Release Notes For GenBank Release 192
GBREL.TXT Genetic Sequence Data Bank
October 15 2012
NCBI-GenBank Flat File Release 192.0
Distribution Release Notes
157889737 loci, 145430961262 bases, from 157889737 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 192.0
1.2 Cutoff Date
1.3 Important Changes in Release 192.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 192.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for GenBank's web-based submission tool (BankIt) :
http://www.ncbi.nlm.nih.gov/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 192.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:
http://www.bio-mirror.net/
1.2 Cutoff Date
This full release, 192.0, incorporates data available to the collaborating
databases as of October 08, 2012 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 192.0
1.3.1 Organizational changes
The total number of sequence data files increased by 33 with this release:
- the BCT division is now composed of 91 files (+2)
- the CON division is now composed of 176 files (+4)
- the ENV division is now composed of 57 files (+2)
- the HTG division is now composed of 141 files (+5)
- the INV division is now composed of 33 files (+1)
- the PLN division is now composed of 59 files (+2)
- the TSA division is now composed of 112 files (+16)
- the VRL division is now composed of 22 files (+1)
The total number of 'index' files increased by 2 with this release:
- the AUT (author name) index is now composed of 102 files (+1)
- the JOU (journal) index is now composed of 14 files (+1)
1.3.2 New qualifier : /altitude
Altitude information is an important component of an accurate environmental
sample description (see related qualifiers /lat_lon and /collection_date).
To capture altitude data, a new source-feature qualifier is now legal as of
October 15 2012 (GenBank 192.0) :
Qualifier /altitude=
Definition geographical altitude of the location from which the sample
was collected
Value format "text"
Example /altitude="-256 m."
/altitude="330.12 m."
Cardinality 1
Comment Values indicate altitudes above or below nominal sea level
provided in metres
1.3.3 Modification of the /anticodon qualifier
As of GenBank Release 192.0 in October 2012, the /anticodon qualifier
of tRNA features has been modified to include the sequence of the anticodon:
Qualifier /anticodon=
Definition location of the anticodon of tRNA and the amino acid for which
it codes
Value format (pos:<location>,aa:<amino_acid>,seq:<text>) where location
is the position of the anticodon, amino_acid is the
abbreviation for the amino acid encoded and seq is the
sequence of the anticodon
Example /anticodon=(pos:34..36,aa:Phe,seq:aaa)
/anticodon=(pos:join(5,495..496),aa:Leu,seq:taa)
/anticodon=(pos:complement(4156..4158),aa:Gln,seq:ttg)
Currently, only the 'pos' and 'aa' elements are supported. The addition
of 'seq' should make it more convenient for database users to process
tRNA features: It will no longer be necessary to analyze the 'pos' element
in order to obtain the anticodon sequence.
1.3.4 Expansion of the /linkage_evidence controlled vocabulary
Genome centers sometimes have knowledge from PCR evidence that two contigs
are linked, and thus should be part of a CON-division/scaffold record, however
none of the values in the linkage_evidence controlled vocabulary are appropriate.
So, as of this GenBank Release 192.0 of October 2012, the value "pcr" is now
a legal value for the /linkage_evidence qualifier:
Qualifier /linkage_evidence=
Value format "paired-ends", "align genus", "align xgenus", "align trnscpt",
"within clone", "clone contig", "map", "strobe", "pcr", and
"unspecified"
1.3.5 /frequency qualifier deprecated
Note: This change was not announced in the August 2012 GenBank Release notes
due to an oversight. Our apologies for the omission.
At the 2012 annual INSDC meeting, it was noted that the /frequency qualifier
was very rarely used, on fewer than 9000 records. It was also noted
that the qualifier has limited utility, given that relative frequencies will
evolve as additional sequencing of a given population occurs. Databases that
are dedicated to variation (dbSNP, DGVa, dbVAR, etc) provide far more accurate
frequency information than a little-used and never-updated text qualifier.
So as of the October 2012 GenBank release, the /frequency qualifier has
been deprecated. Existing values for the qualifier are now presented via the
/note qualifier of source features, and GenBank submission tools are being
updated to cease support of /frequency. Here is an example of a record for
which frequency information is now presented via /note :
LOCUS AJ631998 673 bp DNA linear BCT 10-JUN-2005
DEFINITION Spiroplasma sp. MSRO partial 16S rRNA gene, strain MSRO.
ACCESSION AJ631998
VERSION AJ631998.1 GI:45720448
....
source 1..673
/organism="Spiroplasma sp. MSRO"
/mol_type="genomic DNA"
/strain="MSRO"
/host="Drosophila melanogaster"
/db_xref="taxon:265049"
/country="Brazil:Campinas"
/note="natural symbiont of Drosophila melanogaster that
causes embryonic male lethality;
frequency: .23"
1.3.6 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.7 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
106 of the GSS flatfiles in Release 192.0. Consider gbgss155.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
October 15 2012
NCBI-GenBank Flat File Release 192.0
GSS Sequences (Part 1)
87101 loci, 63965498 bases, from 87101 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "155" based on the number of files dumped from the other
system. We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.
1.4 Upcoming Changes
No changes impacting the flatfile format are expected between the
October 2012 and February 2013 GenBank releases.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1887 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut100.idx - Index of the entries according to author name, part 100.
7. gbaut101.idx - Index of the entries according to author name, part 101.
8. gbaut102.idx - Index of the entries according to author name, part 102.
9. gbaut11.idx - Index of the entries according to author name, part 11.
10. gbaut12.idx - Index of the entries according to author name, part 12.
11. gbaut13.idx - Index of the entries according to author name, part 13.
12. gbaut14.idx - Index of the entries according to author name, part 14.
13. gbaut15.idx - Index of the entries according to author name, part 15.
14. gbaut16.idx - Index of the entries according to author name, part 16.
15. gbaut17.idx - Index of the entries according to author name, part 17.
16. gbaut18.idx - Index of the entries according to author name, part 18.
17. gbaut19.idx - Index of the entries according to author name, part 19.
18. gbaut2.idx - Index of the entries according to author name, part 2.
19. gbaut20.idx - Index of the entries according to author name, part 20.
20. gbaut21.idx - Index of the entries according to author name, part 21.
21. gbaut22.idx - Index of the entries according to author name, part 22.
22. gbaut23.idx - Index of the entries according to author name, part 23.
23. gbaut24.idx - Index of the entries according to author name, part 24.
24. gbaut25.idx - Index of the entries according to author name, part 25.
25. gbaut26.idx - Index of the entries according to author name, part 26.
26. gbaut27.idx - Index of the entries according to author name, part 27.
27. gbaut28.idx - Index of the entries according to author name, part 28.
28. gbaut29.idx - Index of the entries according to author name, part 29.
29. gbaut3.idx - Index of the entries according to author name, part 3.
30. gbaut30.idx - Index of the entries according to author name, part 30.
31. gbaut31.idx - Index of the entries according to author name, part 31.
32. gbaut32.idx - Index of the entries according to author name, part 32.
33. gbaut33.idx - Index of the entries according to author name, part 33.
34. gbaut34.idx - Index of the entries according to author name, part 34.
35. gbaut35.idx - Index of the entries according to author name, part 35.
36. gbaut36.idx - Index of the entries according to author name, part 36.
37. gbaut37.idx - Index of the entries according to author name, part 37.
38. gbaut38.idx - Index of the entries according to author name, part 38.
39. gbaut39.idx - Index of the entries according to author name, part 39.
40. gbaut4.idx - Index of the entries according to author name, part 4.
41. gbaut40.idx - Index of the entries according to author name, part 40.
42. gbaut41.idx - Index of the entries according to author name, part 41.
43. gbaut42.idx - Index of the entries according to author name, part 42.
44. gbaut43.idx - Index of the entries according to author name, part 43.
45. gbaut44.idx - Index of the entries according to author name, part 44.
46. gbaut45.idx - Index of the entries according to author name, part 45.
47. gbaut46.idx - Index of the entries according to author name, part 46.
48. gbaut47.idx - Index of the entries according to author name, part 47.
49. gbaut48.idx - Index of the entries according to author name, part 48.
50. gbaut49.idx - Index of the entries according to author name, part 49.
51. gbaut5.idx - Index of the entries according to author name, part 5.
52. gbaut50.idx - Index of the entries according to author name, part 50.
53. gbaut51.idx - Index of the entries according to author name, part 51.
54. gbaut52.idx - Index of the entries according to author name, part 52.
55. gbaut53.idx - Index of the entries according to author name, part 53.
56. gbaut54.idx - Index of the entries according to author name, part 54.
57. gbaut55.idx - Index of the entries according to author name, part 55.
58. gbaut56.idx - Index of the entries according to author name, part 56.
59. gbaut57.idx - Index of the entries according to author name, part 57.
60. gbaut58.idx - Index of the entries according to author name, part 58.
61. gbaut59.idx - Index of the entries according to author name, part 59.
62. gbaut6.idx - Index of the entries according to author name, part 6.
63. gbaut60.idx - Index of the entries according to author name, part 60.
64. gbaut61.idx - Index of the entries according to author name, part 61.
65. gbaut62.idx - Index of the entries according to author name, part 62.
66. gbaut63.idx - Index of the entries according to author name, part 63.
67. gbaut64.idx - Index of the entries according to author name, part 64.
68. gbaut65.idx - Index of the entries according to author name, part 65.
69. gbaut66.idx - Index of the entries according to author name, part 66.
70. gbaut67.idx - Index of the entries according to author name, part 67.
71. gbaut68.idx - Index of the entries according to author name, part 68.
72. gbaut69.idx - Index of the entries according to author name, part 69.
73. gbaut7.idx - Index of the entries according to author name, part 7.
74. gbaut70.idx - Index of the entries according to author name, part 70.
75. gbaut71.idx - Index of the entries according to author name, part 71.
76. gbaut72.idx - Index of the entries according to author name, part 72.
77. gbaut73.idx - Index of the entries according to author name, part 73.
78. gbaut74.idx - Index of the entries according to author name, part 74.
79. gbaut75.idx - Index of the entries according to author name, part 75.
80. gbaut76.idx - Index of the entries according to author name, part 76.
81. gbaut77.idx - Index of the entries according to author name, part 77.
82. gbaut78.idx - Index of the entries according to author name, part 78.
83. gbaut79.idx - Index of the entries according to author name, part 79.
84. gbaut8.idx - Index of the entries according to author name, part 8.
85. gbaut80.idx - Index of the entries according to author name, part 80.
86. gbaut81.idx - Index of the entries according to author name, part 81.
87. gbaut82.idx - Index of the entries according to author name, part 82.
88. gbaut83.idx - Index of the entries according to author name, part 83.
89. gbaut84.idx - Index of the entries according to author name, part 84.
90. gbaut85.idx - Index of the entries according to author name, part 85.
91. gbaut86.idx - Index of the entries according to author name, part 86.
92. gbaut87.idx - Index of the entries according to author name, part 87.
93. gbaut88.idx - Index of the entries according to author name, part 88.
94. gbaut89.idx - Index of the entries according to author name, part 89.
95. gbaut9.idx - Index of the entries according to author name, part 9.
96. gbaut90.idx - Index of the entries according to author name, part 90.
97. gbaut91.idx - Index of the entries according to author name, part 91.
98. gbaut92.idx - Index of the entries according to author name, part 92.
99. gbaut93.idx - Index of the entries according to author name, part 93.
100. gbaut94.idx - Index of the entries according to author name, part 94.
101. gbaut95.idx - Index of the entries according to author name, part 95.
102. gbaut96.idx - Index of the entries according to author name, part 96.
103. gbaut97.idx - Index of the entries according to author name, part 97.
104. gbaut98.idx - Index of the entries according to author name, part 98.
105. gbaut99.idx - Index of the entries according to author name, part 99.
106. gbbct1.seq - Bacterial sequence entries, part 1.
107. gbbct10.seq - Bacterial sequence entries, part 10.
108. gbbct11.seq - Bacterial sequence entries, part 11.
109. gbbct12.seq - Bacterial sequence entries, part 12.
110. gbbct13.seq - Bacterial sequence entries, part 13.
111. gbbct14.seq - Bacterial sequence entries, part 14.
112. gbbct15.seq - Bacterial sequence entries, part 15.
113. gbbct16.seq - Bacterial sequence entries, part 16.
114. gbbct17.seq - Bacterial sequence entries, part 17.
115. gbbct18.seq - Bacterial sequence entries, part 18.
116. gbbct19.seq - Bacterial sequence entries, part 19.
117. gbbct2.seq - Bacterial sequence entries, part 2.
118. gbbct20.seq - Bacterial sequence entries, part 20.
119. gbbct21.seq - Bacterial sequence entries, part 21.
120. gbbct22.seq - Bacterial sequence entries, part 22.
121. gbbct23.seq - Bacterial sequence entries, part 23.
122. gbbct24.seq - Bacterial sequence entries, part 24.
123. gbbct25.seq - Bacterial sequence entries, part 25.
124. gbbct26.seq - Bacterial sequence entries, part 26.
125. gbbct27.seq - Bacterial sequence entries, part 27.
126. gbbct28.seq - Bacterial sequence entries, part 28.
127. gbbct29.seq - Bacterial sequence entries, part 29.
128. gbbct3.seq - Bacterial sequence entries, part 3.
129. gbbct30.seq - Bacterial sequence entries, part 30.
130. gbbct31.seq - Bacterial sequence entries, part 31.
131. gbbct32.seq - Bacterial sequence entries, part 32.
132. gbbct33.seq - Bacterial sequence entries, part 33.
133. gbbct34.seq - Bacterial sequence entries, part 34.
134. gbbct35.seq - Bacterial sequence entries, part 35.
135. gbbct36.seq - Bacterial sequence entries, part 36.
136. gbbct37.seq - Bacterial sequence entries, part 37.
137. gbbct38.seq - Bacterial sequence entries, part 38.
138. gbbct39.seq - Bacterial sequence entries, part 39.
139. gbbct4.seq - Bacterial sequence entries, part 4.
140. gbbct40.seq - Bacterial sequence entries, part 40.
141. gbbct41.seq - Bacterial sequence entries, part 41.
142. gbbct42.seq - Bacterial sequence entries, part 42.
143. gbbct43.seq - Bacterial sequence entries, part 43.
144. gbbct44.seq - Bacterial sequence entries, part 44.
145. gbbct45.seq - Bacterial sequence entries, part 45.
146. gbbct46.seq - Bacterial sequence entries, part 46.
147. gbbct47.seq - Bacterial sequence entries, part 47.
148. gbbct48.seq - Bacterial sequence entries, part 48.
149. gbbct49.seq - Bacterial sequence entries, part 49.
150. gbbct5.seq - Bacterial sequence entries, part 5.
151. gbbct50.seq - Bacterial sequence entries, part 50.
152. gbbct51.seq - Bacterial sequence entries, part 51.
153. gbbct52.seq - Bacterial sequence entries, part 52.
154. gbbct53.seq - Bacterial sequence entries, part 53.
155. gbbct54.seq - Bacterial sequence entries, part 54.
156. gbbct55.seq - Bacterial sequence entries, part 55.
157. gbbct56.seq - Bacterial sequence entries, part 56.
158. gbbct57.seq - Bacterial sequence entries, part 57.
159. gbbct58.seq - Bacterial sequence entries, part 58.
160. gbbct59.seq - Bacterial sequence entries, part 59.
161. gbbct6.seq - Bacterial sequence entries, part 6.
162. gbbct60.seq - Bacterial sequence entries, part 60.
163. gbbct61.seq - Bacterial sequence entries, part 61.
164. gbbct62.seq - Bacterial sequence entries, part 62.
165. gbbct63.seq - Bacterial sequence entries, part 63.
166. gbbct64.seq - Bacterial sequence entries, part 64.
167. gbbct65.seq - Bacterial sequence entries, part 65.
168. gbbct66.seq - Bacterial sequence entries, part 66.
169. gbbct67.seq - Bacterial sequence entries, part 67.
170. gbbct68.seq - Bacterial sequence entries, part 68.
171. gbbct69.seq - Bacterial sequence entries, part 69.
172. gbbct7.seq - Bacterial sequence entries, part 7.
173. gbbct70.seq - Bacterial sequence entries, part 70.
174. gbbct71.seq - Bacterial sequence entries, part 71.
175. gbbct72.seq - Bacterial sequence entries, part 72.
176. gbbct73.seq - Bacterial sequence entries, part 73.
177. gbbct74.seq - Bacterial sequence entries, part 74.
178. gbbct75.seq - Bacterial sequence entries, part 75.
179. gbbct76.seq - Bacterial sequence entries, part 76.
180. gbbct77.seq - Bacterial sequence entries, part 77.
181. gbbct78.seq - Bacterial sequence entries, part 78.
182. gbbct79.seq - Bacterial sequence entries, part 79.
183. gbbct8.seq - Bacterial sequence entries, part 8.
