79592332
BCT87 77653 78827862
BCT88 43542 81776990
BCT9 6838 96099033
ENV1 94209 70702270
ENV10 83195 87252660
ENV11 20320 17518085
ENV12 84801 80865034
ENV13 118504 43056908
ENV14 89227 77395082
ENV15 96663 67703136
ENV16 96156 63560162
ENV17 111184 66842182
ENV18 115069 68957043
ENV19 53962 72858713
ENV2 94069 68483796
ENV20 68112 87693801
ENV21 91163 74648125
ENV22 128356 34420441
ENV23 123053 29094893
ENV24 77656 17801062
ENV25 123132 49865050
ENV26 97605 67840019
ENV27 115945 56100511
ENV28 136465 52686037
ENV29 109249 60107096
ENV3 85165 75436187
ENV30 60525 48214777
ENV31 62662 85165812
ENV32 89209 73395874
ENV33 102691 43976284
ENV34 96650 56534302
ENV35 70365 54231480
ENV36 111388 47227933
ENV37 101486 61277514
ENV38 106752 64912875
ENV39 66712 95282652
ENV4 81864 84122833
ENV40 73153 79242576
ENV41 62151 84438940
ENV42 5435 7412790
ENV43 71933 79250177
ENV44 108769 49167325
ENV45 112621 56520145
ENV46 104898 61079365
ENV47 68469 36406718
ENV48 98187 43572528
ENV49 42798 53974179
ENV5 87650 86753058
ENV50 42418 55303755
ENV51 62642 61277980
ENV52 103065 56624961
ENV53 94025 65891777
ENV54 65314 52873760
ENV6 99634 61412984
ENV7 131778 31252636
ENV8 86335 70532265
ENV9 93290 72986600
EST1 158932 61578479
EST10 167385 72122173
EST100 231672 140729199
EST101 237802 124852980
EST102 190153 104236045
EST103 184364 101949285
EST104 103193 71889182
EST105 160250 119698853
EST106 172461 105611774
EST107 134884 84746080
EST108 64402 24023712
EST109 63778 22434516
EST11 169595 74018695
EST110 64289 23267056
EST111 64327 27091249
EST112 64826 23100986
EST113 65039 24799093
EST114 63923 27171966
EST115 64304 26439085
EST116 64500 27438643
EST117 64329 25253991
EST118 61682 34942263
EST119 143437 69148920
EST12 166775 70072602
EST120 161509 85063702
EST121 176540 92939816
EST122 149364 96410313
EST123 156225 91806775
EST124 119906 77962123
EST125 189523 90832703
EST126 156066 83062378
EST127 157480 84565404
EST128 156726 84712436
EST129 151478 84989036
EST13 72695 34848854
EST130 173227 92958979
EST131 183360 116973508
EST132 202376 102377290
EST133 159209 87116376
EST134 163003 82938655
EST135 142196 83557290
EST136 144878 89609395
EST137 100352 53529682
EST138 173647 98087376
EST139 245097 113024634
EST14 217838 109343769
EST140 154548 83565381
EST141 167377 92340739
EST142 150567 87983179
EST143 133775 81923085
EST144 154345 96631498
EST145 155780 85598830
EST146 124531 63457173
EST147 121487 65234224
EST148 128019 58013691
EST149 127405 51301558
EST15 168614 105338224
EST150 128750 51314157
EST151 114666 42736056
EST152 163859 82705515
EST153 176185 73807844
EST154 162278 110244175
EST155 200052 122694559
EST156 214239 121752085
EST157 175489 97173867
EST158 154918 108270122
EST159 141852 95175407
EST16 179370 112570464
EST160 154920 96168731
EST161 157632 82605461
EST162 139434 78479271
EST163 167640 93240843
EST164 71435 44426123
EST165 150023 91732089
EST166 191930 110294142
EST167 145734 83903123
EST168 142819 72406653
EST169 149190 87157119
EST17 195485 113421912
EST170 190838 104730335
EST171 156489 95960355
EST172 168507 82508469
EST173 125375 86492621
EST174 170320 99808753
EST175 173349 100632824
EST176 122206 68017354
EST177 157123 90422184
EST178 36040 20910101
EST179 169722 102544886
EST18 190794 121227407
EST180 180480 119007477
EST181 143363 116883808
EST182 196475 100128945
EST183 153063 103417675
EST184 154770 101388996
EST185 141086 81668866
EST186 176203 71381525
EST187 150729 84605822
EST188 157671 99760566
EST189 156081 96182828
EST19 159133 113948375
EST190 139875 83288450
EST191 162380 98123694
EST192 145501 93165509
EST193 129282 90355751
EST194 144178 88129306
EST195 135902 88513039
EST196 129815 92790323
EST197 162840 86849689
EST198 173964 95596657
EST199 173376 96542520
EST2 161860 61550624
EST20 187213 99420130
EST200 171670 95198341
EST201 168820 95407068
EST202 171408 95551825
EST203 173224 95039735
EST204 173942 95722555
EST205 26071 14145658
EST206 188683 105128382
EST207 204869 104647675
EST208 172472 102202197
EST209 180258 101789390
EST21 217083 106514506
EST210 201364 122897276
EST211 194452 112215324
EST212 193236 123998414
EST213 157826 103853508
EST214 218606 142124470
EST215 236981 114289890
EST216 144090 102761491
EST217 162417 109453594
EST218 147468 94888165
EST219 177970 98756745