184. gbbct80.seq - Bacterial sequence entries, part 80.
185. gbbct81.seq - Bacterial sequence entries, part 81.
186. gbbct82.seq - Bacterial sequence entries, part 82.
187. gbbct83.seq - Bacterial sequence entries, part 83.
188. gbbct84.seq - Bacterial sequence entries, part 84.
189. gbbct85.seq - Bacterial sequence entries, part 85.
190. gbbct86.seq - Bacterial sequence entries, part 86.
191. gbbct87.seq - Bacterial sequence entries, part 87.
192. gbbct88.seq - Bacterial sequence entries, part 88.
193. gbbct89.seq - Bacterial sequence entries, part 89.
194. gbbct9.seq - Bacterial sequence entries, part 9.
195. gbbct90.seq - Bacterial sequence entries, part 90.
196. gbbct91.seq - Bacterial sequence entries, part 91.
197. gbchg.txt - Accession numbers of entries updated since the previous release.
198. gbcon1.seq - Constructed sequence entries, part 1.
199. gbcon10.seq - Constructed sequence entries, part 10.
200. gbcon100.seq - Constructed sequence entries, part 100.
201. gbcon101.seq - Constructed sequence entries, part 101.
202. gbcon102.seq - Constructed sequence entries, part 102.
203. gbcon103.seq - Constructed sequence entries, part 103.
204. gbcon104.seq - Constructed sequence entries, part 104.
205. gbcon105.seq - Constructed sequence entries, part 105.
206. gbcon106.seq - Constructed sequence entries, part 106.
207. gbcon107.seq - Constructed sequence entries, part 107.
208. gbcon108.seq - Constructed sequence entries, part 108.
209. gbcon109.seq - Constructed sequence entries, part 109.
210. gbcon11.seq - Constructed sequence entries, part 11.
211. gbcon110.seq - Constructed sequence entries, part 110.
212. gbcon111.seq - Constructed sequence entries, part 111.
213. gbcon112.seq - Constructed sequence entries, part 112.
214. gbcon113.seq - Constructed sequence entries, part 113.
215. gbcon114.seq - Constructed sequence entries, part 114.
216. gbcon115.seq - Constructed sequence entries, part 115.
217. gbcon116.seq - Constructed sequence entries, part 116.
218. gbcon117.seq - Constructed sequence entries, part 117.
219. gbcon118.seq - Constructed sequence entries, part 118.
220. gbcon119.seq - Constructed sequence entries, part 119.
221. gbcon12.seq - Constructed sequence entries, part 12.
222. gbcon120.seq - Constructed sequence entries, part 120.
223. gbcon121.seq - Constructed sequence entries, part 121.
224. gbcon122.seq - Constructed sequence entries, part 122.
225. gbcon123.seq - Constructed sequence entries, part 123.
226. gbcon124.seq - Constructed sequence entries, part 124.
227. gbcon125.seq - Constructed sequence entries, part 125.
228. gbcon126.seq - Constructed sequence entries, part 126.
229. gbcon127.seq - Constructed sequence entries, part 127.
230. gbcon128.seq - Constructed sequence entries, part 128.
231. gbcon129.seq - Constructed sequence entries, part 129.
232. gbcon13.seq - Constructed sequence entries, part 13.
233. gbcon130.seq - Constructed sequence entries, part 130.
234. gbcon131.seq - Constructed sequence entries, part 131.
235. gbcon132.seq - Constructed sequence entries, part 132.
236. gbcon133.seq - Constructed sequence entries, part 133.
237. gbcon134.seq - Constructed sequence entries, part 134.
238. gbcon135.seq - Constructed sequence entries, part 135.
239. gbcon136.seq - Constructed sequence entries, part 136.
240. gbcon137.seq - Constructed sequence entries, part 137.
241. gbcon138.seq - Constructed sequence entries, part 138.
242. gbcon139.seq - Constructed sequence entries, part 139.
243. gbcon14.seq - Constructed sequence entries, part 14.
244. gbcon140.seq - Constructed sequence entries, part 140.
245. gbcon141.seq - Constructed sequence entries, part 141.
246. gbcon142.seq - Constructed sequence entries, part 142.
247. gbcon143.seq - Constructed sequence entries, part 143.
248. gbcon144.seq - Constructed sequence entries, part 144.
249. gbcon145.seq - Constructed sequence entries, part 145.
250. gbcon146.seq - Constructed sequence entries, part 146.
251. gbcon147.seq - Constructed sequence entries, part 147.
252. gbcon148.seq - Constructed sequence entries, part 148.
253. gbcon149.seq - Constructed sequence entries, part 149.
254. gbcon15.seq - Constructed sequence entries, part 15.
255. gbcon150.seq - Constructed sequence entries, part 150.
256. gbcon151.seq - Constructed sequence entries, part 151.
257. gbcon152.seq - Constructed sequence entries, part 152.
258. gbcon153.seq - Constructed sequence entries, part 153.
259. gbcon154.seq - Constructed sequence entries, part 154.
260. gbcon155.seq - Constructed sequence entries, part 155.
261. gbcon156.seq - Constructed sequence entries, part 156.
262. gbcon157.seq - Constructed sequence entries, part 157.
263. gbcon158.seq - Constructed sequence entries, part 158.
264. gbcon159.seq - Constructed sequence entries, part 159.
265. gbcon16.seq - Constructed sequence entries, part 16.
266. gbcon160.seq - Constructed sequence entries, part 160.
267. gbcon161.seq - Constructed sequence entries, part 161.
268. gbcon162.seq - Constructed sequence entries, part 162.
269. gbcon163.seq - Constructed sequence entries, part 163.
270. gbcon164.seq - Constructed sequence entries, part 164.
271. gbcon165.seq - Constructed sequence entries, part 165.
272. gbcon166.seq - Constructed sequence entries, part 166.
273. gbcon167.seq - Constructed sequence entries, part 167.
274. gbcon168.seq - Constructed sequence entries, part 168.
275. gbcon169.seq - Constructed sequence entries, part 169.
276. gbcon17.seq - Constructed sequence entries, part 17.
277. gbcon170.seq - Constructed sequence entries, part 170.
278. gbcon171.seq - Constructed sequence entries, part 171.
279. gbcon172.seq - Constructed sequence entries, part 172.
280. gbcon173.seq - Constructed sequence entries, part 173.
281. gbcon174.seq - Constructed sequence entries, part 174.
282. gbcon175.seq - Constructed sequence entries, part 175.
283. gbcon176.seq - Constructed sequence entries, part 176.
284. gbcon18.seq - Constructed sequence entries, part 18.
285. gbcon19.seq - Constructed sequence entries, part 19.
286. gbcon2.seq - Constructed sequence entries, part 2.
287. gbcon20.seq - Constructed sequence entries, part 20.
288. gbcon21.seq - Constructed sequence entries, part 21.
289. gbcon22.seq - Constructed sequence entries, part 22.
290. gbcon23.seq - Constructed sequence entries, part 23.
291. gbcon24.seq - Constructed sequence entries, part 24.
292. gbcon25.seq - Constructed sequence entries, part 25.
293. gbcon26.seq - Constructed sequence entries, part 26.
294. gbcon27.seq - Constructed sequence entries, part 27.
295. gbcon28.seq - Constructed sequence entries, part 28.
296. gbcon29.seq - Constructed sequence entries, part 29.
297. gbcon3.seq - Constructed sequence entries, part 3.
298. gbcon30.seq - Constructed sequence entries, part 30.
299. gbcon31.seq - Constructed sequence entries, part 31.
300. gbcon32.seq - Constructed sequence entries, part 32.
301. gbcon33.seq - Constructed sequence entries, part 33.
302. gbcon34.seq - Constructed sequence entries, part 34.
303. gbcon35.seq - Constructed sequence entries, part 35.
304. gbcon36.seq - Constructed sequence entries, part 36.
305. gbcon37.seq - Constructed sequence entries, part 37.
306. gbcon38.seq - Constructed sequence entries, part 38.
307. gbcon39.seq - Constructed sequence entries, part 39.
308. gbcon4.seq - Constructed sequence entries, part 4.
309. gbcon40.seq - Constructed sequence entries, part 40.
310. gbcon41.seq - Constructed sequence entries, part 41.
311. gbcon42.seq - Constructed sequence entries, part 42.
312. gbcon43.seq - Constructed sequence entries, part 43.
313. gbcon44.seq - Constructed sequence entries, part 44.
314. gbcon45.seq - Constructed sequence entries, part 45.
315. gbcon46.seq - Constructed sequence entries, part 46.
316. gbcon47.seq - Constructed sequence entries, part 47.
317. gbcon48.seq - Constructed sequence entries, part 48.
318. gbcon49.seq - Constructed sequence entries, part 49.
319. gbcon5.seq - Constructed sequence entries, part 5.
320. gbcon50.seq - Constructed sequence entries, part 50.
321. gbcon51.seq - Constructed sequence entries, part 51.
322. gbcon52.seq - Constructed sequence entries, part 52.
323. gbcon53.seq - Constructed sequence entries, part 53.
324. gbcon54.seq - Constructed sequence entries, part 54.
325. gbcon55.seq - Constructed sequence entries, part 55.
326. gbcon56.seq - Constructed sequence entries, part 56.
327. gbcon57.seq - Constructed sequence entries, part 57.
328. gbcon58.seq - Constructed sequence entries, part 58.
329. gbcon59.seq - Constructed sequence entries, part 59.
330. gbcon6.seq - Constructed sequence entries, part 6.
331. gbcon60.seq - Constructed sequence entries, part 60.
332. gbcon61.seq - Constructed sequence entries, part 61.
333. gbcon62.seq - Constructed sequence entries, part 62.
334. gbcon63.seq - Constructed sequence entries, part 63.
335. gbcon64.seq - Constructed sequence entries, part 64.
336. gbcon65.seq - Constructed sequence entries, part 65.
337. gbcon66.seq - Constructed sequence entries, part 66.
338. gbcon67.seq - Constructed sequence entries, part 67.
339. gbcon68.seq - Constructed sequence entries, part 68.
340. gbcon69.seq - Constructed sequence entries, part 69.
341. gbcon7.seq - Constructed sequence entries, part 7.
342. gbcon70.seq - Constructed sequence entries, part 70.
343. gbcon71.seq - Constructed sequence entries, part 71.
344. gbcon72.seq - Constructed sequence entries, part 72.
345. gbcon73.seq - Constructed sequence entries, part 73.
346. gbcon74.seq - Constructed sequence entries, part 74.
347. gbcon75.seq - Constructed sequence entries, part 75.
348. gbcon76.seq - Constructed sequence entries, part 76.
349. gbcon77.seq - Constructed sequence entries, part 77.
350. gbcon78.seq - Constructed sequence entries, part 78.
351. gbcon79.seq - Constructed sequence entries, part 79.
352. gbcon8.seq - Constructed sequence entries, part 8.
353. gbcon80.seq - Constructed sequence entries, part 80.
354. gbcon81.seq - Constructed sequence entries, part 81.
355. gbcon82.seq - Constructed sequence entries, part 82.
356. gbcon83.seq - Constructed sequence entries, part 83.
357. gbcon84.seq - Constructed sequence entries, part 84.
358. gbcon85.seq - Constructed sequence entries, part 85.
359. gbcon86.seq - Constructed sequence entries, part 86.
360. gbcon87.seq - Constructed sequence entries, part 87.
361. gbcon88.seq - Constructed sequence entries, part 88.
362. gbcon89.seq - Constructed sequence entries, part 89.
363. gbcon9.seq - Constructed sequence entries, part 9.
364. gbcon90.seq - Constructed sequence entries, part 90.
365. gbcon91.seq - Constructed sequence entries, part 91.
366. gbcon92.seq - Constructed sequence entries, part 92.
367. gbcon93.seq - Constructed sequence entries, part 93.
368. gbcon94.seq - Constructed sequence entries, part 94.
369. gbcon95.seq - Constructed sequence entries, part 95.
370. gbcon96.seq - Constructed sequence entries, part 96.
371. gbcon97.seq - Constructed sequence entries, part 97.
372. gbcon98.seq - Constructed sequence entries, part 98.
373. gbcon99.seq - Constructed sequence entries, part 99.
374. gbdel.txt - Accession numbers of entries deleted since the previous release.
375. gbenv1.seq - Environmental sampling sequence entries, part 1.
376. gbenv10.seq - Environmental sampling sequence entries, part 10.
377. gbenv11.seq - Environmental sampling sequence entries, part 11.
378. gbenv12.seq - Environmental sampling sequence entries, part 12.
379. gbenv13.seq - Environmental sampling sequence entries, part 13.
380. gbenv14.seq - Environmental sampling sequence entries, part 14.
381. gbenv15.seq - Environmental sampling sequence entries, part 15.
382. gbenv16.seq - Environmental sampling sequence entries, part 16.
383. gbenv17.seq - Environmental sampling sequence entries, part 17.
384. gbenv18.seq - Environmental sampling sequence entries, part 18.
385. gbenv19.seq - Environmental sampling sequence entries, part 19.
386. gbenv2.seq - Environmental sampling sequence entries, part 2.
387. gbenv20.seq - Environmental sampling sequence entries, part 20.
388. gbenv21.seq - Environmental sampling sequence entries, part 21.
389. gbenv22.seq - Environmental sampling sequence entries, part 22.
390. gbenv23.seq - Environmental sampling sequence entries, part 23.
391. gbenv24.seq - Environmental sampling sequence entries, part 24.
392. gbenv25.seq - Environmental sampling sequence entries, part 25.
393. gbenv26.seq - Environmental sampling sequence entries, part 26.
394. gbenv27.seq - Environmental sampling sequence entries, part 27.
395. gbenv28.seq - Environmental sampling sequence entries, part 28.
396. gbenv29.seq - Environmental sampling sequence entries, part 29.
397. gbenv3.seq - Environmental sampling sequence entries, part 3.
398. gbenv30.seq - Environmental sampling sequence entries, part 30.
399. gbenv31.seq - Environmental sampling sequence entries, part 31.
400. gbenv32.seq - Environmental sampling sequence entries, part 32.
401. gbenv33.seq - Environmental sampling sequence entries, part 33.
402. gbenv34.seq - Environmental sampling sequence entries, part 34.
403. gbenv35.seq - Environmental sampling sequence entries, part 35.
404. gbenv36.seq - Environmental sampling sequence entries, part 36.
405. gbenv37.seq - Environmental sampling sequence entries, part 37.
406. gbenv38.seq - Environmental sampling sequence entries, part 38.
407. gbenv39.seq - Environmental sampling sequence entries, part 39.
408. gbenv4.seq - Environmental sampling sequence entries, part 4.
409. gbenv40.seq - Environmental sampling sequence entries, part 40.
410. gbenv41.seq - Environmental sampling sequence entries, part 41.
411. gbenv42.seq - Environmental sampling sequence entries, part 42.
412. gbenv43.seq - Environmental sampling sequence entries, part 43.
413. gbenv44.seq - Environmental sampling sequence entries, part 44.
414. gbenv45.seq - Environmental sampling sequence entries, part 45.
415. gbenv46.seq - Environmental sampling sequence entries, part 46.
416. gbenv47.seq - Environmental sampling sequence entries, part 47.
417. gbenv48.seq - Environmental sampling sequence entries, part 48.
418. gbenv49.seq - Environmental sampling sequence entries, part 49.
419. gbenv5.seq - Environmental sampling sequence entries, part 5.
420. gbenv50.seq - Environmental sampling sequence entries, part 50.
421. gbenv51.seq - Environmental sampling sequence entries, part 51.
422. gbenv52.seq - Environmental sampling sequence entries, part 52.
423. gbenv53.seq - Environmental sampling sequence entries, part 53.
424. gbenv54.seq - Environmental sampling sequence entries, part 54.
425. gbenv55.seq - Environmental sampling sequence entries, part 55.
426. gbenv56.seq - Environmental sampling sequence entries, part 56.
427. gbenv57.seq - Environmental sampling sequence entries, part 57.
428. gbenv6.seq - Environmental sampling sequence entries, part 6.
429. gbenv7.seq - Environmental sampling sequence entries, part 7.
430. gbenv8.seq - Environmental sampling sequence entries, part 8.
431. gbenv9.seq - Environmental sampling sequence entries, part 9.
432. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
433. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
434. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
435. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
436. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
437. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
438. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
439. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
440. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
441. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
442. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
443. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
444. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
445. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
446. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
447. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
448. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
449. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
450. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
451. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
452. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
453. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
454. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
455. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
456. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
457. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
458. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
459. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
460. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
461. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
462. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
463. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
464. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
465. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
466. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
467. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
468. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
469. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
470. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
471. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
472. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
473. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
474. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
475. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
476. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
477. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
478. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
479. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
480. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
481. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
482. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
483. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
484. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
485. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
486. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
487. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
488. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
489. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
490. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
491. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
492. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
493. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
494. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
495. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
496. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
497. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
498. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
499. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
500. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
501. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
502. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
503. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
504. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
505. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
506. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
507. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
508. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
509. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
510. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
511. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
512. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
513. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
514. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
515. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
516. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
517. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
518. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
519. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
520. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
521. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
522. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
523. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
524. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
525. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
526. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
527. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
528. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
529. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
530. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
531. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
532. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
533. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
534. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
535. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
536. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
537. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
538. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
539. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
540. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
541. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
542. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
543. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
544. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
545. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
546. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
547. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
548. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
549. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
550. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
551. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
552. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
553. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
554. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
555. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
556. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
557. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
558. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
559. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
560. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
561. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
562. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
563. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
564. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
565. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
566. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
567. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
568. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
569. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
570. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
571. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
572. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
573. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
574. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
575. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
576. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
577. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
578. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
579. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
580. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
581. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
582. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
583. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
584. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
585. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
586. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
587. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
588. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
589. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
590. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
591. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
592. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
593. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
594. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
595. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
596. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
597. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
598. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
599. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
600. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
601. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
602. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
603. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
604. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
605. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
606. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
607. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
608. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
609. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
610. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
611. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
612. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
613. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
614. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
615. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
616. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
617. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
618. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
619. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
620. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
621. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
622. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
623. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
624. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
625. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
626. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
627. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
628. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
629. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
630. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
631. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
632. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
633. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
634. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
635. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
636. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
637. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
638. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
639. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
640. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
641. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
642. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
643. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
644. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
645. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
646. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
647. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
648. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
649. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
650. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
651. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
652. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
653. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
654. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
655. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
656. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
657. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
658. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
659. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
660. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
661. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
662. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
663. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
664. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
665. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
666. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
667. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
668. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
669. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
670. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
671. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
672. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
673. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
674. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
675. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
676. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
677. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
678. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
679. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
680. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
681. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
682. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
683. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
684. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
685. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
686. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
687. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
688. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
689. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
690. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
691. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
692. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
693. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
694. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
695. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
696. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
697. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
698. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
699. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
700. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
701. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
702. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
703. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
704. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
705. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
706. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
707. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
708. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
709. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
710. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
711. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
712. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
713. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
714. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
715. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
716. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
717. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
718. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
719. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
720. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
721. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
722. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
723. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
724. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
725. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
726. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
727. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
728. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
729. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
730. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
731. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
732. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
733. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
734. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
735. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
736. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
737. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
738. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
739. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
740. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
741. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
742. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
743. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
744. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
745. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
746. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
747. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
748. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
749. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
750. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
751. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
752. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
753. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
754. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
755. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
756. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
757. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
758. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
759. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
760. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
761. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
762. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
763. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
764. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
765. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
766. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
767. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
768. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
769. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
770. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
771. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
772. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
773. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
774. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
775. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
776. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
777. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
778. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
779. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
780. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
781. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
782. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
783. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
784. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
785. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
786. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
787. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
788. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
789. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
790. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
791. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
792. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
793. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
794. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
795. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
796. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
797. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
798. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
799. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
800. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
801. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
802. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
803. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
804. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
805. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
806. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
807. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
808. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
809. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
810. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
811. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
812. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
813. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
814. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
815. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
816. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
817. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
818. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
819. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
820. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
821. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
822. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
823. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
824. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
825. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
826. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
827. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
828. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
829. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
830. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
831. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
832. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
833. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
834. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
835. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
836. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
837. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
838. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
839. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
840. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
841. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
842. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
843. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
844. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
845. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
846. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
847. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
848. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
849. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
850. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
851. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
852. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
853. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
854. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
855. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
856. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
857. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
858. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
859. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
860. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
861. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
862. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
863. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
864. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
865. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
866. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
867. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
868. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
869. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
870. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
871. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
872. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
873. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
874. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
875. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
876. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
877. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
878. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
879. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
880. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
881. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
882. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
883. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
884. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
885. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
886. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
887. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
888. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
889. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
890. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
891. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
892. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
893. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
894. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
895. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
896. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
897. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
898. gbgen.idx - Index of the entries according to gene symbols.
899. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
900. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
901. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
902. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
903. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
904. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
905. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
906. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
907. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
908. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
909. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
910. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
911. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
912. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
913. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
914. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
915. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
916. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
917. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
918. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
919. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
920. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
921. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
922. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
923. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
924. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
925. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
926. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
927. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
928. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
929. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
930. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
931. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
932. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
933. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
934. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
935. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
936. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
937. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
938. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
939. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
940. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
941. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
942. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
943. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
944. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
945. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
946. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
947. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
948. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
949. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
950. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
951. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
952. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
953. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
954. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
955. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
956. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
957. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
958. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
959. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
960. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
961. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
962. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
963. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
964. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
965. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
966. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
967. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
968. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
969. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
970. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
971. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
972. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
973. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
974. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
975. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
976. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
977. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
978. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
979. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
980. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
981. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
982. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
983. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
984. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
985. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
986. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
987. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
988. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
989. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
990. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
991. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
992. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
993. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
994. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
995. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
996. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
997. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
998. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
999. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1000. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1001. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1002. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1003. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1004. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1005. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1006. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1007. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1008. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1009. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1010. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1011. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1012. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1013. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1014. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1015. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1016. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1017. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1018. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1019. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1020. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1021. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1022. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1023. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1024. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1025. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1026. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1027. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1028. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1029. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1030. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1031. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1032. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1033. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1034. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1035. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1036. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1037. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1038. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1039. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1040. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1041. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1042. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1043. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1044. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1045. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1046. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1047. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1048. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1049. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1050. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1051. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1052. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1053. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1054. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1055. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1056. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1057. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1058. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1059. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1060. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1061. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1062. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1063. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1064. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1065. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1066. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1067. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1068. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1069. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1070. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1071. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1072. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1073. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1074. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1075. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1076. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1077. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1078. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1079. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1080. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1081. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1082. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1083. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1084. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1085. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1086. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1087. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1088. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1089. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1090. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1091. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1092. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1093. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1094. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1095. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1096. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1097. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1098. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1099. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1100. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1101. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1102. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1103. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1104. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1105. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1106. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1107. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1108. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1109. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1110. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1111. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1112. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1113. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1114. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1115. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1116. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1117. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1118. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1119. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1120. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1121. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1122. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1123. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1124. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1125. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1126. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1127. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1128. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1129. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1130. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1131. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1132. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1133. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1134. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1135. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1136. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1137. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1138. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1139. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1140. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1141. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1142. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1143. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1144. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1145. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1146. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1147. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1148. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1149. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1150. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1151. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1152. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1153. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1154. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1155. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1156. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1157. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1158. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1159. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1160. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1161. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1162. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1163. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1164. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1165. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1166. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1167. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1168. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1169. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1170. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1171. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1172. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1173. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1174. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1175. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1176. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1177. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1178. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1179. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1180. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1181. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1182. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1183. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1184. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1185. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1186. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1187. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1188. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1189. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1190. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1191. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1192. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1193. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1194. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1195. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1196. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1197. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1198. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1199. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1200. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1201. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1202. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1203. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1204. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1205. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1206. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1207. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1208. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1209. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1210. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1211. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1212. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1213. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1214. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1215. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1216. gbhtg137.seq - HTGS (high throughput genomic sequencing) sequence entries, part 137.
1217. gbhtg138.seq - HTGS (high throughput genomic sequencing) sequence entries, part 138.
1218. gbhtg139.seq - HTGS (high throughput genomic sequencing) sequence entries, part 139.
1219. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1220. gbhtg140.seq - HTGS (high throughput genomic sequencing) sequence entries, part 140.
1221. gbhtg141.seq - HTGS (high throughput genomic sequencing) sequence entries, part 141.
1222. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1223. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1224. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1225. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1226. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1227. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1228. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1229. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1230. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1231. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1232. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1233. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1234. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1235. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1236. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1237. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1238. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1239. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1240. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1241. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1242. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1243. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1244. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1245. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1246. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1247. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1248. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1249. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1250. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1251. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1252. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1253. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1254. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1255. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1256. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1257. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1258. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1259. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1260. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1261. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1262. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1263. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1264. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1265. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1266. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1267. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1268. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1269. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1270. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1271. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1272. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1273. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1274. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1275. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1276. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1277. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1278. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1279. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1280. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1281. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1282. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1283. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1284. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1285. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1286. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1287. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1288. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1289. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1290. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1291. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1292. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1293. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1294. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1295. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1296. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1297. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1298. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1299. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1300. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1301. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1302. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1303. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1304. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1305. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1306. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1307. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1308. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1309. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1310. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1311. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1312. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1313. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1314. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1315. gbinv1.seq - Invertebrate sequence entries, part 1.
1316. gbinv10.seq - Invertebrate sequence entries, part 10.
1317. gbinv11.seq - Invertebrate sequence entries, part 11.
1318. gbinv12.seq - Invertebrate sequence entries, part 12.
1319. gbinv13.seq - Invertebrate sequence entries, part 13.
1320. gbinv14.seq - Invertebrate sequence entries, part 14.
1321. gbinv15.seq - Invertebrate sequence entries, part 15.
1322. gbinv16.seq - Invertebrate sequence entries, part 16.
1323. gbinv17.seq - Invertebrate sequence entries, part 17.
1324. gbinv18.seq - Invertebrate sequence entries, part 18.
1325. gbinv19.seq - Invertebrate sequence entries, part 19.
1326. gbinv2.seq - Invertebrate sequence entries, part 2.
1327. gbinv20.seq - Invertebrate sequence entries, part 20.
1328. gbinv21.seq - Invertebrate sequence entries, part 21.
1329. gbinv22.seq - Invertebrate sequence entries, part 22.
1330. gbinv23.seq - Invertebrate sequence entries, part 23.
1331. gbinv24.seq - Invertebrate sequence entries, part 24.
1332. gbinv25.seq - Invertebrate sequence entries, part 25.
1333. gbinv26.seq - Invertebrate sequence entries, part 26.
1334. gbinv27.seq - Invertebrate sequence entries, part 27.
1335. gbinv28.seq - Invertebrate sequence entries, part 28.
1336. gbinv29.seq - Invertebrate sequence entries, part 29.
1337. gbinv3.seq - Invertebrate sequence entries, part 3.
1338. gbinv30.seq - Invertebrate sequence entries, part 30.
1339. gbinv31.seq - Invertebrate sequence entries, part 31.
1340. gbinv32.seq - Invertebrate sequence entries, part 32.
1341. gbinv33.seq - Invertebrate sequence entries, part 33.
1342. gbinv4.seq - Invertebrate sequence entries, part 4.
1343. gbinv5.seq - Invertebrate sequence entries, part 5.
1344. gbinv6.seq - Invertebrate sequence entries, part 6.
1345. gbinv7.seq - Invertebrate sequence entries, part 7.
1346. gbinv8.seq - Invertebrate sequence entries, part 8.
1347. gbinv9.seq - Invertebrate sequence entries, part 9.
1348. gbjou1.idx - Index of the entries according to journal citation, part 1.
1349. gbjou10.idx - Index of the entries according to journal citation, part 10.
1350. gbjou11.idx - Index of the entries according to journal citation, part 11.
1351. gbjou12.idx - Index of the entries according to journal citation, part 12.
1352. gbjou13.idx - Index of the entries according to journal citation, part 13.
1353. gbjou14.idx - Index of the entries according to journal citation, part 14.
1354. gbjou2.idx - Index of the entries according to journal citation, part 2.
1355. gbjou3.idx - Index of the entries according to journal citation, part 3.
1356. gbjou4.idx - Index of the entries according to journal citation, part 4.
1357. gbjou5.idx - Index of the entries according to journal citation, part 5.
1358. gbjou6.idx - Index of the entries according to journal citation, part 6.
1359. gbjou7.idx - Index of the entries according to journal citation, part 7.
1360. gbjou8.idx - Index of the entries according to journal citation, part 8.
1361. gbjou9.idx - Index of the entries according to journal citation, part 9.
1362. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1363. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1364. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1365. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1366. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1367. gbkey6.idx - Index of the entries according to keyword phrase, part 6.
1368. gbkey7.idx - Index of the entries according to keyword phrase, part 7.
1369. gbmam1.seq - Other mammalian sequence entries, part 1.
1370. gbmam2.seq - Other mammalian sequence entries, part 2.
1371. gbmam3.seq - Other mammalian sequence entries, part 3.
1372. gbmam4.seq - Other mammalian sequence entries, part 4.
1373. gbmam5.seq - Other mammalian sequence entries, part 5.
1374. gbmam6.seq - Other mammalian sequence entries, part 6.
1375. gbmam7.seq - Other mammalian sequence entries, part 7.
1376. gbmam8.seq - Other mammalian sequence entries, part 8.
1377. gbnew.txt - Accession numbers of entries new since the previous release.
1378. gbpat1.seq - Patent sequence entries, part 1.
1379. gbpat10.seq - Patent sequence entries, part 10.
1380. gbpat100.seq - Patent sequence entries, part 100.
1381. gbpat101.seq - Patent sequence entries, part 101.
1382. gbpat102.seq - Patent sequence entries, part 102.
1383. gbpat103.seq - Patent sequence entries, part 103.
1384. gbpat104.seq - Patent sequence entries, part 104.
1385. gbpat105.seq - Patent sequence entries, part 105.
1386. gbpat106.seq - Patent sequence entries, part 106.
1387. gbpat107.seq - Patent sequence entries, part 107.
1388. gbpat108.seq - Patent sequence entries, part 108.
1389. gbpat109.seq - Patent sequence entries, part 109.
1390. gbpat11.seq - Patent sequence entries, part 11.
1391. gbpat110.seq - Patent sequence entries, part 110.
1392. gbpat111.seq - Patent sequence entries, part 111.
1393. gbpat112.seq - Patent sequence entries, part 112.
1394. gbpat113.seq - Patent sequence entries, part 113.
1395. gbpat114.seq - Patent sequence entries, part 114.
1396. gbpat115.seq - Patent sequence entries, part 115.
1397. gbpat116.seq - Patent sequence entries, part 116.
1398. gbpat117.seq - Patent sequence entries, part 117.
1399. gbpat118.seq - Patent sequence entries, part 118.
1400. gbpat119.seq - Patent sequence entries, part 119.
1401. gbpat12.seq - Patent sequence entries, part 12.
1402. gbpat120.seq - Patent sequence entries, part 120.
1403. gbpat121.seq - Patent sequence entries, part 121.
1404. gbpat122.seq - Patent sequence entries, part 122.
1405. gbpat123.seq - Patent sequence entries, part 123.
1406. gbpat124.seq - Patent sequence entries, part 124.
1407. gbpat125.seq - Patent sequence entries, part 125.
1408. gbpat126.seq - Patent sequence entries, part 126.
1409. gbpat127.seq - Patent sequence entries, part 127.
1410. gbpat128.seq - Patent sequence entries, part 128.
1411. gbpat129.seq - Patent sequence entries, part 129.
1412. gbpat13.seq - Patent sequence entries, part 13.
1413. gbpat130.seq - Patent sequence entries, part 130.
1414. gbpat131.seq - Patent sequence entries, part 131.
1415. gbpat132.seq - Patent sequence entries, part 132.
1416. gbpat133.seq - Patent sequence entries, part 133.
1417. gbpat134.seq - Patent sequence entries, part 134.
1418. gbpat135.seq - Patent sequence entries, part 135.
1419. gbpat136.seq - Patent sequence entries, part 136.
1420. gbpat137.seq - Patent sequence entries, part 137.
1421. gbpat138.seq - Patent sequence entries, part 138.
1422. gbpat139.seq - Patent sequence entries, part 139.
1423. gbpat14.seq - Patent sequence entries, part 14.
1424. gbpat140.seq - Patent sequence entries, part 140.
1425. gbpat141.seq - Patent sequence entries, part 141.
1426. gbpat142.seq - Patent sequence entries, part 142.
1427. gbpat143.seq - Patent sequence entries, part 143.
1428. gbpat144.seq - Patent sequence entries, part 144.
1429. gbpat145.seq - Patent sequence entries, part 145.
1430. gbpat146.seq - Patent sequence entries, part 146.
1431. gbpat147.seq - Patent sequence entries, part 147.
1432. gbpat148.seq - Patent sequence entries, part 148.
1433. gbpat149.seq - Patent sequence entries, part 149.
1434. gbpat15.seq - Patent sequence entries, part 15.
1435. gbpat150.seq - Patent sequence entries, part 150.
1436. gbpat151.seq - Patent sequence entries, part 151.
1437. gbpat152.seq - Patent sequence entries, part 152.
1438. gbpat153.seq - Patent sequence entries, part 153.
1439. gbpat154.seq - Patent sequence entries, part 154.
1440. gbpat155.seq - Patent sequence entries, part 155.