EST22 198534 65752423
EST220 189640 118163131
EST221 111502 87690743
EST222 134620 120952490
EST223 160288 93323935
EST224 148164 95283375
EST225 195419 107606906
EST226 165956 104004627
EST227 134256 92504650
EST228 142246 105338552
EST229 121037 87171351
EST23 140862 40065399
EST230 89017 60065173
EST231 144707 89923186
EST232 132134 93896873
EST233 142356 101341738
EST234 120291 86685390
EST235 125401 84269360
EST236 155662 108152561
EST237 159222 115371006
EST238 119672 122010725
EST239 147837 88887768
EST24 103787 28102244
EST240 184282 119267577
EST241 151658 92214097
EST242 170294 107705840
EST243 168047 121457538
EST244 144918 107959708
EST245 12728 9508739
EST246 155314 99988755
EST247 211317 97462628
EST248 187801 111520345
EST249 152131 86844599
EST25 120996 50723240
EST250 220345 27616336
EST251 221254 90066703
EST252 163455 120913817
EST253 174720 102321431
EST254 161936 107622791
EST255 175914 115399930
EST256 156223 114468607
EST257 99561 53974488
EST258 185661 97474439
EST259 177456 104472997
EST26 213501 97054723
EST260 166024 119620495
EST261 213639 103014724
EST262 271912 119057190
EST263 210005 121285910
EST264 182168 40387609
EST265 244614 112858925
EST266 168698 97405400
EST267 168071 105513129
EST268 91751 57335915
EST269 165597 113974547
EST27 218819 110001727
EST270 198817 103241138
EST271 155639 106041898
EST272 195434 114967787
EST273 197349 49934451
EST274 208508 42438416
EST275 181445 103178886
EST276 170072 114930491
EST277 185647 115672988
EST278 181693 109072871
EST279 156874 101653801
EST28 190237 88555560
EST280 107765 37295820
EST281 143441 86877283
EST282 119146 79285022
EST283 155963 106087924
EST284 247054 37101314
EST285 263884 24184983
EST286 168438 90780287
EST287 167471 109887997
EST288 161036 104213327
EST289 147170 91851247
EST29 158143 68957152
EST290 263805 37938913
EST291 175249 96902493
EST292 65786 49567265
EST293 194338 110878705
EST294 143325 78882928
EST295 183213 119106362
EST296 183143 112477875
EST297 153695 111899727
EST298 192149 107445583
EST299 177857 99889722
EST3 153644 54437600
EST30 171754 69719151
EST300 174789 110135664
EST301 188994 63439538
EST302 187078 69018136
EST303 187611 72816531
EST304 125121 45341071
EST305 191234 89843416
EST306 181274 127349813
EST307 158971 92980965
EST308 155331 90434581
EST309 127300 99043905
EST31 148807 63221819
EST310 148700 98828832
EST311 165551 100442817
EST312 164669 92445820
EST313 171497 102947767
EST314 150255 99194578
EST315 150183 101501700
EST316 164808 107893360
EST317 149798 103710289
EST318 180081 152154447
EST319 173049 113522912
EST32 168259 76028450
EST320 141881 76116072
EST321 143244 97615879
EST322 144928 99505570
EST323 132589 89348860
EST324 149632 99766976
EST325 150467 102013561
EST326 177881 111147474
EST327 151506 83739788
EST328 150733 86370440
EST329 151983 107660093
EST33 173679 66404329
EST330 156358 97012678
EST331 75668 45944543
EST332 142969 90533688
EST333 142925 89593086
EST334 209441 112523399
EST335 130101 71843744
EST336 92275 55613264
EST337 131682 87116725
EST338 137932 87526178
EST339 124352 79176420
EST34 123502 43663231
EST340 167207 85573407
EST341 212893 84728803
EST342 167017 88160971
EST343 175024 104695592
EST344 161775 96760321
EST345 83671 55846234
EST346 132870 88571128
EST347 136240 89108559
EST348 189873 121547105
EST349 157125 96320507
EST35 97393 29901036
EST350 162118 81354200
EST351 185548 130535600
EST352 110503 75364645
EST353 73462 43657604
EST354 141770 78734463
EST355 130261 77842955
EST356 149892 54279694
EST357 158516 32679823
EST358 158543 32605027
EST359 183886 112070036
EST36 97798 30578433
EST360 8500 6041888
EST361 229380 116863832
EST362 250947 114659736
EST363 197345 103804155
EST364 146744 94472560
EST365 136179 87025130
EST366 147035 87148639
EST367 184173 114009612
EST368 226121 77370370
EST369 186906 101062433
EST37 96708 29347011
EST370 214642 119446089
EST371 155822 86751447
EST372 141135 66880597
EST373 206911 123161947
EST374 146910 93253171
EST375 183485 135800456
EST376 182030 141629606
EST377 160276 100718410
EST378 163851 102390479
EST379 185405 109289935
EST38 98627 29829233
EST380 185059 107455490
EST381 194895 99930044
EST382 187317 114751014
EST383 142725 86103298
EST384 184880 123581471
EST385 203343 139268066