1441. gbpat156.seq - Patent sequence entries, part 156.
1442. gbpat157.seq - Patent sequence entries, part 157.
1443. gbpat158.seq - Patent sequence entries, part 158.
1444. gbpat159.seq - Patent sequence entries, part 159.
1445. gbpat16.seq - Patent sequence entries, part 16.
1446. gbpat160.seq - Patent sequence entries, part 160.
1447. gbpat161.seq - Patent sequence entries, part 161.
1448. gbpat162.seq - Patent sequence entries, part 162.
1449. gbpat163.seq - Patent sequence entries, part 163.
1450. gbpat164.seq - Patent sequence entries, part 164.
1451. gbpat165.seq - Patent sequence entries, part 165.
1452. gbpat166.seq - Patent sequence entries, part 166.
1453. gbpat167.seq - Patent sequence entries, part 167.
1454. gbpat168.seq - Patent sequence entries, part 168.
1455. gbpat169.seq - Patent sequence entries, part 169.
1456. gbpat17.seq - Patent sequence entries, part 17.
1457. gbpat170.seq - Patent sequence entries, part 170.
1458. gbpat171.seq - Patent sequence entries, part 171.
1459. gbpat172.seq - Patent sequence entries, part 172.
1460. gbpat173.seq - Patent sequence entries, part 173.
1461. gbpat174.seq - Patent sequence entries, part 174.
1462. gbpat175.seq - Patent sequence entries, part 175.
1463. gbpat176.seq - Patent sequence entries, part 176.
1464. gbpat177.seq - Patent sequence entries, part 177.
1465. gbpat178.seq - Patent sequence entries, part 178.
1466. gbpat179.seq - Patent sequence entries, part 179.
1467. gbpat18.seq - Patent sequence entries, part 18.
1468. gbpat180.seq - Patent sequence entries, part 180.
1469. gbpat181.seq - Patent sequence entries, part 181.
1470. gbpat182.seq - Patent sequence entries, part 182.
1471. gbpat19.seq - Patent sequence entries, part 19.
1472. gbpat2.seq - Patent sequence entries, part 2.
1473. gbpat20.seq - Patent sequence entries, part 20.
1474. gbpat21.seq - Patent sequence entries, part 21.
1475. gbpat22.seq - Patent sequence entries, part 22.
1476. gbpat23.seq - Patent sequence entries, part 23.
1477. gbpat24.seq - Patent sequence entries, part 24.
1478. gbpat25.seq - Patent sequence entries, part 25.
1479. gbpat26.seq - Patent sequence entries, part 26.
1480. gbpat27.seq - Patent sequence entries, part 27.
1481. gbpat28.seq - Patent sequence entries, part 28.
1482. gbpat29.seq - Patent sequence entries, part 29.
1483. gbpat3.seq - Patent sequence entries, part 3.
1484. gbpat30.seq - Patent sequence entries, part 30.
1485. gbpat31.seq - Patent sequence entries, part 31.
1486. gbpat32.seq - Patent sequence entries, part 32.
1487. gbpat33.seq - Patent sequence entries, part 33.
1488. gbpat34.seq - Patent sequence entries, part 34.
1489. gbpat35.seq - Patent sequence entries, part 35.
1490. gbpat36.seq - Patent sequence entries, part 36.
1491. gbpat37.seq - Patent sequence entries, part 37.
1492. gbpat38.seq - Patent sequence entries, part 38.
1493. gbpat39.seq - Patent sequence entries, part 39.
1494. gbpat4.seq - Patent sequence entries, part 4.
1495. gbpat40.seq - Patent sequence entries, part 40.
1496. gbpat41.seq - Patent sequence entries, part 41.
1497. gbpat42.seq - Patent sequence entries, part 42.
1498. gbpat43.seq - Patent sequence entries, part 43.
1499. gbpat44.seq - Patent sequence entries, part 44.
1500. gbpat45.seq - Patent sequence entries, part 45.
1501. gbpat46.seq - Patent sequence entries, part 46.
1502. gbpat47.seq - Patent sequence entries, part 47.
1503. gbpat48.seq - Patent sequence entries, part 48.
1504. gbpat49.seq - Patent sequence entries, part 49.
1505. gbpat5.seq - Patent sequence entries, part 5.
1506. gbpat50.seq - Patent sequence entries, part 50.
1507. gbpat51.seq - Patent sequence entries, part 51.
1508. gbpat52.seq - Patent sequence entries, part 52.
1509. gbpat53.seq - Patent sequence entries, part 53.
1510. gbpat54.seq - Patent sequence entries, part 54.
1511. gbpat55.seq - Patent sequence entries, part 55.
1512. gbpat56.seq - Patent sequence entries, part 56.
1513. gbpat57.seq - Patent sequence entries, part 57.
1514. gbpat58.seq - Patent sequence entries, part 58.
1515. gbpat59.seq - Patent sequence entries, part 59.
1516. gbpat6.seq - Patent sequence entries, part 6.
1517. gbpat60.seq - Patent sequence entries, part 60.
1518. gbpat61.seq - Patent sequence entries, part 61.
1519. gbpat62.seq - Patent sequence entries, part 62.
1520. gbpat63.seq - Patent sequence entries, part 63.
1521. gbpat64.seq - Patent sequence entries, part 64.
1522. gbpat65.seq - Patent sequence entries, part 65.
1523. gbpat66.seq - Patent sequence entries, part 66.
1524. gbpat67.seq - Patent sequence entries, part 67.
1525. gbpat68.seq - Patent sequence entries, part 68.
1526. gbpat69.seq - Patent sequence entries, part 69.
1527. gbpat7.seq - Patent sequence entries, part 7.
1528. gbpat70.seq - Patent sequence entries, part 70.
1529. gbpat71.seq - Patent sequence entries, part 71.
1530. gbpat72.seq - Patent sequence entries, part 72.
1531. gbpat73.seq - Patent sequence entries, part 73.
1532. gbpat74.seq - Patent sequence entries, part 74.
1533. gbpat75.seq - Patent sequence entries, part 75.
1534. gbpat76.seq - Patent sequence entries, part 76.
1535. gbpat77.seq - Patent sequence entries, part 77.
1536. gbpat78.seq - Patent sequence entries, part 78.
1537. gbpat79.seq - Patent sequence entries, part 79.
1538. gbpat8.seq - Patent sequence entries, part 8.
1539. gbpat80.seq - Patent sequence entries, part 80.
1540. gbpat81.seq - Patent sequence entries, part 81.
1541. gbpat82.seq - Patent sequence entries, part 82.
1542. gbpat83.seq - Patent sequence entries, part 83.
1543. gbpat84.seq - Patent sequence entries, part 84.
1544. gbpat85.seq - Patent sequence entries, part 85.
1545. gbpat86.seq - Patent sequence entries, part 86.
1546. gbpat87.seq - Patent sequence entries, part 87.
1547. gbpat88.seq - Patent sequence entries, part 88.
1548. gbpat89.seq - Patent sequence entries, part 89.
1549. gbpat9.seq - Patent sequence entries, part 9.
1550. gbpat90.seq - Patent sequence entries, part 90.
1551. gbpat91.seq - Patent sequence entries, part 91.
1552. gbpat92.seq - Patent sequence entries, part 92.
1553. gbpat93.seq - Patent sequence entries, part 93.
1554. gbpat94.seq - Patent sequence entries, part 94.
1555. gbpat95.seq - Patent sequence entries, part 95.
1556. gbpat96.seq - Patent sequence entries, part 96.
1557. gbpat97.seq - Patent sequence entries, part 97.
1558. gbpat98.seq - Patent sequence entries, part 98.
1559. gbpat99.seq - Patent sequence entries, part 99.
1560. gbphg1.seq - Phage sequence entries, part 1.
1561. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1562. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1563. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1564. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1565. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1566. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1567. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1568. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1569. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1570. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1571. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1572. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1573. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1574. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1575. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1576. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1577. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1578. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1579. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1580. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1581. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1582. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1583. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1584. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1585. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1586. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1587. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1588. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1589. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1590. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1591. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1592. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1593. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1594. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1595. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1596. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1597. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1598. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1599. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1600. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1601. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1602. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1603. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1604. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1605. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1606. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1607. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1608. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1609. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
1610. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
1611. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
1612. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
1613. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
1614. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
1615. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
1616. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1617. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1618. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1619. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1620. gbpri1.seq - Primate sequence entries, part 1.
1621. gbpri10.seq - Primate sequence entries, part 10.
1622. gbpri11.seq - Primate sequence entries, part 11.
1623. gbpri12.seq - Primate sequence entries, part 12.
1624. gbpri13.seq - Primate sequence entries, part 13.
1625. gbpri14.seq - Primate sequence entries, part 14.
1626. gbpri15.seq - Primate sequence entries, part 15.
1627. gbpri16.seq - Primate sequence entries, part 16.
1628. gbpri17.seq - Primate sequence entries, part 17.
1629. gbpri18.seq - Primate sequence entries, part 18.
1630. gbpri19.seq - Primate sequence entries, part 19.
1631. gbpri2.seq - Primate sequence entries, part 2.
1632. gbpri20.seq - Primate sequence entries, part 20.
1633. gbpri21.seq - Primate sequence entries, part 21.
1634. gbpri22.seq - Primate sequence entries, part 22.
1635. gbpri23.seq - Primate sequence entries, part 23.
1636. gbpri24.seq - Primate sequence entries, part 24.
1637. gbpri25.seq - Primate sequence entries, part 25.
1638. gbpri26.seq - Primate sequence entries, part 26.
1639. gbpri27.seq - Primate sequence entries, part 27.
1640. gbpri28.seq - Primate sequence entries, part 28.
1641. gbpri29.seq - Primate sequence entries, part 29.
1642. gbpri3.seq - Primate sequence entries, part 3.
1643. gbpri30.seq - Primate sequence entries, part 30.
1644. gbpri31.seq - Primate sequence entries, part 31.
1645. gbpri32.seq - Primate sequence entries, part 32.
1646. gbpri33.seq - Primate sequence entries, part 33.
1647. gbpri34.seq - Primate sequence entries, part 34.
1648. gbpri35.seq - Primate sequence entries, part 35.
1649. gbpri36.seq - Primate sequence entries, part 36.
1650. gbpri37.seq - Primate sequence entries, part 37.
1651. gbpri38.seq - Primate sequence entries, part 38.
1652. gbpri39.seq - Primate sequence entries, part 39.
1653. gbpri4.seq - Primate sequence entries, part 4.
1654. gbpri40.seq - Primate sequence entries, part 40.
1655. gbpri41.seq - Primate sequence entries, part 41.
1656. gbpri42.seq - Primate sequence entries, part 42.
1657. gbpri43.seq - Primate sequence entries, part 43.
1658. gbpri44.seq - Primate sequence entries, part 44.
1659. gbpri45.seq - Primate sequence entries, part 45.
1660. gbpri5.seq - Primate sequence entries, part 5.
1661. gbpri6.seq - Primate sequence entries, part 6.
1662. gbpri7.seq - Primate sequence entries, part 7.
1663. gbpri8.seq - Primate sequence entries, part 8.
1664. gbpri9.seq - Primate sequence entries, part 9.
1665. gbrel.txt - Release notes (this document).
1666. gbrod1.seq - Rodent sequence entries, part 1.
1667. gbrod10.seq - Rodent sequence entries, part 10.
1668. gbrod11.seq - Rodent sequence entries, part 11.
1669. gbrod12.seq - Rodent sequence entries, part 12.
1670. gbrod13.seq - Rodent sequence entries, part 13.
1671. gbrod14.seq - Rodent sequence entries, part 14.
1672. gbrod15.seq - Rodent sequence entries, part 15.
1673. gbrod16.seq - Rodent sequence entries, part 16.
1674. gbrod17.seq - Rodent sequence entries, part 17.
1675. gbrod18.seq - Rodent sequence entries, part 18.
1676. gbrod19.seq - Rodent sequence entries, part 19.
1677. gbrod2.seq - Rodent sequence entries, part 2.
1678. gbrod20.seq - Rodent sequence entries, part 20.
1679. gbrod21.seq - Rodent sequence entries, part 21.
1680. gbrod22.seq - Rodent sequence entries, part 22.
1681. gbrod23.seq - Rodent sequence entries, part 23.
1682. gbrod24.seq - Rodent sequence entries, part 24.
1683. gbrod25.seq - Rodent sequence entries, part 25.
1684. gbrod26.seq - Rodent sequence entries, part 26.
1685. gbrod27.seq - Rodent sequence entries, part 27.
1686. gbrod28.seq - Rodent sequence entries, part 28.
1687. gbrod29.seq - Rodent sequence entries, part 29.
1688. gbrod3.seq - Rodent sequence entries, part 3.
1689. gbrod4.seq - Rodent sequence entries, part 4.
1690. gbrod5.seq - Rodent sequence entries, part 5.
1691. gbrod6.seq - Rodent sequence entries, part 6.
1692. gbrod7.seq - Rodent sequence entries, part 7.
1693. gbrod8.seq - Rodent sequence entries, part 8.
1694. gbrod9.seq - Rodent sequence entries, part 9.
1695. gbsdr1.txt - Short directory of the data bank, part 1.
1696. gbsdr2.txt - Short directory of the data bank, part 2.
1697. gbsdr3.txt - Short directory of the data bank, part 3.
1698. gbsec.idx - Index of the entries according to secondary accession number.
1699. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1700. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1701. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1702. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1703. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1704. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1705. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1706. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1707. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1708. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1709. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1710. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1711. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1712. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1713. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1714. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1715. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1716. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1717. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1718. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1719. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1720. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1721. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1722. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
1723. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
1724. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
1725. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
1726. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1727. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1728. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
1729. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
1730. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
1731. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
1732. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
1733. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
1734. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
1735. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
1736. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
1737. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
1738. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1739. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
1740. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
1741. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
1742. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1743. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1744. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1745. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1746. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1747. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1748. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1749. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1750. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1751. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1752. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1753. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1754. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1755. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1756. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1757. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1758. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1759. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1760. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1761. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1762. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1763. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
1764. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
1765. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
1766. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
1767. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
1768. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
1769. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
1770. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
1771. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
1772. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1773. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
1774. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
1775. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
1776. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
1777. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
1778. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
1779. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
1780. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
1781. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
1782. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
1783. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1784. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
1785. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
1786. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
1787. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
1788. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
1789. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
1790. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
1791. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
1792. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
1793. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
1794. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1795. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
1796. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
1797. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
1798. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
1799. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
1800. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
1801. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
1802. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
1803. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
1804. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
1805. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1806. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
1807. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
1808. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
1809. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
1810. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
1811. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
1812. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
1813. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
1814. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
1815. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
1816. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1817. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
1818. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
1819. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
1820. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
1821. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
1822. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
1823. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
1824. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
1825. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
1826. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
1827. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1828. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
1829. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
1830. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
1831. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
1832. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
1833. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
1834. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
1835. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
1836. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
1837. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
1838. gbuna1.seq - Unannotated sequence entries, part 1.
1839. gbvrl1.seq - Viral sequence entries, part 1.
1840. gbvrl10.seq - Viral sequence entries, part 10.
1841. gbvrl11.seq - Viral sequence entries, part 11.
1842. gbvrl12.seq - Viral sequence entries, part 12.
1843. gbvrl13.seq - Viral sequence entries, part 13.
1844. gbvrl14.seq - Viral sequence entries, part 14.
1845. gbvrl15.seq - Viral sequence entries, part 15.
1846. gbvrl16.seq - Viral sequence entries, part 16.
1847. gbvrl17.seq - Viral sequence entries, part 17.
1848. gbvrl18.seq - Viral sequence entries, part 18.
1849. gbvrl19.seq - Viral sequence entries, part 19.
1850. gbvrl2.seq - Viral sequence entries, part 2.
1851. gbvrl20.seq - Viral sequence entries, part 20.
1852. gbvrl21.seq - Viral sequence entries, part 21.
1853. gbvrl22.seq - Viral sequence entries, part 22.
1854. gbvrl3.seq - Viral sequence entries, part 3.
1855. gbvrl4.seq - Viral sequence entries, part 4.
1856. gbvrl5.seq - Viral sequence entries, part 5.
1857. gbvrl6.seq - Viral sequence entries, part 6.
1858. gbvrl7.seq - Viral sequence entries, part 7.
1859. gbvrl8.seq - Viral sequence entries, part 8.
1860. gbvrl9.seq - Viral sequence entries, part 9.
1861. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1862. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1863. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1864. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1865. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1866. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1867. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1868. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1869. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1870. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1871. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1872. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1873. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1874. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1875. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1876. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1877. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1878. gbvrt25.seq - Other vertebrate sequence entries, part 25.
1879. gbvrt26.seq - Other vertebrate sequence entries, part 26.
1880. gbvrt27.seq - Other vertebrate sequence entries, part 27.