EST386 225508 131106947
EST387 201174 146848815
EST388 212679 165540464
EST389 188252 105691438
EST39 99409 31246345
EST390 195715 112758679
EST391 170743 30917508
EST392 162772 13359065
EST393 156380 21558560
EST394 158386 32980893
EST395 18740 3500796
EST396 158904 31737671
EST397 152491 69878624
EST398 167721 96756186
EST399 173835 118170573
EST4 170812 67108330
EST40 23364 5953454
EST400 167875 98880040
EST401 154848 107464448
EST402 141525 98186920
EST403 146655 102317880
EST404 155819 96456301
EST405 162113 119653940
EST406 164349 99526813
EST407 170202 58713568
EST408 155434 25947225
EST409 160737 106997829
EST41 101025 52987591
EST410 151968 101622599
EST411 179648 118059462
EST412 140089 75802216
EST413 196139 110574622
EST414 157589 117559538
EST415 134137 91654861
EST416 139580 92155723
EST417 147539 92153974
EST418 176489 96701048
EST419 178650 97554302
EST42 119533 50861384
EST420 145879 90440251
EST421 166107 102395210
EST422 161695 96165303
EST423 110350 76140704
EST424 85714 65440406
EST425 100246 67540584
EST426 137972 80425047
EST427 135046 80015127
EST428 133629 82455414
EST429 136630 89185613
EST43 165833 91749823
EST430 141642 86634644
EST431 175692 94665993
EST432 188469 108748454
EST433 128540 84031031
EST434 187990 107765121
EST435 174626 80178983
EST436 32224 17445013
EST437 157757 90445431
EST438 154604 85271660
EST439 216718 126447328
EST44 170265 72258613
EST440 179417 109867210
EST441 174694 106068070
EST442 140389 102089109
EST443 140710 91510254
EST444 152032 77522515
EST445 195701 87010048
EST446 201299 82951681
EST447 206755 85592816
EST448 158996 71006701
EST449 180264 112731054
EST45 167207 84835444
EST450 185135 91423893
EST451 186900 86409916
EST452 200387 105588449
EST453 197581 118495404
EST454 172104 103634127
EST455 200992 125290848
EST456 150680 95469131
EST457 156612 107620351
EST458 193887 99448759
EST459 146054 81393988
EST46 168558 86873194
EST460 81089 47519014
EST461 169132 87778349
EST462 165307 61809794
EST463 168026 61371207
EST464 77761 29659392
EST47 163262 87825019
EST48 162141 83268160
EST49 160106 91089164
EST5 168996 66194437
EST50 161687 88150757
EST51 157075 98885218
EST52 159523 69798362
EST53 145892 81655293
EST54 77893 50484869
EST55 167014 69863326
EST56 164685 74782249
EST57 164346 90732446
EST58 159178 97166701
EST59 156490 101521697
EST6 171504 66930687
EST60 164652 98962423
EST61 160066 108020892
EST62 171124 81366441
EST63 173194 92475995
EST64 155553 84217629
EST65 148982 81884638
EST66 158925 98551453
EST67 135790 77000242
EST68 149407 91679785
EST69 195065 108209511
EST7 169838 72796689
EST70 180928 95035856
EST71 221024 121170482
EST72 185551 110633950
EST73 203997 121403744
EST74 163466 90073924
EST75 133803 61352208
EST76 139606 68714064
EST77 154928 94123793
EST78 157774 100292851
EST79 141999 78491384
EST8 179388 72856367
EST80 52437 24417770
EST81 164129 100478047
EST82 212013 114844649
EST83 223643 123677791
EST84 200580 94359351
EST85 211218 93334305
EST86 162062 92859374
EST87 144093 86857971
EST88 164220 81109529
EST89 158205 79848153
EST9 168560 69305002
EST90 152983 102103871
EST91 152015 88934493
EST92 134784 86959062
EST93 156082 113065452
EST94 142345 104168873
EST95 143183 102383840
EST96 141176 97543929
EST97 147010 80970712
EST98 178720 111290006
EST99 224300 135818237
GSS1 200062 87617305
GSS10 132040 60283336
GSS100 145362 114337340
GSS101 141643 116113759
GSS102 143263 116656493
GSS103 167238 128921102
GSS104 149783 82569304
GSS105 191527 120854119
GSS106 167747 112125081
GSS107 197328 115524481
GSS108 204975 134770173
GSS109 209812 138225285
GSS11 137026 73963213
GSS110 207577 140849031
GSS111 206236 142443188
GSS112 205251 143737895
GSS113 205176 143937947
GSS114 202120 146641028
GSS115 182321 139890075
GSS116 18414 10874742
GSS117 132848 84052151
GSS118 169611 80019194
GSS119 184271 79450634
GSS12 147892 75892246
GSS120 170296 148327490
GSS121 177223 120247442
GSS122 184849 149514379
GSS123 192486 124724450
GSS124 187593 137833036
GSS125 192178 126797998
GSS126 190607 95460230
GSS127 166251 152986683
GSS128 164115 115658040
GSS129 66249 42508121
GSS13 145394 68606713
GSS130 171037 155489454
GSS131 172571 154290391
GSS132 172231 155358474
GSS133 173848 154157454
GSS134 172390 153324435
GSS135 180501 140512813
GSS136 180034 143808295