1881. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1882. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1883. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1884. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1885. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1886. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1887. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 192.0 flatfiles require roughly 569 GB (sequence
files only) or 612 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
2158153412 gbacc1.idx
2428441455 gbacc2.idx
856488540 gbacc3.idx
184474968 gbaut1.idx
208135753 gbaut10.idx
188063851 gbaut100.idx
184029652 gbaut101.idx
150559856 gbaut102.idx
183840533 gbaut11.idx
183848465 gbaut12.idx
185521280 gbaut13.idx
185161452 gbaut14.idx
185811915 gbaut15.idx
183728801 gbaut16.idx
185523198 gbaut17.idx
183892543 gbaut18.idx
203130272 gbaut19.idx
186214579 gbaut2.idx
183860961 gbaut20.idx
210947514 gbaut21.idx
184329871 gbaut22.idx
188941042 gbaut23.idx
183988110 gbaut24.idx
231380781 gbaut25.idx
226666118 gbaut26.idx
185348524 gbaut27.idx
190445911 gbaut28.idx
183985303 gbaut29.idx
183925836 gbaut3.idx
185955858 gbaut30.idx
185748226 gbaut31.idx
186132819 gbaut32.idx
185102190 gbaut33.idx
185937893 gbaut34.idx
234950145 gbaut35.idx
186230003 gbaut36.idx
184154932 gbaut37.idx
249123533 gbaut38.idx
183860556 gbaut39.idx
249128354 gbaut4.idx
184897275 gbaut40.idx
184531958 gbaut41.idx
232307106 gbaut42.idx
186065969 gbaut43.idx
185036409 gbaut44.idx
183824968 gbaut45.idx
207845681 gbaut46.idx
184115481 gbaut47.idx
200712490 gbaut48.idx
184483317 gbaut49.idx
185432127 gbaut5.idx
241175721 gbaut50.idx
183949543 gbaut51.idx
184945483 gbaut52.idx
183974315 gbaut53.idx
200265275 gbaut54.idx
237260898 gbaut55.idx
184252088 gbaut56.idx
188605930 gbaut57.idx
192357568 gbaut58.idx
204643992 gbaut59.idx
183928854 gbaut6.idx
183983817 gbaut60.idx
186196513 gbaut61.idx
190496816 gbaut62.idx
184172484 gbaut63.idx
184016712 gbaut64.idx
185444189 gbaut65.idx
183888463 gbaut66.idx
183919623 gbaut67.idx
187540573 gbaut68.idx
185972130 gbaut69.idx
186444378 gbaut7.idx
243942676 gbaut70.idx
185546174 gbaut71.idx
185887959 gbaut72.idx
183934956 gbaut73.idx
183862606 gbaut74.idx
184818927 gbaut75.idx
188036411 gbaut76.idx
183993528 gbaut77.idx
183788962 gbaut78.idx
186729441 gbaut79.idx
188982192 gbaut8.idx
228275437 gbaut80.idx
238663113 gbaut81.idx
229145455 gbaut82.idx
185596050 gbaut83.idx
184150905 gbaut84.idx
184445240 gbaut85.idx
205055226 gbaut86.idx
184118783 gbaut87.idx
249127225 gbaut88.idx
203708120 gbaut89.idx
186390969 gbaut9.idx
254540273 gbaut90.idx
183776954 gbaut91.idx
193553866 gbaut92.idx
183787005 gbaut93.idx
224520132 gbaut94.idx
186724427 gbaut95.idx
183944044 gbaut96.idx
188551980 gbaut97.idx
200277477 gbaut98.idx
184475022 gbaut99.idx
249999624 gbbct1.seq
248280521 gbbct10.seq
239032202 gbbct11.seq
248802279 gbbct12.seq
241799686 gbbct13.seq
116677557 gbbct14.seq
243190533 gbbct15.seq
249804855 gbbct16.seq
245562628 gbbct17.seq
248629344 gbbct18.seq
248233024 gbbct19.seq
248325204 gbbct2.seq
249282329 gbbct20.seq
246199154 gbbct21.seq
245693892 gbbct22.seq
217807723 gbbct23.seq
242804091 gbbct24.seq
241841463 gbbct25.seq
248677810 gbbct26.seq
247876182 gbbct27.seq
249388745 gbbct28.seq
244186437 gbbct29.seq
249650688 gbbct3.seq
247337413 gbbct30.seq
249997167 gbbct31.seq
249762205 gbbct32.seq
249793033 gbbct33.seq
242886970 gbbct34.seq
241640310 gbbct35.seq
164818361 gbbct36.seq
243029950 gbbct37.seq
244324408 gbbct38.seq
249250072 gbbct39.seq
246076810 gbbct4.seq
247838739 gbbct40.seq
246706471 gbbct41.seq
241266210 gbbct42.seq
249895456 gbbct43.seq
248792349 gbbct44.seq
244000837 gbbct45.seq
240748007 gbbct46.seq
247072501 gbbct47.seq
231587023 gbbct48.seq
244577616 gbbct49.seq
213991242 gbbct5.seq
243720304 gbbct50.seq
248498818 gbbct51.seq
239599867 gbbct52.seq
248233100 gbbct53.seq
247217404 gbbct54.seq
244234276 gbbct55.seq
249995259 gbbct56.seq
247368653 gbbct57.seq
241879998 gbbct58.seq
249710660 gbbct59.seq
242142729 gbbct6.seq
247569363 gbbct60.seq
105371412 gbbct61.seq
244927103 gbbct62.seq
247458586 gbbct63.seq
249968335 gbbct64.seq
238494006 gbbct65.seq
242212870 gbbct66.seq
249205665 gbbct67.seq
247813953 gbbct68.seq
245494854 gbbct69.seq
244197887 gbbct7.seq
140424619 gbbct70.seq
6888487 gbbct71.seq
14098739 gbbct72.seq
23207138 gbbct73.seq
45105456 gbbct74.seq
87762103 gbbct75.seq
170239136 gbbct76.seq
249997571 gbbct77.seq
249997463 gbbct78.seq
244683130 gbbct79.seq
229394187 gbbct8.seq
239413252 gbbct80.seq
249223343 gbbct81.seq
247078279 gbbct82.seq
245388836 gbbct83.seq
249426975 gbbct84.seq
214538028 gbbct85.seq
248904593 gbbct86.seq
242251208 gbbct87.seq
249998898 gbbct88.seq
249999175 gbbct89.seq
245202010 gbbct9.seq
249998669 gbbct90.seq
241435138 gbbct91.seq
43260135 gbchg.txt
249995954 gbcon1.seq
249991455 gbcon10.seq
249999018 gbcon100.seq
249995506 gbcon101.seq
249999938 gbcon102.seq
249996196 gbcon103.seq
249994668 gbcon104.seq
158184767 gbcon105.seq
249997662 gbcon106.seq
249996981 gbcon107.seq
249998026 gbcon108.seq
249999534 gbcon109.seq
249306540 gbcon11.seq
73726548 gbcon110.seq
213431083 gbcon111.seq
249999151 gbcon112.seq
249998618 gbcon113.seq
249995107 gbcon114.seq
249967397 gbcon115.seq
109513271 gbcon116.seq
249993276 gbcon117.seq
249997920 gbcon118.seq
181287823 gbcon119.seq
248941383 gbcon12.seq
249997376 gbcon120.seq
249999771 gbcon121.seq
250000264 gbcon122.seq
222531140 gbcon123.seq
248957794 gbcon124.seq
249935631 gbcon125.seq
249448116 gbcon126.seq
249999890 gbcon127.seq
249998411 gbcon128.seq
249997860 gbcon129.seq
248692728 gbcon13.seq
34323471 gbcon130.seq
249971298 gbcon131.seq
249997710 gbcon132.seq
249994690 gbcon133.seq
249959868 gbcon134.seq
249943571 gbcon135.seq
249999699 gbcon136.seq
249977443 gbcon137.seq
234884818 gbcon138.seq
246632932 gbcon139.seq
249997302 gbcon14.seq
247186189 gbcon140.seq
249988778 gbcon141.seq
249615035 gbcon142.seq
127384172 gbcon143.seq
249999057 gbcon144.seq
249346175 gbcon145.seq
249996661 gbcon146.seq
250000027 gbcon147.seq
249998686 gbcon148.seq
249998568 gbcon149.seq
123634387 gbcon15.seq
248987090 gbcon150.seq
249998189 gbcon151.seq
207973486 gbcon152.seq
249999069 gbcon153.seq
249999113 gbcon154.seq
249963873 gbcon155.seq
249995192 gbcon156.seq
249997584 gbcon157.seq
249983971 gbcon158.seq
7238252 gbcon159.seq
249997357 gbcon16.seq
249999135 gbcon160.seq
249989415 gbcon161.seq
249998872 gbcon162.seq
249998551 gbcon163.seq
249999143 gbcon164.seq
249688881 gbcon165.seq
48206469 gbcon166.seq
249978313 gbcon167.seq
249768223 gbcon168.seq
249994385 gbcon169.seq
249910208 gbcon17.seq
249886572 gbcon170.seq
249829144 gbcon171.seq
249999895 gbcon172.seq
249626214 gbcon173.seq
249551595 gbcon174.seq
189010973 gbcon175.seq
18870823 gbcon176.seq
249998920 gbcon18.seq
240711310 gbcon19.seq
249313215 gbcon2.seq
249994640 gbcon20.seq
249193119 gbcon21.seq
117444305 gbcon22.seq
249998736 gbcon23.seq
119794062 gbcon24.seq
249993709 gbcon25.seq
249727153 gbcon26.seq
249999220 gbcon27.seq
249996705 gbcon28.seq
192075300 gbcon29.seq
249817269 gbcon3.seq
249998917 gbcon30.seq
249996531 gbcon31.seq
249997326 gbcon32.seq
249998915 gbcon33.seq
249951770 gbcon34.seq
238918179 gbcon35.seq
249997270 gbcon36.seq
249999221 gbcon37.seq
249994732 gbcon38.seq
249996897 gbcon39.seq
249994704 gbcon4.seq
249997078 gbcon40.seq
249997414 gbcon41.seq
63412389 gbcon42.seq
249995423 gbcon43.seq
249997315 gbcon44.seq
249997250 gbcon45.seq
249997590 gbcon46.seq
249996159 gbcon47.seq
44928861 gbcon48.seq
249994872 gbcon49.seq
249999657 gbcon5.seq
249995799 gbcon50.seq
249997684 gbcon51.seq
249996690 gbcon52.seq
249997782 gbcon53.seq
38241897 gbcon54.seq
249998302 gbcon55.seq
249999150 gbcon56.seq
249998346 gbcon57.seq
249994564 gbcon58.seq
249999492 gbcon59.seq
249994057 gbcon6.seq
154672375 gbcon60.seq
249999016 gbcon61.seq
249996777 gbcon62.seq
249999159 gbcon63.seq
249995190 gbcon64.seq
185611272 gbcon65.seq
249996810 gbcon66.seq
249998700 gbcon67.seq
249997155 gbcon68.seq
249997874 gbcon69.seq
93508945 gbcon7.seq
247616447 gbcon70.seq
249998269 gbcon71.seq
249995941 gbcon72.seq
249998068 gbcon73.seq
249999277 gbcon74.seq
249999797 gbcon75.seq
98773033 gbcon76.seq
249997150 gbcon77.seq
249997442 gbcon78.seq
249995516 gbcon79.seq
249993190 gbcon8.seq
249996111 gbcon80.seq
249995971 gbcon81.seq
64633499 gbcon82.seq
249998451 gbcon83.seq
249995859 gbcon84.seq
249994386 gbcon85.seq
249994858 gbcon86.seq
249998199 gbcon87.seq
23638323 gbcon88.seq
249997115 gbcon89.seq
249995121 gbcon9.seq
249995538 gbcon90.seq
249998987 gbcon91.seq
249999150 gbcon92.seq
199759401 gbcon93.seq
249994089 gbcon94.seq
249998565 gbcon95.seq
249998526 gbcon96.seq
249996032 gbcon97.seq
249999284 gbcon98.seq
135141018 gbcon99.seq
169333 gbdel.txt
249998621 gbenv1.seq
249999504 gbenv10.seq
249998812 gbenv11.seq
57820273 gbenv12.seq
249999721 gbenv13.seq
250000048 gbenv14.seq
249999966 gbenv15.seq
249998902 gbenv16.seq
249999480 gbenv17.seq
249999231 gbenv18.seq
249999882 gbenv19.seq
249998001 gbenv2.seq
219990946 gbenv20.seq
249998731 gbenv21.seq
249998100 gbenv22.seq
250000039 gbenv23.seq
250000140 gbenv24.seq
156931318 gbenv25.seq
249999462 gbenv26.seq
249962164 gbenv27.seq
249998406 gbenv28.seq
250000170 gbenv29.seq
249998967 gbenv3.seq
249998776 gbenv30.seq
189417653 gbenv31.seq
249999624 gbenv32.seq
249999140 gbenv33.seq
249998746 gbenv34.seq
249997495 gbenv35.seq
187121159 gbenv36.seq
249998676 gbenv37.seq
250000091 gbenv38.seq
249999940 gbenv39.seq
249999591 gbenv4.seq
249999714 gbenv40.seq
250000256 gbenv41.seq
249997771 gbenv42.seq
44579982 gbenv43.seq
249999550 gbenv44.seq
250000151 gbenv45.seq
250000026 gbenv46.seq
250000054 gbenv47.seq
174976810 gbenv48.seq
249999929 gbenv49.seq
249998789 gbenv5.seq
249997148 gbenv50.seq
249999121 gbenv51.seq
249996956 gbenv52.seq
249998354 gbenv53.seq
249999189 gbenv54.seq
250000073 gbenv55.seq
249999646 gbenv56.seq
96747647 gbenv57.seq
249998641 gbenv6.seq
5839916 gbenv7.seq
250000239 gbenv8.seq
249998259 gbenv9.seq
524291258 gbest1.seq
524291691 gbest10.seq
524289503 gbest100.seq
524289117 gbest101.seq
524291228 gbest102.seq
524291374 gbest103.seq
360471688 gbest104.seq
524289437 gbest105.seq
524290220 gbest106.seq
524292310 gbest107.seq
385868816 gbest108.seq
389646281 gbest109.seq
524291350 gbest11.seq
383426451 gbest110.seq
384181241 gbest111.seq
381049581 gbest112.seq
385314556 gbest113.seq
390041318 gbest114.seq
388174760 gbest115.seq
387304186 gbest116.seq
383870701 gbest117.seq
407529928 gbest118.seq
510895029 gbest119.seq
524289338 gbest12.seq
524290409 gbest120.seq
524290409 gbest121.seq
524291635 gbest122.seq
524290760 gbest123.seq
430296883 gbest124.seq
524290214 gbest125.seq
524292129 gbest126.seq
524289327 gbest127.seq
524290282 gbest128.seq
524290485 gbest129.seq
157978590 gbest13.seq
524289905 gbest130.seq
524290610 gbest131.seq
524290311 gbest132.seq
524289180 gbest133.seq
524289362 gbest134.seq
524289277 gbest135.seq
524291308 gbest136.seq
301917696 gbest137.seq
524289110 gbest138.seq
524289125 gbest139.seq
524289168 gbest14.seq
524289652 gbest140.seq
524290303 gbest141.seq
524288876 gbest142.seq
524291296 gbest143.seq
524289582 gbest144.seq
524290691 gbest145.seq
524292250 gbest146.seq
524293002 gbest147.seq
524289863 gbest148.seq
524289916 gbest149.seq
524291852 gbest15.seq
524290234 gbest150.seq
466136395 gbest151.seq
524290637 gbest152.seq
524290049 gbest153.seq
524289751 gbest154.seq
524290081 gbest155.seq
524289496 gbest156.seq
524289101 gbest157.seq
524290566 gbest158.seq
524289067 gbest159.seq
524289721 gbest16.seq
524291896 gbest160.seq
524290490 gbest161.seq
524290362 gbest162.seq
524288742 gbest163.seq
247708380 gbest164.seq
524291244 gbest165.seq
524290849 gbest166.seq
524288956 gbest167.seq
524289464 gbest168.seq
524290707 gbest169.seq
524291705 gbest17.seq
524289659 gbest170.seq
524289128 gbest171.seq
524292317 gbest172.seq
524292018 gbest173.seq
524288946 gbest174.seq
524290108 gbest175.seq
524290497 gbest176.seq
524290132 gbest177.seq
114354791 gbest178.seq
524291246 gbest179.seq
524289860 gbest18.seq
524289996 gbest180.seq
524289993 gbest181.seq
524289366 gbest182.seq
524290597 gbest183.seq
524290967 gbest184.seq
524291027 gbest185.seq
524288904 gbest186.seq
524289129 gbest187.seq
524291035 gbest188.seq
524289994 gbest189.seq
524290656 gbest19.seq
524290380 gbest190.seq
474304889 gbest191.seq
524290694 gbest192.seq
524290357 gbest193.seq
524293686 gbest194.seq
524290732 gbest195.seq
524292521 gbest196.seq
524291296 gbest197.seq
524290645 gbest198.seq
524290580 gbest199.seq
524290885 gbest2.seq
524290428 gbest20.seq
524291113 gbest200.seq
524290749 gbest201.seq
524290408 gbest202.seq
524290502 gbest203.seq
524290132 gbest204.seq
78639770 gbest205.seq
524290755 gbest206.seq
524289337 gbest207.seq
524290952 gbest208.seq
524290571 gbest209.seq
524291732 gbest21.seq
524292169 gbest210.seq
524290898 gbest211.seq
524291221 gbest212.seq
524290445 gbest213.seq
524290225 gbest214.seq
524289671 gbest215.seq
425469521 gbest216.seq
524290450 gbest217.seq
524289935 gbest218.seq
524289416 gbest219.seq
512263225 gbest22.seq
524290998 gbest220.seq
524293167 gbest221.seq
524295305 gbest222.seq
524290097 gbest223.seq
524290750 gbest224.seq
524290664 gbest225.seq
524292706 gbest226.seq
524288904 gbest227.seq
524289267 gbest228.seq
524291223 gbest229.seq
500300273 gbest23.seq
350888376 gbest230.seq
524290657 gbest231.seq
524292710 gbest232.seq
524289947 gbest233.seq
524290255 gbest234.seq
524289598 gbest235.seq
524290936 gbest236.seq
524292578 gbest237.seq
524290775 gbest238.seq
524290983 gbest239.seq
509293873 gbest24.seq
524291397 gbest240.seq
524289862 gbest241.seq
524291281 gbest242.seq
524289654 gbest243.seq
524289574 gbest244.seq
33276964 gbest245.seq
524290085 gbest246.seq
524289242 gbest247.seq
524292264 gbest248.seq
524290431 gbest249.seq
320478099 gbest25.seq
524288761 gbest250.seq
524289276 gbest251.seq
524291097 gbest252.seq
524290422 gbest253.seq
524291422 gbest254.seq
524290016 gbest255.seq
524289441 gbest256.seq
270612611 gbest257.seq
524291119 gbest258.seq
524291376 gbest259.seq
524290814 gbest26.seq
524288728 gbest260.seq
524290388 gbest261.seq
524289079 gbest262.seq
524291657 gbest263.seq
524290862 gbest264.seq
524290295 gbest265.seq
524290785 gbest266.seq
524290959 gbest267.seq
300575461 gbest268.seq
524289522 gbest269.seq
524290138 gbest27.seq
524291313 gbest270.seq
524290049 gbest271.seq
524289255 gbest272.seq
524289986 gbest273.seq
524291082 gbest274.seq
524290277 gbest275.seq
524290563 gbest276.seq
524291310 gbest277.seq
524290631 gbest278.seq
524288899 gbest279.seq
524289347 gbest28.seq
312560110 gbest280.seq
524291839 gbest281.seq
524289055 gbest282.seq
524292148 gbest283.seq
524290111 gbest284.seq
524288964 gbest285.seq
524292385 gbest286.seq
524291050 gbest287.seq
524289240 gbest288.seq
524291301 gbest289.seq
524288943 gbest29.seq
524290056 gbest290.seq
524290910 gbest291.seq
223360005 gbest292.seq
524291235 gbest293.seq
524289648 gbest294.seq
524289373 gbest295.seq
524288942 gbest296.seq
524290640 gbest297.seq
524290143 gbest298.seq
524289501 gbest299.seq
497614745 gbest3.seq
524289053 gbest30.seq
524290303 gbest300.seq
477206485 gbest301.seq
484971571 gbest302.seq
487584675 gbest303.seq
328812311 gbest304.seq
524290958 gbest305.seq
524288791 gbest306.seq
524292598 gbest307.seq
524290432 gbest308.seq
524289670 gbest309.seq
524292328 gbest31.seq
524290779 gbest310.seq
524291042 gbest311.seq
524290831 gbest312.seq
524291252 gbest313.seq
524291277 gbest314.seq
524290668 gbest315.seq
524289468 gbest316.seq
506309099 gbest317.seq
524289787 gbest318.seq
524289856 gbest319.seq
524289518 gbest32.seq
524291127 gbest320.seq
524291613 gbest321.seq
524289858 gbest322.seq
524289349 gbest323.seq
524291534 gbest324.seq
524289176 gbest325.seq
524290844 gbest326.seq
524289717 gbest327.seq
524291748 gbest328.seq
524289085 gbest329.seq
524289648 gbest33.seq
524290996 gbest330.seq
253443789 gbest331.seq
524290152 gbest332.seq
524288762 gbest333.seq
524290880 gbest334.seq
524292549 gbest335.seq
500875525 gbest336.seq
524290163 gbest337.seq
524289204 gbest338.seq
524290564 gbest339.seq
520110839 gbest34.seq
524288980 gbest340.seq
524290308 gbest341.seq
524289350 gbest342.seq
524289250 gbest343.seq
524291662 gbest344.seq
350307450 gbest345.seq
524291963 gbest346.seq
524291687 gbest347.seq
524291171 gbest348.seq
524290448 gbest349.seq
492754682 gbest35.seq
524290028 gbest350.seq
524289679 gbest351.seq
524289449 gbest352.seq
524294144 gbest353.seq
524288776 gbest354.seq
524291148 gbest355.seq
524289803 gbest356.seq
524288730 gbest357.seq
524289638 gbest358.seq
524289745 gbest359.seq
494458317 gbest36.seq
36620324 gbest360.seq
524289139 gbest361.seq
524289559 gbest362.seq
524292302 gbest363.seq
524292586 gbest364.seq
524292386 gbest365.seq
524290831 gbest366.seq
524289607 gbest367.seq
524289597 gbest368.seq
524291596 gbest369.seq
493331750 gbest37.seq
524291332 gbest370.seq
396132081 gbest371.seq
524291344 gbest372.seq
524289188 gbest373.seq
524288884 gbest374.seq
524290974 gbest375.seq
524290913 gbest376.seq
524288994 gbest377.seq
524291135 gbest378.seq
524290319 gbest379.seq
487995788 gbest38.seq
524291807 gbest380.seq
524289778 gbest381.seq
524289691 gbest382.seq
347543594 gbest383.seq
524289836 gbest384.seq
524288942 gbest385.seq
524289703 gbest386.seq
524288815 gbest387.seq
524289640 gbest388.seq
524290039 gbest389.seq
493160350 gbest39.seq
524290924 gbest390.seq
524290044 gbest391.seq
524289777 gbest392.seq
524290147 gbest393.seq
518637064 gbest394.seq
524290864 gbest395.seq
524288727 gbest396.seq
524291023 gbest397.seq
524289815 gbest398.seq
524289176 gbest399.seq
524289662 gbest4.seq
113006982 gbest40.seq
524290803 gbest400.seq
524291693 gbest401.seq
524288859 gbest402.seq
524290504 gbest403.seq
524289525 gbest404.seq
524292123 gbest405.seq
524292202 gbest406.seq
516867127 gbest407.seq
524292010 gbest408.seq
524289643 gbest409.seq
524289451 gbest41.seq
524290147 gbest410.seq
524291021 gbest411.seq
524290393 gbest412.seq
524289100 gbest413.seq
524292064 gbest414.seq
524290835 gbest415.seq
524290786 gbest416.seq
524289290 gbest417.seq
524290598 gbest418.seq
524291804 gbest419.seq
524289716 gbest42.seq
524291193 gbest420.seq
8454818 gbest421.seq
524289305 gbest422.seq
524288893 gbest423.seq
524288963 gbest424.seq
524294696 gbest425.seq
524294113 gbest426.seq
524288904 gbest427.seq
524294280 gbest428.seq
524290679 gbest429.seq
524289690 gbest43.seq
524291765 gbest430.seq
524289092 gbest431.seq
524291051 gbest432.seq
524290821 gbest433.seq
524290512 gbest434.seq
524290616 gbest435.seq
71428037 gbest436.seq
524291327 gbest437.seq
524289147 gbest438.seq
524291737 gbest439.seq
524290558 gbest44.seq
524292770 gbest440.seq
524292586 gbest441.seq
524289675 gbest442.seq
524291091 gbest443.seq
524289373 gbest444.seq
524290373 gbest445.seq
524291172 gbest446.seq
524289281 gbest447.seq
483530943 gbest448.seq
524290373 gbest449.seq
524289608 gbest45.seq
524290784 gbest450.seq
524288877 gbest451.seq
524289901 gbest452.seq
524289561 gbest453.seq
524289247 gbest454.seq
524291281 gbest455.seq
524290041 gbest456.seq
524290964 gbest457.seq
524289882 gbest458.seq
524289504 gbest459.seq
524290059 gbest46.seq
184026538 gbest460.seq
524290764 gbest461.seq
524291173 gbest462.seq
524290968 gbest463.seq
524291479 gbest464.seq
524289122 gbest465.seq
494355812 gbest466.seq
524289815 gbest47.seq
524290832 gbest48.seq
524291441 gbest49.seq
524290143 gbest5.seq
524289193 gbest50.seq
524289821 gbest51.seq
524288853 gbest52.seq
524291027 gbest53.seq
254282266 gbest54.seq
524290547 gbest55.seq
524291109 gbest56.seq
524291881 gbest57.seq
524290833 gbest58.seq
524289115 gbest59.seq
524289793 gbest6.seq
524290338 gbest60.seq
524291844 gbest61.seq
524289934 gbest62.seq
524291536 gbest63.seq
524289349 gbest64.seq
524291219 gbest65.seq
524289000 gbest66.seq
464571013 gbest67.seq
524289181 gbest68.seq
524291163 gbest69.seq
524288922 gbest7.seq
524290146 gbest70.seq
524289125 gbest71.seq
524290974 gbest72.seq
524291712 gbest73.seq
524290850 gbest74.seq
524293204 gbest75.seq
524291139 gbest76.seq
524291183 gbest77.seq
524290774 gbest78.seq
524290311 gbest79.seq
524290619 gbest8.seq
192290980 gbest80.seq
524290727 gbest81.seq
524290780 gbest82.seq
524290243 gbest83.seq
524291050 gbest84.seq
524290568 gbest85.seq
524291024 gbest86.seq
524290755 gbest87.seq
524289152 gbest88.seq
524288950 gbest89.seq
524293073 gbest9.seq
524290685 gbest90.seq
524290958 gbest91.seq
463227010 gbest92.seq
524292178 gbest93.seq
524291563 gbest94.seq
524291967 gbest95.seq
524289003 gbest96.seq
524292050 gbest97.seq
524291981 gbest98.seq
524288752 gbest99.seq
197420238 gbgen.idx
524291268 gbgss1.seq
524289844 gbgss10.seq
524292593 gbgss100.seq
524289703 gbgss101.seq
524291138 gbgss102.seq
524288836 gbgss103.seq
418618384 gbgss104.seq
524289981 gbgss105.seq
524289409 gbgss106.seq
524289590 gbgss107.seq
524289562 gbgss108.seq
524290609 gbgss109.seq
524291170 gbgss11.seq
524290191 gbgss110.seq
524288873 gbgss111.seq
524290006 gbgss112.seq
524290845 gbgss113.seq
524290117 gbgss114.seq
524291178 gbgss115.seq
56015061 gbgss116.seq
524291185 gbgss117.seq
524291250 gbgss118.seq
524288915 gbgss119.seq
524291525 gbgss12.seq
524289908 gbgss120.seq
524288793 gbgss121.seq
524289578 gbgss122.seq
524288786 gbgss123.seq
524291168 gbgss124.seq
524290926 gbgss125.seq
524289929 gbgss126.seq
524289589 gbgss127.seq
524291592 gbgss128.seq
205528272 gbgss129.seq
524290301 gbgss13.seq
524288727 gbgss130.seq
524291361 gbgss131.seq
524289314 gbgss132.seq
524290882 gbgss133.seq
524290446 gbgss134.seq
524289077 gbgss135.seq
524288773 gbgss136.seq
524289512 gbgss137.seq
524290859 gbgss138.seq
517497172 gbgss139.seq
524290538 gbgss14.seq
516021215 gbgss140.seq
157659078 gbgss141.seq
524289602 gbgss142.seq
524289547 gbgss143.seq
524290849 gbgss144.seq
524291267 gbgss145.seq
524290484 gbgss146.seq
524290520 gbgss147.seq
524291547 gbgss148.seq
524289741 gbgss149.seq
524290893 gbgss15.seq
524288989 gbgss150.seq
524290826 gbgss151.seq
325872631 gbgss152.seq
524289115 gbgss153.seq
396548736 gbgss154.seq
249998130 gbgss155.seq
249997341 gbgss156.seq
249997848 gbgss157.seq
249997631 gbgss158.seq
29198811 gbgss159.seq
524291189 gbgss16.seq
249997137 gbgss160.seq
250000033 gbgss161.seq
249998542 gbgss162.seq
249998333 gbgss163.seq
224919493 gbgss164.seq
249998415 gbgss165.seq
249998761 gbgss166.seq
249999722 gbgss167.seq
249998684 gbgss168.seq
191344183 gbgss169.seq
524289284 gbgss17.seq
249997564 gbgss170.seq
249996752 gbgss171.seq
249999513 gbgss172.seq
249997874 gbgss173.seq
249999326 gbgss174.seq
77035229 gbgss175.seq
249999158 gbgss176.seq
2090297 gbgss177.seq
79542394 gbgss178.seq
249998428 gbgss179.seq
524290445 gbgss18.seq
249999593 gbgss180.seq
87205952 gbgss181.seq
249999685 gbgss182.seq
249998355 gbgss183.seq
249998984 gbgss184.seq
202702168 gbgss185.seq
249999232 gbgss186.seq
249998752 gbgss187.seq
250000079 gbgss188.seq
246010499 gbgss189.seq
315738815 gbgss19.seq
249997836 gbgss190.seq
249998110 gbgss191.seq
249999870 gbgss192.seq
243311140 gbgss193.seq
249999336 gbgss194.seq
249999577 gbgss195.seq
250000236 gbgss196.seq
249997665 gbgss197.seq
123207544 gbgss198.seq
249998013 gbgss199.seq
524291236 gbgss2.seq
524289657 gbgss20.seq
249999792 gbgss200.seq
249998459 gbgss201.seq
249998343 gbgss202.seq
95905540 gbgss203.seq
249999742 gbgss204.seq
249999443 gbgss205.seq
249998384 gbgss206.seq
249999963 gbgss207.seq
183118490 gbgss208.seq
249999236 gbgss209.seq
524288871 gbgss21.seq
249997993 gbgss210.seq
249998006 gbgss211.seq
249999353 gbgss212.seq
95926739 gbgss213.seq
249999461 gbgss214.seq
249999350 gbgss215.seq
249998406 gbgss216.seq
249998619 gbgss217.seq
249999398 gbgss218.seq
249998401 gbgss219.seq
524290551 gbgss22.seq
99057250 gbgss220.seq
249999424 gbgss221.seq
249999963 gbgss222.seq
249997369 gbgss223.seq
43648880 gbgss224.seq
52925443 gbgss225.seq
249997818 gbgss226.seq
249998543 gbgss227.seq
249997629 gbgss228.seq
249998343 gbgss229.seq
524289209 gbgss23.seq
32070531 gbgss230.seq
249997670 gbgss231.seq
249997588 gbgss232.seq
249999018 gbgss233.seq
250000000 gbgss234.seq
28042636 gbgss235.seq
249997661 gbgss236.seq