GSS137 162562 117574424
GSS138 199819 91097855
GSS139 265735 40959994
GSS14 169809 84775223
GSS140 265734 40943584
GSS141 71174 10930356
GSS142 256185 58367796
GSS143 253136 60903252
GSS144 193384 82083564
GSS145 196875 71369208
GSS146 186224 149437899
GSS147 181602 151282470
GSS148 168164 155319870
GSS149 171139 157877394
GSS15 161099 97662972
GSS150 239513 66755578
GSS151 224276 84847535
GSS152 139502 50811447
GSS153 45810 10485531
GSS154 87112 63991594
GSS155 83556 62806181
GSS156 103676 48621434
GSS157 68586 58475658
GSS158 7686 7033775
GSS159 68591 57924394
GSS16 172836 87033449
GSS160 69224 56650935
GSS161 69460 56187403
GSS162 71202 55998401
GSS163 68561 51865315
GSS164 75915 58209304
GSS165 87237 74898207
GSS166 81830 44609896
GSS167 92262 44834024
GSS168 63624 47799159
GSS169 77435 61351403
GSS17 183522 113500748
GSS170 69655 58699293
GSS171 67711 62706526
GSS172 61946 53348157
GSS173 95612 42935517
GSS174 21104 4920928
GSS175 112937 70876701
GSS176 823 560132
GSS177 23226 28867035
GSS178 109043 70652585
GSS179 84533 34668223
GSS18 192358 114306485
GSS180 35815 22222733
GSS181 103304 62490220
GSS182 102329 63761256
GSS183 104268 67656826
GSS184 82099 41276456
GSS185 83102 54651503
GSS186 95673 61335435
GSS187 107323 78547443
GSS188 106375 76684757
GSS189 106058 79947480
GSS19 114078 52104778
GSS190 103996 80016519
GSS191 76374 51039123
GSS192 104572 63292187
GSS193 109868 66415305
GSS194 106205 59313311
GSS195 68379 37446344
GSS196 69573 38736929
GSS197 37145 17774305
GSS198 85481 46023427
GSS199 97119 55907586
GSS2 182294 92190593
GSS20 181789 101771260
GSS200 94982 49597190
GSS201 96286 55922591
GSS202 42132 23615490
GSS203 114638 43642267
GSS204 117085 39368203
GSS205 108676 55514545
GSS206 101471 78372335
GSS207 71604 45899517
GSS208 95891 36542252
GSS209 95417 37268709
GSS21 166208 114173594
GSS210 96671 35161518
GSS211 94285 39167432
GSS212 37736 17626556
GSS213 103939 66277823
GSS214 94551 61190929
GSS215 95128 60357048
GSS216 94773 60868501
GSS217 75675 70017159
GSS218 76712 71926232
GSS219 10069 14841525
GSS22 169506 97609042
GSS220 83736 28233267
GSS221 84219 27346468
GSS222 84926 25909272
GSS223 14851 4422302
GSS224 16547 7508221
GSS225 92377 59458826
GSS226 84657 52502700
GSS227 94076 50770605
GSS228 88581 48350254
GSS229 10980 5983348
GSS23 187251 126687349
GSS230 90648 56882510
GSS231 89662 61882079
GSS232 88553 63641206
GSS233 89283 62505584
GSS234 9890 7129098
GSS235 87995 63795538
GSS236 90217 62488977
GSS237 94643 59915214
GSS238 74331 63055090
GSS239 84246 78879440
GSS24 194057 130219707
GSS240 83027 80589521
GSS241 70483 52650376
GSS242 117650 64297121
GSS243 108874 55446727
GSS244 107533 52125503
GSS245 96658 43251344
GSS246 109801 49060015
GSS247 98194 46325477
GSS248 73059 72225597
GSS249 76682 71142435
GSS25 177481 105207105
GSS250 72980 46435649
GSS251 94787 57200301
GSS252 93517 59081345
GSS253 93900 58510429
GSS254 94714 57307691
GSS255 94197 58070562
GSS256 12741 6343956
GSS26 185918 107808246
GSS27 170600 151419573
GSS28 190494 146229226
GSS29 151147 106441309
GSS3 174946 87827370
GSS30 192451 132131298
GSS31 13629 8773195
GSS32 196044 127318947
GSS33 216659 116231837
GSS34 218573 113602417
GSS35 219720 112025390
GSS36 213958 121897898
GSS37 198560 156434224
GSS38 194984 146797396
GSS39 197244 73372753
GSS4 167155 85101061
GSS40 185054 97670908
GSS41 189776 125953978
GSS42 170974 159160741
GSS43 8445 5513515
GSS44 183999 100320381
GSS45 172882 121572550
GSS46 185086 124654027
GSS47 190845 122391958
GSS48 70876 62667060
GSS49 171799 101963548
GSS5 53445 31617730
GSS50 167647 103037030
GSS51 167798 102616122
GSS52 184194 121477291
GSS53 184741 116610251
GSS54 181685 122486352
GSS55 187532 113988808
GSS56 189404 134542890
GSS57 178931 104920751
GSS58 195718 120562198
GSS59 179928 133341146
GSS6 161617 84471320
GSS60 1929 1744988
GSS61 172844 138948397
GSS62 161635 111553347
GSS63 161673 111572480
GSS64 158827 107592995
GSS65 156768 129062324
GSS66 170185 142553826
GSS67 179844 117096102
GSS68 204911 127968663
GSS69 193332 110756601
GSS7 165322 79361222
GSS70 243921 125965583
GSS71 160206 106329772
GSS72 159349 119781671
GSS73 162663 124539163
GSS74 162629 124600831
GSS75 175106 108958250
GSS76 190310 140120691
GSS77 13118 7645896
GSS78 199135 126616367
GSS79 170370 111603100