250000032 gbgss237.seq
249998827 gbgss238.seq
249999616 gbgss239.seq
524290237 gbgss24.seq
249999456 gbgss240.seq
249997806 gbgss241.seq
180456815 gbgss242.seq
249999812 gbgss243.seq
249998926 gbgss244.seq
249999095 gbgss245.seq
220154622 gbgss246.seq
250000034 gbgss247.seq
249997956 gbgss248.seq
250000074 gbgss249.seq
524289518 gbgss25.seq
249999182 gbgss250.seq
249999521 gbgss251.seq
249999273 gbgss252.seq
249999982 gbgss253.seq
141286832 gbgss254.seq
249999562 gbgss255.seq
249998752 gbgss256.seq
249999600 gbgss257.seq
249999029 gbgss258.seq
249999913 gbgss259.seq
524289126 gbgss26.seq
31601752 gbgss260.seq
524291882 gbgss27.seq
524289238 gbgss28.seq
524290063 gbgss29.seq
524291209 gbgss3.seq
524291675 gbgss30.seq
39710031 gbgss31.seq
524289648 gbgss32.seq
524290113 gbgss33.seq
524289714 gbgss34.seq
524289477 gbgss35.seq
524289253 gbgss36.seq
524289803 gbgss37.seq
524290304 gbgss38.seq
509235276 gbgss39.seq
524291248 gbgss4.seq
524291637 gbgss40.seq
524290032 gbgss41.seq
524290785 gbgss42.seq
27290698 gbgss43.seq
524288946 gbgss44.seq
524288881 gbgss45.seq
524289248 gbgss46.seq
524288900 gbgss47.seq
223531204 gbgss48.seq
524290426 gbgss49.seq
168382749 gbgss5.seq
524289735 gbgss50.seq
524291269 gbgss51.seq
524290992 gbgss52.seq
524290041 gbgss53.seq
524288997 gbgss54.seq
524292017 gbgss55.seq
524290771 gbgss56.seq
524290630 gbgss57.seq
524289617 gbgss58.seq
524288925 gbgss59.seq
524290951 gbgss6.seq
36635990 gbgss60.seq
524291629 gbgss61.seq
524290608 gbgss62.seq
524291618 gbgss63.seq
461765495 gbgss64.seq
524290190 gbgss65.seq
524290828 gbgss66.seq
524290508 gbgss67.seq
524290868 gbgss68.seq
524289498 gbgss69.seq
524288796 gbgss7.seq
524288938 gbgss70.seq
524290467 gbgss71.seq
524288729 gbgss72.seq
524290924 gbgss73.seq
524289241 gbgss74.seq
524290569 gbgss75.seq
524289070 gbgss76.seq
49646918 gbgss77.seq
524291014 gbgss78.seq
524289021 gbgss79.seq
524291665 gbgss8.seq
524290279 gbgss80.seq
524290660 gbgss81.seq
524291034 gbgss82.seq
524290373 gbgss83.seq
524289673 gbgss84.seq
524289427 gbgss85.seq
524291776 gbgss86.seq
524289284 gbgss87.seq
524289797 gbgss88.seq
390928760 gbgss89.seq
524290499 gbgss9.seq
524292172 gbgss90.seq
524291677 gbgss91.seq
524291807 gbgss92.seq
524292003 gbgss93.seq
524289134 gbgss94.seq
524289592 gbgss95.seq
524289866 gbgss96.seq
524291875 gbgss97.seq
524291048 gbgss98.seq
524291620 gbgss99.seq
250000034 gbhtc1.seq
249998647 gbhtc10.seq
249997533 gbhtc11.seq
33336954 gbhtc12.seq
249997337 gbhtc13.seq
249997513 gbhtc14.seq
66501472 gbhtc15.seq
249992681 gbhtc2.seq
249996913 gbhtc3.seq
249991889 gbhtc4.seq
249985674 gbhtc5.seq
249997743 gbhtc6.seq
249996123 gbhtc7.seq
84096736 gbhtc8.seq
249996193 gbhtc9.seq
249907861 gbhtg1.seq
249801162 gbhtg10.seq
249917504 gbhtg100.seq
249844960 gbhtg101.seq
249902534 gbhtg102.seq
249987237 gbhtg103.seq
5671243 gbhtg104.seq
249937699 gbhtg105.seq
249890707 gbhtg106.seq
249627730 gbhtg107.seq
249784108 gbhtg108.seq
249918357 gbhtg109.seq
1643239 gbhtg11.seq
249872422 gbhtg110.seq
179990578 gbhtg111.seq
249886747 gbhtg112.seq
249853982 gbhtg113.seq
249945826 gbhtg114.seq
249865680 gbhtg115.seq
249873643 gbhtg116.seq
249764940 gbhtg117.seq
249985854 gbhtg118.seq
115386031 gbhtg119.seq
249888438 gbhtg12.seq
249867328 gbhtg120.seq
249979076 gbhtg121.seq
249891974 gbhtg122.seq
249811641 gbhtg123.seq
249909936 gbhtg124.seq
32001278 gbhtg125.seq
249935899 gbhtg126.seq
249834856 gbhtg127.seq
249925989 gbhtg128.seq
249893130 gbhtg129.seq
249970556 gbhtg13.seq
249991866 gbhtg130.seq
135260137 gbhtg131.seq
249837708 gbhtg132.seq
249847144 gbhtg133.seq
249810959 gbhtg134.seq
249845531 gbhtg135.seq
249823951 gbhtg136.seq
249763586 gbhtg137.seq
249983283 gbhtg138.seq
249909427 gbhtg139.seq
249587437 gbhtg14.seq
249823121 gbhtg140.seq
77645919 gbhtg141.seq
249775919 gbhtg15.seq
249742391 gbhtg16.seq
249169910 gbhtg17.seq
249983662 gbhtg18.seq
249677588 gbhtg19.seq
249988506 gbhtg2.seq
249988774 gbhtg20.seq
237145184 gbhtg21.seq
249760635 gbhtg22.seq
249868408 gbhtg23.seq
249987789 gbhtg24.seq
249921752 gbhtg25.seq
249761262 gbhtg26.seq
249891641 gbhtg27.seq
249961480 gbhtg28.seq
249842167 gbhtg29.seq
249988698 gbhtg3.seq
249992987 gbhtg30.seq
225324756 gbhtg31.seq
249827828 gbhtg32.seq
249920778 gbhtg33.seq
249929470 gbhtg34.seq
249919058 gbhtg35.seq
249858216 gbhtg36.seq
249814780 gbhtg37.seq
249767485 gbhtg38.seq
249627604 gbhtg39.seq
249766042 gbhtg4.seq
249839726 gbhtg40.seq
224363181 gbhtg41.seq
249889409 gbhtg42.seq
249786859 gbhtg43.seq
249974474 gbhtg44.seq
249775813 gbhtg45.seq
249912495 gbhtg46.seq
249597904 gbhtg47.seq
249994359 gbhtg48.seq
249827714 gbhtg49.seq
249989014 gbhtg5.seq
249877445 gbhtg50.seq
234821586 gbhtg51.seq
249732630 gbhtg52.seq
249917798 gbhtg53.seq
249773220 gbhtg54.seq
249971346 gbhtg55.seq
249962503 gbhtg56.seq
18795866 gbhtg57.seq
249861298 gbhtg58.seq
249823559 gbhtg59.seq
249770427 gbhtg6.seq
249990589 gbhtg60.seq
249921231 gbhtg61.seq
225131050 gbhtg62.seq
249853671 gbhtg63.seq
249787654 gbhtg64.seq
249883726 gbhtg65.seq
249980288 gbhtg66.seq
249833261 gbhtg67.seq
16614633 gbhtg68.seq
249960711 gbhtg69.seq
249852195 gbhtg7.seq
249973591 gbhtg70.seq
249953795 gbhtg71.seq
249976849 gbhtg72.seq
224833550 gbhtg73.seq
249811083 gbhtg74.seq
249874989 gbhtg75.seq
249800276 gbhtg76.seq
249959811 gbhtg77.seq
244236597 gbhtg78.seq
249884075 gbhtg79.seq
249758873 gbhtg8.seq
249989775 gbhtg80.seq
249840148 gbhtg81.seq
249838461 gbhtg82.seq
216751404 gbhtg83.seq
249966974 gbhtg84.seq
249803238 gbhtg85.seq
249757896 gbhtg86.seq
249849119 gbhtg87.seq
220831501 gbhtg88.seq
249970341 gbhtg89.seq
249968894 gbhtg9.seq
249954491 gbhtg90.seq
249999471 gbhtg91.seq
249963741 gbhtg92.seq
208664273 gbhtg93.seq
249870418 gbhtg94.seq
249944588 gbhtg95.seq
249904036 gbhtg96.seq
249769960 gbhtg97.seq
167889800 gbhtg98.seq
249744704 gbhtg99.seq
249998798 gbinv1.seq
249998992 gbinv10.seq
249998207 gbinv11.seq
181284762 gbinv12.seq
249999219 gbinv13.seq
249999822 gbinv14.seq
249998845 gbinv15.seq
159788224 gbinv16.seq
249999177 gbinv17.seq
249039050 gbinv18.seq
249999814 gbinv19.seq
249889604 gbinv2.seq
249997738 gbinv20.seq
249999813 gbinv21.seq
11152155 gbinv22.seq
223881343 gbinv23.seq
175506967 gbinv24.seq
249997752 gbinv25.seq
249999385 gbinv26.seq
102974106 gbinv27.seq
249998201 gbinv28.seq
249998374 gbinv29.seq
236722945 gbinv3.seq
249999009 gbinv30.seq
250000151 gbinv31.seq
249891017 gbinv32.seq
2787477 gbinv33.seq
249995918 gbinv4.seq
249996906 gbinv5.seq
249756501 gbinv6.seq
249995710 gbinv7.seq
41769127 gbinv8.seq
249997977 gbinv9.seq
139340358 gbjou1.idx
305252873 gbjou10.idx
297041333 gbjou11.idx
261826286 gbjou12.idx
220573172 gbjou13.idx
22960429 gbjou14.idx
139418432 gbjou2.idx
163354303 gbjou3.idx
142011534 gbjou4.idx
234836634 gbjou5.idx
289358240 gbjou6.idx
257092152 gbjou7.idx
280732009 gbjou8.idx
293173698 gbjou9.idx
354192523 gbkey1.idx
180097208 gbkey2.idx
179384371 gbkey3.idx
264748200 gbkey4.idx
210011455 gbkey5.idx
183456832 gbkey6.idx
122138122 gbkey7.idx
249863023 gbmam1.seq
249963061 gbmam2.seq
249885616 gbmam3.seq
249998162 gbmam4.seq
249997414 gbmam5.seq
249999421 gbmam6.seq
249999158 gbmam7.seq
69057603 gbmam8.seq
25643451 gbnew.txt
249999224 gbpat1.seq
250000069 gbpat10.seq
249999793 gbpat100.seq
149112469 gbpat101.seq
249999880 gbpat102.seq
249999565 gbpat103.seq
249929731 gbpat104.seq
249824879 gbpat105.seq
249998856 gbpat106.seq
192957445 gbpat107.seq
250000209 gbpat108.seq
249999625 gbpat109.seq
179605805 gbpat11.seq
249995259 gbpat110.seq
80149593 gbpat111.seq
249999663 gbpat112.seq
250000019 gbpat113.seq
249999595 gbpat114.seq
249999878 gbpat115.seq
249849703 gbpat116.seq
66835452 gbpat117.seq
249999441 gbpat118.seq
249999845 gbpat119.seq
249999800 gbpat12.seq
249999888 gbpat120.seq
249999095 gbpat121.seq
160256390 gbpat122.seq
249999974 gbpat123.seq
249999633 gbpat124.seq
234784218 gbpat125.seq
249991591 gbpat126.seq
249970935 gbpat127.seq
249999681 gbpat128.seq
249997397 gbpat129.seq
250000262 gbpat13.seq
249997452 gbpat130.seq
66832984 gbpat131.seq
249992315 gbpat132.seq
249999867 gbpat133.seq
250000197 gbpat134.seq
249999821 gbpat135.seq
249998337 gbpat136.seq
18437114 gbpat137.seq
249999655 gbpat138.seq
249998828 gbpat139.seq
249999107 gbpat14.seq
249999803 gbpat140.seq
249999630 gbpat141.seq
249999242 gbpat142.seq
156351865 gbpat143.seq
249998039 gbpat144.seq
250000068 gbpat145.seq
250000067 gbpat146.seq
86028783 gbpat147.seq
249999922 gbpat148.seq
249999547 gbpat149.seq
249998247 gbpat15.seq
250000047 gbpat150.seq
63545113 gbpat151.seq
249997936 gbpat152.seq
249998685 gbpat153.seq
250000097 gbpat154.seq
249998938 gbpat155.seq
250000265 gbpat156.seq
249999035 gbpat157.seq
222257365 gbpat158.seq
250000249 gbpat159.seq
249998662 gbpat16.seq
249999893 gbpat160.seq
249999893 gbpat161.seq
220539897 gbpat162.seq
249999753 gbpat163.seq
250000152 gbpat164.seq
249999979 gbpat165.seq
12389115 gbpat166.seq
249997274 gbpat167.seq
249998918 gbpat168.seq
249999535 gbpat169.seq
65949737 gbpat17.seq
249999609 gbpat170.seq
35425686 gbpat171.seq
249998936 gbpat172.seq
249999147 gbpat173.seq
249999261 gbpat174.seq
249999114 gbpat175.seq
249999335 gbpat176.seq
249999993 gbpat177.seq
147946096 gbpat178.seq
250000201 gbpat179.seq
250000027 gbpat18.seq
249999686 gbpat180.seq
249998303 gbpat181.seq
140781203 gbpat182.seq
249999801 gbpat19.seq
249997564 gbpat2.seq
250000170 gbpat20.seq
249995119 gbpat21.seq
186149817 gbpat22.seq
249999352 gbpat23.seq
249967655 gbpat24.seq
249999252 gbpat25.seq
249999307 gbpat26.seq
71269871 gbpat27.seq
249992428 gbpat28.seq
249999397 gbpat29.seq
249999687 gbpat3.seq
249998557 gbpat30.seq
249999292 gbpat31.seq
250000003 gbpat32.seq
180220267 gbpat33.seq
249999227 gbpat34.seq
249999204 gbpat35.seq
249999914 gbpat36.seq
249998923 gbpat37.seq
130551393 gbpat38.seq
249997332 gbpat39.seq
249995996 gbpat4.seq
249995262 gbpat40.seq
249998829 gbpat41.seq
249999496 gbpat42.seq
249995159 gbpat43.seq
249899385 gbpat44.seq
249999190 gbpat45.seq
249999197 gbpat46.seq
171471500 gbpat47.seq
249999317 gbpat48.seq
249997524 gbpat49.seq
71719615 gbpat5.seq
249999853 gbpat50.seq
249999528 gbpat51.seq
222937739 gbpat52.seq
249999057 gbpat53.seq
249999815 gbpat54.seq
250000246 gbpat55.seq
164995993 gbpat56.seq
249886561 gbpat57.seq
249998432 gbpat58.seq
250000003 gbpat59.seq
249999527 gbpat6.seq
250000158 gbpat60.seq
135004984 gbpat61.seq
249998945 gbpat62.seq
249999978 gbpat63.seq
249999690 gbpat64.seq
249998210 gbpat65.seq
249999753 gbpat66.seq
249999682 gbpat67.seq
144886744 gbpat68.seq
250000135 gbpat69.seq
250000218 gbpat7.seq
249999899 gbpat70.seq
249998837 gbpat71.seq
244400042 gbpat72.seq
248969066 gbpat73.seq
244459261 gbpat74.seq
247875799 gbpat75.seq
249999921 gbpat76.seq
160624439 gbpat77.seq
250000121 gbpat78.seq
249999657 gbpat79.seq
249998836 gbpat8.seq
249999470 gbpat80.seq
249999644 gbpat81.seq
249996869 gbpat82.seq
250000181 gbpat83.seq
93339777 gbpat84.seq
249156483 gbpat85.seq
249999683 gbpat86.seq
249999994 gbpat87.seq
249999368 gbpat88.seq
249999290 gbpat89.seq
250000160 gbpat9.seq
249999957 gbpat90.seq
145297619 gbpat91.seq
249999508 gbpat92.seq
249998980 gbpat93.seq
249999939 gbpat94.seq
250000257 gbpat95.seq
196964910 gbpat96.seq
249999051 gbpat97.seq
249998995 gbpat98.seq
249999064 gbpat99.seq
213560560 gbphg1.seq
249996775 gbpln1.seq
249999740 gbpln10.seq
249998752 gbpln11.seq
249999449 gbpln12.seq
249892935 gbpln13.seq
214585736 gbpln14.seq
249969765 gbpln15.seq
249989406 gbpln16.seq
249992843 gbpln17.seq
249928458 gbpln18.seq
249994013 gbpln19.seq
249886915 gbpln2.seq
249952454 gbpln20.seq
249995569 gbpln21.seq
33983667 gbpln22.seq
249991306 gbpln23.seq
97752990 gbpln24.seq
249998520 gbpln25.seq
249998124 gbpln26.seq
249837325 gbpln27.seq
221260740 gbpln28.seq
181007284 gbpln29.seq
249768732 gbpln3.seq
249670768 gbpln30.seq
249895640 gbpln31.seq
249999868 gbpln32.seq
250000243 gbpln33.seq
250000128 gbpln34.seq
156468880 gbpln35.seq
249997992 gbpln36.seq
249999057 gbpln37.seq
249999371 gbpln38.seq
250000253 gbpln39.seq
249893596 gbpln4.seq
143909423 gbpln40.seq
249943308 gbpln41.seq
249905662 gbpln42.seq
249999037 gbpln43.seq