GSS8 165782 88979718
GSS80 200718 131518447
GSS81 211575 85835271
GSS82 187842 98659368
GSS83 131802 92017231
GSS84 146986 118083551
GSS85 139587 116995322
GSS86 142817 114062378
GSS87 144008 119847686
GSS88 141842 115691442
GSS89 106718 88926972
GSS9 137999 67157765
GSS90 149425 122240891
GSS91 147663 117692857
GSS92 143995 113064403
GSS93 142869 115422868
GSS94 144203 119656289
GSS95 148069 121684067
GSS96 147696 117745472
GSS97 146077 121054040
GSS98 146145 120923099
GSS99 146569 120073651
HTC1 25057 27045808
HTC10 55760 70772571
HTC11 80466 70929569
HTC12 7043 8192975
HTC13 66993 60073171
HTC14 68555 69498879
HTC15 24287 16415337
HTC2 16086 36243320
HTC3 16029 36627693
HTC4 16251 35560357
HTC5 15980 40344457
HTC6 16068 37474845
HTC7 53834 31477922
HTC8 31137 19451907
HTC9 60867 78012683
HTG1 1318 188771164
HTG10 1298 186340737
HTG100 990 189440077
HTG101 996 189331054
HTG102 985 189419172
HTG103 1161 190585510
HTG104 30 4314892
HTG105 1087 189830459
HTG106 1045 189717260
HTG107 1388 191466792
HTG108 1295 190933340
HTG109 1637 191203456
HTG11 6 837687
HTG110 1342 192059426
HTG111 1298 191975983
HTG112 1320 189984665
HTG113 1061 186071359
HTG114 761 123096347
HTG115 1507 182635389
HTG116 1007 191730955
HTG117 1024 187703174
HTG118 1067 193712434
HTG119 1102 193135451
HTG12 1452 184004673
HTG120 133 25376388
HTG121 1029 189520679
HTG122 1054 192676832
HTG123 1164 192121620
HTG124 1083 192945775
HTG125 1083 192937725
HTG126 590 104030016
HTG127 1122 192568597
HTG128 1080 192404608
HTG129 1078 192326016
HTG13 875 191786413
HTG130 1167 192001881
HTG131 1580 191735452
HTG132 1072 192290481
HTG133 1071 192281753
HTG134 1127 191850871
HTG135 1425 188077382
HTG136 445 59222914
HTG14 753 191921309
HTG15 745 191963148
HTG16 785 191933231
HTG17 796 191351096
HTG18 775 192103394
HTG19 2069 170638342
HTG2 2470 186037380
HTG20 1096 187413748
HTG21 887 180042173
HTG22 785 191651644
HTG23 928 190141652
HTG24 907 190491600
HTG25 811 191323929
HTG26 784 191771279
HTG27 874 191079273
HTG28 896 190515178
HTG29 939 189959636
HTG3 2513 185208586
HTG30 911 190941779
HTG31 841 171449145
HTG32 875 191097680
HTG33 968 189501635
HTG34 884 191025385
HTG35 868 191276405
HTG36 825 191702609
HTG37 949 189868158
HTG38 949 190351720
HTG39 940 190045229
HTG4 2550 188439001
HTG40 1049 189067591
HTG41 1089 167537350
HTG42 1256 188119418
HTG43 1169 188010117
HTG44 1150 188080035
HTG45 1117 191232412
HTG46 1269 190634433
HTG47 1176 190820695
HTG48 1128 191224702
HTG49 1046 191244150
HTG5 1283 185453274
HTG50 1030 189621534
HTG51 1042 178756613
HTG52 968 190052338
HTG53 1105 190148899
HTG54 1046 190158403
HTG55 1014 189831932
HTG56 969 189170679
HTG57 81 14306584
HTG58 1010 189338312
HTG59 1029 189903667
HTG6 1273 185124562
HTG60 1078 187304761
HTG61 1125 188306505
HTG62 988 170992054
HTG63 1085 189487801
HTG64 1064 189415560
HTG65 1169 188798107
HTG66 1179 187545797
HTG67 1282 184397923
HTG68 94 12194080
HTG69 1221 185314622
HTG7 1276 185375030
HTG70 1239 184674446
HTG71 1244 184625496
HTG72 1183 187688486
HTG73 1019 170126516
HTG74 1118 188293510
HTG75 1103 190775743
HTG76 1135 190789237
HTG77 1182 190871034
HTG78 1096 185997580
HTG79 1171 190202119
HTG8 1459 184608562
HTG80 1115 190063261
HTG81 1213 189874691
HTG82 1120 189645029
HTG83 959 164682536
HTG84 1229 188409093
HTG85 1250 187741728
HTG86 1141 189879061
HTG87 1144 189686641
HTG88 978 167870813
HTG89 1182 189961005
HTG9 1200 186916809
HTG90 1104 190233697
HTG91 1146 190217975
HTG92 1109 190471215
HTG93 962 159420591
HTG94 1056 190754252
HTG95 1160 191014458
HTG96 1031 189156227
HTG97 1071 189497493
HTG98 684 127508859
HTG99 1018 189641315
INV1 93998 48445292
INV10 57199 86634079
INV11 83144 65260906
INV12 59641 47161951
INV13 84926 66266045
INV14 81215 66973881
INV15 78590 67305407
INV16 47188 44332633
INV17 33489 109757153
INV18 3223 146908081
INV19 46561 108090739
INV2 21311 155210684
INV20 77489 55916239
INV21 70668 60809996
INV22 20678 125708200
INV23 6 133712559
INV24 53976 99409443
INV25 78653 53750372
INV26 26569 19758919
INV27 79428 56780387
INV28 78464 61133461
INV29 71486 51098653
INV3 1611 160233861
INV30 63761 74575360
INV31 1758 21466827
INV4 3882 133970248
INV5 78843 73616199
INV6 55577 94593127
INV7 53072 88333125
INV8 7459 7953161
INV9 80575 71772037
MAM1 15929 161549746
MAM2 19803 157738669
MAM3 58989 82666319
MAM4 7988 184338917
MAM5 79484 74649786
MAM6 50895 122370246
MAM7 74249 63555831
MAM8 7258 7392083
PAT1 222552 70120341
PAT10 124454 102575462
PAT100 178185 3385515
PAT101 132610 2848492
PAT102 342935 8573375
PAT103 188806 88519660
PAT104 111348 132068608
PAT105 3850 194703659
PAT106 131292 110979300
PAT107 158599 54826034
PAT108 224730 34113420
PAT109 250080 15844360
PAT11 98621 64109728
PAT110 180680 63677151
PAT111 51648 26046194
PAT112 114177 110461898
PAT113 137697 83275032
PAT114 164174 99337407
PAT115 158860 103334939
PAT116 137435 114993907
PAT117 42311 27994848
PAT118 193712 81686401
PAT119 150217 108404022
PAT12 142059 62828666
PAT120 356051 11379688
PAT121 257211 57607099
PAT122 138161 48226925
PAT123 322021 22795469
PAT124 155639 102753887
PAT125 132727 110696284
PAT126 128341 121313309
PAT127 21664 184390005
PAT128 144888 112900567
PAT129 171997 96403773
PAT13 105891 59875090
PAT130 44618 171217879
PAT131 9167 47581637
PAT132 33645 178334734
PAT133 153558 109675196
PAT134 178705 90913377
PAT135 136049 115324159
PAT136 120392 123342367
PAT137 8527 8992390
PAT138 155429 101473147
PAT139 184764 88815933
PAT14 103642 50160219
PAT140 182409 85292093
PAT141 174396 93932900
PAT142 97226 64800823
PAT143 203662 47737230
PAT144 277828 9627968
PAT145 220409 46465135
PAT146 106719 2881142
PAT147 270386 21672571
PAT148 186749 61237793
PAT149 109798 106057839
PAT15 121149 53316510
PAT150 47521 9551424
PAT151 87298 88246391
PAT152 78460 95573571
PAT153 145159 77711416
PAT154 167498 71377475
PAT155 121473 92940947
PAT156 102998 85359486
PAT157 165586 46048712
PAT158 270022 5130418
PAT159 269978 5129582
PAT16 113134 61272877
PAT160 269978 5129582
PAT161 237888 4519872
PAT162 269396 5118524
PAT163 235480 25575098
PAT164 203730 47154285
PAT165 12037 422709
PAT166 165317 74871979
PAT167 91686 126656173
PAT168 172587 71662828
PAT169 137861 72258430
PAT17 39164 16237825
PAT170 9534 13984766
PAT171 93111 87244841
PAT172 91681 79829797
PAT173 83213 91467896
PAT174 109150 53717368
PAT175 121111 65214605
PAT176 61550 15891474
PAT177 86904 129984422
PAT178 159361 78756697
PAT179 211784 48300758
PAT18 146771 52594264
PAT180 93274 41134377
PAT19 153705 78039102
PAT2 194525 84650653
PAT20 104995 118172564
PAT21 133550 95503155
PAT22 84598 79322013
PAT23 123508 103387313
PAT24 119470 105674473
PAT25 145486 86670068
PAT26 175165 64299073
PAT27 71371 1784275
PAT28 102171 77387698
PAT29 93955 87644560
PAT3 171981 95897120
PAT30 119942 61673191
PAT31 96643 78968028
PAT32 128386 55024402
PAT33 92213 51124955
PAT34 111297 78150994
PAT35 138100 29119820
PAT36 158503 24081830
PAT37 114680 49019471
PAT38 44868 54579998
PAT39 95732 83191686
PAT4 153748 106056406
PAT40 100232 70984798
PAT41 136206 39303264
PAT42 143774 35446826
PAT43 123731 64736974
PAT44 104361 81207665
PAT45 93445 74211542
PAT46 113255 66591457
PAT47 65218 54831902
PAT48 135193 108001084
PAT49 167081 97032398
PAT5 57146 23927792
PAT50 116397 127555645
PAT51 196343 76722711
PAT52 80302 127991032
PAT53 27631 180872621
PAT54 185408 93066629
PAT55 274259 6856475
PAT56 129447 31627433
PAT57 161320 77719729
PAT58 92809 89400771
PAT59 106512 74783638
PAT6 170642 91909261
PAT60 122361 64031080
PAT61 67433 30299206
PAT62 70750 109767817
PAT63 87947 82758966
PAT64 92971 78937516
PAT65 93166 72441718
PAT66 93384 75085880
PAT67 115775 60531183
PAT68 102736 9941783
PAT69 175933 10547809
PAT7 154777 88234848
PAT70 171510 10872561
PAT71 171496 10866737
PAT72 99859 86225043
PAT73 99 196466297
PAT74 67 192869889
PAT75 103 195600591
PAT76 1137 196318757
PAT77 97599 5772236
PAT78 151009 9636510
PAT79 151022 9621259
PAT8 131210 96916575
PAT80 151024 9622125
PAT81 151021 9620837
PAT82 94633 88060720
PAT83 93689 93464843
PAT84 34072 33980702
PAT85 83459 93185861
PAT86 15570 180450165
PAT87 164895 19209843
PAT88 178944 3399936
PAT89 177434 3371246
PAT9 129381 101126002
PAT90 175305 3330795
PAT91 101394 1926486
PAT92 169172 12412265
PAT93 178699 3395281
PAT94 178691 3395129
PAT95 178677 3394863
PAT96 140779 2674801
PAT97 178683 3394977
PAT98 178342 3388498
PAT99 178198 3385762
PHG1 6539 78965392
PLN1 59906 93473814
PLN10 73064 75866951
PLN11 37368 49288557
PLN12 40288 65715135
PLN13 22486 123971328
PLN14 21103 99490647
PLN15 17578 144865462
PLN16 17634 146278605
PLN17 17564 146392665
PLN18 24636 128667828
PLN19 6000 149205408
PLN2 44614 110229020
PLN20 1266 170315035
PLN21 14024 156030132
PLN22 7239 8483649
PLN23 67251 69749254
PLN24 29377 31585173
PLN25 76943 76363980
PLN26 64877 80581708
PLN27 61609 100265946
PLN28 76 95744252
PLN29 3 61743175
PLN3 1365 175352616
PLN30 842 124721503
PLN31 22712 129429639
PLN32 19595 134200900
PLN33 77954 74719810
PLN34 97677 58565857
PLN35 32919 32369415
PLN36 80378 71656866
PLN37 77879 75901312
PLN38 80006 70498807
PLN39 82141 75442002
PLN4 1809 185391480
PLN40 57790 31632553
PLN41 98608 55062825
PLN42 82013 68932500
PLN43 45899 98599899
PLN44 26328 123492156
PLN45 25106 131583821
PLN46 60144 57753150
PLN47 81462 72224681
PLN48 63271 82408528
PLN49 36868 104584716
PLN5 1875 193948849
PLN50 85589 62349393
PLN51 80251 51093477
PLN52 77023 72630054
PLN53 71102 84462914
PLN54 77574 68708731
PLN55 72757 73907430
PLN56 67734 76920525
PLN57 15813 33605222
PLN6 1694 194455396
PLN7 8875 166727332
PLN8 74779 80929027
PLN9 15960 15706263
PRI1 23017 59647552
PRI10 1272 179395210
PRI11 778 94342363
PRI12 1278 179183454
PRI13 1451 177770436
PRI14 1589 180081042
PRI15 1591 181937113
PRI16 1285 191720215
PRI17 1137 193666240
PRI18 1099 194310776
PRI19 1166 193657185
PRI2 18429 149128717
PRI20 1737 191818169
PRI21 2647 189828619
PRI22 14648 168994264
PRI23 6232 19009058
PRI24 31573 84616058
PRI25 61951 78207697
PRI26 31350 70628098
PRI27 8521 161801360
PRI28 2251 180645625
PRI29 1618 181509288
PRI3 1432 175161011
PRI30 2007 181705860
PRI31 1958 180727178
PRI32 13185 156524900
PRI33 1327 183635528
PRI34 41711 106642910
PRI35 22923 33121498
PRI36 32189 63608729
PRI37 20152 117784920
PRI38 18563 147331908
PRI39 66684 86887518
PRI4 1281 185439398
PRI40 49544 89484261
PRI41 40139 74379736
PRI42 45900 95174528
PRI43 18093 108064568
PRI44 66076 89447241
PRI45 1457 18351424
PRI5 1325 184269325
PRI6 1180 179951778
PRI7 1245 180985147
PRI8 1213 178408437
PRI9 1367 174689932
ROD1 33082 139573048
ROD10 989 181517379
ROD11 239 45370799
ROD12 1034 185475616
ROD13 940 182703335
ROD14 1040 189324025
ROD15 950 180306408
ROD16 967 182057152
ROD17 991 185811349
ROD18 1189 190476978
ROD19 16761 153123318
ROD2 916 175520958
ROD20 20349 148361192
ROD21 1132 182075942
ROD22 1079 168189648
ROD23 12240 164895229
ROD24 39629 69426318
ROD25 22368 102346854
ROD26 1532 187749424
ROD27 131881 40081047
ROD28 85541 70219130
ROD29 59246 64317916
ROD3 905 173300070
ROD4 901 173844425
ROD5 921 174289711
ROD6 966 178150478
ROD7 970 179681769
ROD8 978 181216054
ROD9 993 181818518
STS1 85283 36763581
STS10 57907 44420267
STS11 48910 37503235
STS12 57924 43637361
STS13 64283 42850336
STS14 93614 34186498
STS15 104286 26517058
STS16 10109 2739230
STS17 103611 27476228
STS18 86931 34449254
STS19 99732 33367582
STS2 84354 49850025
STS20 54952 21017981
STS3 66846 26362760
STS4 76989 36945836
STS5 8457 4958885
STS6 54259 31650966
STS7 54162 31838227
STS8 54316 31957697
STS9 55716 37767321
SYN1 42753 77269197
SYN2 49419 68040737
SYN3 11320 159501663
SYN4 4599 176558238
SYN5 4596 176482727
SYN6 4600 176575736
SYN7 5894 92767949
TSA1 120472 38235688
TSA10 108480 37654586
TSA11 62538 30840256
TSA12 110433 44590798
TSA13 16282 7598904
TSA14 86486 70566494
TSA15 121991 38853496
TSA16 134870 35826510
TSA17 61036 79698424
TSA18 39468 53516874
TSA19 70282 97466599
TSA2 113532 41666458
TSA20 100897 57123531
TSA21 110668 52338593
TSA22 102984 53513191
TSA23 103695 52518403
TSA24 100966 47107597
TSA25 10786 6455891
TSA26 66573 59369298
TSA27 93236 68475106
TSA28 91230 65647744
TSA29 79450 85594729
TSA3 110396 41019325
TSA30 103819 45646892
TSA31 113332 35261472
TSA32 92833 70603170
TSA33 94924 35718056
TSA34 79432 36554147
TSA35 110249 45080197
TSA36 117427 47973607
TSA37 19696 15336790
TSA38 106388 50375672
TSA39 100992 55141702
TSA4 110949 45737681
TSA40 90151 68489264
TSA41 91678 73454415
TSA42 32519 9955030
TSA43 90902 71737996
TSA44 97655 54672826
TSA45 63226 108204047
TSA46 89912 77989665
TSA47 87860 65994759
TSA48 86501 67911324
TSA49 77475 79690624
TSA5 43179 10927440
TSA50 40794 62941250
TSA51 90931 66884444
TSA52 76043 84732155
TSA53 71912 78529712
TSA54 71826 60276693
TSA55 87192 79998644
TSA56 85990 87897435
TSA57 55156 77681419
TSA58 83252 74039729
TSA59 91594 48744665
TSA6 112457 59449948
TSA60 98540 54918616
TSA61 75972 66426414
TSA62 100913 61115519
TSA63 102120 49730592
TSA64 12226 7204525
TSA65 102468 60112114
TSA66 70154 93782023
TSA67 94802 57414821
TSA68 94388 42929737
TSA69 71068 68454615
TSA7 95626 66268412
TSA70 39758 46444273
TSA71 70263 113160948
TSA72 104922 61927258
TSA73 117909 52395033
TSA74 74137 71255913
TSA75 79272 85095993
TSA76 76684 76392231
TSA77 64912 113292613
TSA78 9950 28790541
TSA79 72977 66848466
TSA8 105747 68768936
TSA80 78193 80753452
TSA81 65583 62631516
TSA82 64325 64887880
TSA83 61967 69088092
TSA84 62041 69631974
TSA85 93767 80253595
TSA86 50396 38123325
TSA9 105920 64853842
UNA1 239 125812
VRL1 67999 69114361
VRL10 64669 70455833
VRL11 42900 57093251
VRL12 62839 71111799
VRL13 57380 72796068
VRL14 63338 65132746
VRL15 56925 73305442
VRL16 58455 71581749
VRL17 57250 71369666
VRL18 55081 74954673
VRL19 55784 72404121
VRL2 73133 64529137
VRL20 66533 71141264
VRL21 1724 902139
VRL3 69947 60699816
VRL4 68468 69815743
VRL5 50773 52765552
VRL6 48185 77563239
VRL7 47035 72937762
VRL8 62874 69624995
VRL9 62618 71608839
VRT1 42589 121961551
VRT10 1256 189217253
VRT11 8275 177873094
VRT12 3991 136366329
VRT13 13101 170790688
VRT14 5342 182610424
VRT15 3936 186026494
VRT16 37599 134590371
VRT17 79807 68466686
VRT18 78242 66409629
VRT19 30962 24980963
VRT2 1113 194371060
VRT20 71402 77207069
VRT21 46889 121317377
VRT22 77614 63223659
VRT23 79180 62434063
VRT24 80446 56990170
VRT25 103420 65415235
VRT26 49877 39495475
VRT3 72625 77788559
VRT4 8374 171158924
VRT5 31412 29447352
VRT6 73019 66731968
VRT7 31770 63580334
VRT8 30608 112208508
VRT9 1202 189989805
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 190.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:
Entries Bases Species
19974488 16284884320 Homo sapiens
9697015 9974022626 Mus musculus
2187868 6520656032 Rattus norvegicus
2200463 5384418717 Bos taurus
3934250 5062271053 Zea mays
3285666 4887973037 Sus scrofa
1722799 3121277825 Danio rerio
257580 1435225947 Strongylocentrotus purpuratus
453095 1256162876 Macaca mulatta
1348495 1255479936 Oryza sativa Japonica Group
1774103 1197111264 Nicotiana tabacum
1424488 1147323881 Xenopus (Silurana) tropicalis
2329529 1143776415 Arabidopsis thaliana
1252295 1119390905 Drosophila melanogaster
216607 1008294854 Pan troglodytes
766770 998964692 Vitis vinifera
1455680 951100495 Canis lupus familiaris
1902824 906486948 Glycine max
815266 899539532 Gallus gallus
1426822 898569588 Triticum aestivum
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
187 Dec 2011 135117731375 146413798
188 Feb 2012 137384889783 149819246
189 Apr 2012 139266481398 151824421
190 Jun 2012 141343240755 154130210
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
187 Dec 2011 239868309609 73729553
188 Feb 2012 261370512675 78656704
189 Apr 2012 272693351548 80905298
190 Jun 2012 287577367116 82076779
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
October 15 2010
NCBI-GenBank Flat File Release 190.0
Bacterial Sequences (Part 1)
51396 loci, 92682287 bases, from 51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
or 2010.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
June 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA).
Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
DBLINK Project:18787
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK Project:100,200,300
DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:
http://www.ncbi.nlm.nih.gov/genomes/static/gprj_help.html#introduction
As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 190.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Jianli Dai, Michel Eschenbrenner, Irene Fang,
Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Beverly Underwood,
Melissa Wright, and Linda Yankie
Data Management and Preparation
Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
Ilya Dondoshansky, WonHee Jang, Jonathan Kans, Leonid Khotomliansky,
Michael Kimelman, Jim Ostell, Denis Sinyakov, Karl Sirotkin,
Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov
Database Administration
Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
Ben Slade, Constantin Vasilyev
User Support
Peter Cooper, Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris,
Steve Pechous, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