249999193 gbpln44.seq
245992794 gbpln45.seq
219728195 gbpln46.seq
249999905 gbpln47.seq
249550572 gbpln48.seq
249998967 gbpln49.seq
249824463 gbpln5.seq
249998895 gbpln50.seq
249998365 gbpln51.seq
28960287 gbpln52.seq
250000244 gbpln53.seq
249998624 gbpln54.seq
249999811 gbpln55.seq
249887601 gbpln56.seq
249996435 gbpln57.seq
250000200 gbpln58.seq
130593883 gbpln59.seq
249976671 gbpln6.seq
249299708 gbpln7.seq
249998725 gbpln8.seq
101109981 gbpln9.seq
148968929 gbpri1.seq
249860761 gbpri10.seq
131545508 gbpri11.seq
249962747 gbpri12.seq
249896480 gbpri13.seq
249896770 gbpri14.seq
249947119 gbpri15.seq
249902715 gbpri16.seq
249876249 gbpri17.seq
249992266 gbpri18.seq
249904047 gbpri19.seq
249885275 gbpri2.seq
249955645 gbpri20.seq
249974539 gbpri21.seq
249913702 gbpri22.seq
57376514 gbpri23.seq
177491906 gbpri24.seq
249998492 gbpri25.seq
211357951 gbpri26.seq
249984318 gbpri27.seq
249988068 gbpri28.seq
249947682 gbpri29.seq
249872295 gbpri3.seq
249935305 gbpri30.seq
249956545 gbpri31.seq
249969435 gbpri32.seq
249968207 gbpri33.seq
249985584 gbpri34.seq
99003572 gbpri35.seq
249993971 gbpri36.seq
249997177 gbpri37.seq
249926095 gbpri38.seq
249994583 gbpri39.seq
249930116 gbpri4.seq
249997671 gbpri40.seq
184925076 gbpri41.seq
249999830 gbpri42.seq
249999034 gbpri43.seq
249998899 gbpri44.seq
81409729 gbpri45.seq
249863455 gbpri5.seq
249792010 gbpri6.seq
249859687 gbpri7.seq
249806231 gbpri8.seq
249896907 gbpri9.seq
336441 gbrel.txt
249952887 gbrod1.seq
249890064 gbrod10.seq
63086316 gbrod11.seq
249871284 gbrod12.seq
249783783 gbrod13.seq
249992872 gbrod14.seq
249651633 gbrod15.seq
249953778 gbrod16.seq
249885197 gbrod17.seq
249944172 gbrod18.seq
249740612 gbrod19.seq
249927954 gbrod2.seq
249742613 gbrod20.seq
249924095 gbrod21.seq
230194968 gbrod22.seq
249997864 gbrod23.seq
250000163 gbrod24.seq
249953950 gbrod25.seq
249850861 gbrod26.seq
249999285 gbrod27.seq
249999569 gbrod28.seq
228470294 gbrod29.seq
249846934 gbrod3.seq
249801207 gbrod4.seq
249878898 gbrod5.seq
249894478 gbrod6.seq
249944880 gbrod7.seq
249973808 gbrod8.seq
249999120 gbrod9.seq
4554412719 gbsdr1.txt
5897199457 gbsdr2.txt
2762775895 gbsdr3.txt
166387531 gbsec.idx
249996637 gbsts1.seq
249997720 gbsts10.seq
210919464 gbsts11.seq
249996524 gbsts12.seq
249998812 gbsts13.seq
249999881 gbsts14.seq
249999569 gbsts15.seq
24453604 gbsts16.seq
249999107 gbsts17.seq
249999933 gbsts18.seq
249998944 gbsts19.seq
249998310 gbsts2.seq
148910603 gbsts20.seq
250000245 gbsts3.seq
249996479 gbsts4.seq
39285911 gbsts5.seq
249997411 gbsts6.seq
249997774 gbsts7.seq
249997192 gbsts8.seq
249999304 gbsts9.seq
249998424 gbsyn1.seq
249998740 gbsyn2.seq
249982438 gbsyn3.seq
249995958 gbsyn4.seq
249978656 gbsyn5.seq
249956817 gbsyn6.seq
142481091 gbsyn7.seq
249998949 gbtsa1.seq
60152536 gbtsa10.seq
250000174 gbtsa100.seq
249999584 gbtsa101.seq
249997105 gbtsa102.seq
196200322 gbtsa103.seq
249999600 gbtsa104.seq
249994630 gbtsa105.seq
249997962 gbtsa106.seq
249998548 gbtsa107.seq
249999647 gbtsa108.seq
249999586 gbtsa109.seq
249997488 gbtsa11.seq
249999725 gbtsa110.seq
249997827 gbtsa111.seq
116050893 gbtsa112.seq
249995952 gbtsa12.seq
249999431 gbtsa13.seq
249999867 gbtsa14.seq
249999291 gbtsa15.seq
37289699 gbtsa16.seq
249998569 gbtsa17.seq
249998880 gbtsa18.seq
249999066 gbtsa19.seq
249997872 gbtsa2.seq
249993881 gbtsa20.seq
175705543 gbtsa21.seq
249999624 gbtsa22.seq
249998425 gbtsa23.seq
249999491 gbtsa24.seq
249999247 gbtsa25.seq
249999747 gbtsa26.seq
249998903 gbtsa27.seq
40124348 gbtsa28.seq
249998953 gbtsa29.seq
249998023 gbtsa3.seq
249997667 gbtsa30.seq
250000063 gbtsa31.seq
249998720 gbtsa32.seq
249999882 gbtsa33.seq
249999779 gbtsa34.seq
249998416 gbtsa35.seq
5664107 gbtsa36.seq
249997128 gbtsa37.seq
249999411 gbtsa38.seq
249998366 gbtsa39.seq
250000174 gbtsa4.seq
249999971 gbtsa40.seq
62939241 gbtsa41.seq
249998923 gbtsa42.seq
249999602 gbtsa43.seq
249998333 gbtsa44.seq
249999006 gbtsa45.seq
74665083 gbtsa46.seq
249999615 gbtsa47.seq
249998945 gbtsa48.seq
249997943 gbtsa49.seq
89214320 gbtsa5.seq
249997483 gbtsa50.seq
249997286 gbtsa51.seq
249999918 gbtsa52.seq
249998636 gbtsa53.seq
178872109 gbtsa54.seq
249996642 gbtsa55.seq
249998501 gbtsa56.seq
249999029 gbtsa57.seq
249999341 gbtsa58.seq
249997360 gbtsa59.seq
249998268 gbtsa6.seq
249999156 gbtsa60.seq
214694295 gbtsa61.seq
249999216 gbtsa62.seq
250000224 gbtsa63.seq
249998245 gbtsa64.seq
249998468 gbtsa65.seq
250000251 gbtsa66.seq
100267956 gbtsa67.seq
249999943 gbtsa68.seq
249997522 gbtsa69.seq
250000072 gbtsa7.seq
249998509 gbtsa70.seq
249998538 gbtsa71.seq
249998464 gbtsa72.seq
26840872 gbtsa73.seq
249999932 gbtsa74.seq
249998917 gbtsa75.seq
249998531 gbtsa76.seq
249997728 gbtsa77.seq
249997863 gbtsa78.seq
249998169 gbtsa79.seq
250000052 gbtsa8.seq
249997077 gbtsa80.seq
31414257 gbtsa81.seq
249998284 gbtsa82.seq
249998100 gbtsa83.seq
249998276 gbtsa84.seq
249999907 gbtsa85.seq
249998577 gbtsa86.seq
29919285 gbtsa87.seq
249998447 gbtsa88.seq
249998843 gbtsa89.seq
249997923 gbtsa9.seq
249999713 gbtsa90.seq
249998940 gbtsa91.seq
244854076 gbtsa92.seq
249999257 gbtsa93.seq
249998411 gbtsa94.seq
249997711 gbtsa95.seq
249998937 gbtsa96.seq
249719593 gbtsa97.seq
249999535 gbtsa98.seq
249998914 gbtsa99.seq
496442 gbuna1.seq
249997497 gbvrl1.seq
249996596 gbvrl10.seq
230556266 gbvrl11.seq
249996666 gbvrl12.seq
249994854 gbvrl13.seq
249997869 gbvrl14.seq
249999604 gbvrl15.seq
162889778 gbvrl16.seq
249993300 gbvrl17.seq
249982967 gbvrl18.seq
249997833 gbvrl19.seq
249999242 gbvrl2.seq
249995201 gbvrl20.seq
249996027 gbvrl21.seq
116295067 gbvrl22.seq
249998888 gbvrl3.seq
249997426 gbvrl4.seq
203255865 gbvrl5.seq
250000031 gbvrl6.seq
249998773 gbvrl7.seq
249995105 gbvrl8.seq
249999147 gbvrl9.seq
249915660 gbvrt1.seq
249855727 gbvrt10.seq
249950363 gbvrt11.seq
185412106 gbvrt12.seq
249994619 gbvrt13.seq
249897444 gbvrt14.seq
249910477 gbvrt15.seq
249999651 gbvrt16.seq
249999508 gbvrt17.seq
249997811 gbvrt18.seq
99263725 gbvrt19.seq
249823521 gbvrt2.seq
249950820 gbvrt20.seq
249997972 gbvrt21.seq
249998686 gbvrt22.seq
249997534 gbvrt23.seq
249999370 gbvrt24.seq
250000106 gbvrt25.seq
249999827 gbvrt26.seq
167099111 gbvrt27.seq
249883407 gbvrt3.seq
249997801 gbvrt4.seq
113933022 gbvrt5.seq
250000086 gbvrt6.seq
249994827 gbvrt7.seq
249879945 gbvrt8.seq
249793188 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 63964 86337907
BCT10 66 116730258
BCT11 74 112572581
BCT12 115 115325441
BCT13 44 113286588
BCT14 16101 45900496
BCT15 53933 85391494
BCT16 93 110189094
BCT17 151 93915681
BCT18 61 112455059
BCT19 52 112042350
BCT2 8146 109474737
BCT20 46 114233015
BCT21 58 114931588
BCT22 67 111284815
BCT23 36 96325907
BCT24 40 106881287
BCT25 58 105533856
BCT26 74 111675186
BCT27 55 110045255
BCT28 63 106845575
BCT29 55 109391288
BCT3 52 112760544
BCT30 53 108650404
BCT31 46 110496749
BCT32 95 109522868
BCT33 59 110966729
BCT34 67 108616570
BCT35 124 106350090
BCT36 37 71643089
BCT37 200 108779787
BCT38 53 109969009
BCT39 38 108760252
BCT4 56 109240941
BCT40 58 108566760
BCT41 56 107056790
BCT42 44 107631668
BCT43 74 110145776
BCT44 63 109222644
BCT45 45 107106306
BCT46 59 105661869
BCT47 80 110031975
BCT48 76 103598262
BCT49 67 109336234
BCT5 38315 81650281
BCT50 60 103344001
BCT51 51 106715862
BCT52 56 105766361
BCT53 54 107452055
BCT54 64 111546035
BCT55 47 104055611
BCT56 69 108689945
BCT57 61 113403997
BCT58 64 109922985
BCT59 63 109426773
BCT6 39042 82648391
BCT60 51 114853662
BCT61 35 46539831
BCT62 37 108301494
BCT63 53 115243937
BCT64 54 113498150
BCT65 53 109920857
BCT66 122 113813295
BCT67 65 116010476
BCT68 83 115337289
BCT69 220 98447010
BCT7 5518 94828825
BCT70 350 52715337
BCT71 1589 2511877
BCT72 3179 5215935
BCT73 6347 7902871
BCT74 12648 15076979
BCT75 25620 27738207
BCT76 50524 54036411
BCT77 76191 77911071
BCT78 71333 77174315
BCT79 9881 94289735
BCT8 13773 81411004
BCT80 5443 100112702
BCT81 3203 107449195
BCT82 39 113461033
BCT83 2376 110225873
BCT84 5925 108700788
BCT85 40600 75488483
BCT86 67821 79675622
BCT87 4111 124375619
BCT88 52055 89938071
BCT89 76301 79624150
BCT9 6838 96099579
BCT90 76698 78944257
BCT91 47186 87430848
ENV1 94104 70654692
ENV10 93251 72992468
ENV11 83203 87348958
ENV12 20758 17760380
ENV13 84748 80843700
ENV14 118375 43040171
ENV15 89183 77253657
ENV16 96496 67709152
ENV17 96130 63410337
ENV18 110559 66902497
ENV19 116972 67911907
ENV2 94649 68935041
ENV20 56635 76471364
ENV21 67983 87505211
ENV22 91106 74601703
ENV23 128242 34584261
ENV24 123050 29085257
ENV25 77959 17881890
ENV26 123121 49787346
ENV27 97689 67743895
ENV28 115709 56215319
ENV29 136377 52708778
ENV3 84671 76040787
ENV30 108582 61731385
ENV31 69515 51811672
ENV32 62536 84995133
ENV33 88979 73398903
ENV34 102624 44144264
ENV35 96843 56252227
ENV36 70694 54682368
ENV37 111341 47244097
ENV38 101086 61316240
ENV39 107217 63313935
ENV4 81621 83650567
ENV40 63535 90709116
ENV41 72613 78816555
ENV42 62032 84254413
ENV43 11050 15062180
ENV44 71793 79117723
ENV45 108676 48868025
ENV46 112200 56830463
ENV47 104860 61099749
ENV48 71478 37836557
ENV49 100506 44094010
ENV5 89160 84754086
ENV50 42757 53805700
ENV51 42381 55136831
ENV52 60471 57429118
ENV53 100137 59513368
ENV54 99733 59511112
ENV55 77923 84656591
ENV56 87351 72109006
ENV57 34973 25908513
ENV6 100336 66965556
ENV7 3409 351186
ENV8 131426 31030828
ENV9 86280 70411430
EST1 158919 61572670
EST10 167136 71987124
EST100 231736 140763677
EST101 237801 124861802
EST102 190121 104227132
EST103 184383 101960893
EST104 103255 71898629
EST105 160238 119715675
EST106 172274 105505357
EST107 134993 84824109
EST108 64410 24032213
EST109 63776 22430545
EST11 169723 74100103
EST110 64300 23290552
EST111 64314 27067505
EST112 64824 23108014
EST113 65040 24789732
EST114 63924 27181669
EST115 64305 26428863
EST116 64500 27445217
EST117 64330 25257020
EST118 61686 34904925
EST119 143086 68946802
EST12 166643 70029765
EST120 160862 84980820
EST121 176991 92873784
EST122 149340 96407517
EST123 156327 91866902
EST124 120454 78352052
EST125 189395 90785712
EST126 156163 83086158
EST127 157299 84443808
EST128 156473 84631750
EST129 151637 85041499
EST13 73164 35016155
EST130 172879 92806640
EST131 183351 116986849
EST132 202632 102425032
EST133 159026 87134784
EST134 163132 82939830
EST135 142118 83540684
EST136 144986 89679654
EST137 100783 53710109
EST138 173414 97939042
EST139 245181 113126747
EST14 217756 109283250
EST140 154609 83537231
EST141 167333 92307494
EST142 150632 88077845
EST143 133603 81709045
EST144 154276 96730064
EST145 155919 85642646
EST146 124543 63436565
EST147 121489 65223213
EST148 127998 58057539
EST149 127406 51315410
EST15 168446 105158467
EST150 128755 51319204
EST151 114836 42807454
EST152 163811 82666829
EST153 176181 73812808
EST154 162336 110222029
EST155 199949 122657089
EST156 214263 121765344
EST157 175421 97160206
EST158 154756 108203016
EST159 141941 95125676
EST16 179130 112614607
EST160 154684 96135971
EST161 157570 82567863
EST162 139282 78417421
EST163 167515 93150916
EST164 72224 44791549
EST165 150026 91755971
EST166 191850 110266521
EST167 145719 83912033
EST168 142852 72417592
EST169 148907 87004940
EST17 195643 113169467
EST170 190779 104718637
EST171 156407 95944513
EST172 168558 82344690
EST173 125070 86538529
EST174 169931 99555146
EST175 173298 100700765
EST176 122562 68070477
EST177 157099 90322185
EST178 36885 21444025
EST179 169724 102571222
EST18 190585 121354588
EST180 180461 118980204
EST181 143355 116918785
EST182 194736 99541170
EST183 153263 102172821
EST184 154545 102131493
EST185 141621 81868750
EST186 175382 70843804
EST187 150651 85169465
EST188 158224 99175801
EST189 155021 96146471
EST19 159352 114118119
EST190 139195 82598141
EST191 165720 100282736
EST192 145545 93178688
EST193 129265 90352886
EST194 144231 88153597
EST195 135848 88470760
EST196 129805 92784691
EST197 162724 86807768
EST198 173959 95600387
EST199 173380 96534297
EST2 161834 61542584
EST20 186608 99330728
EST200 171666 95207178
EST201 168841 95364304
EST202 171391 95596294
EST203 173219 95038721
EST204 173942 95721601
EST205 26177 14201683
EST206 188669 105137899
EST207 204797 104611955
EST208 172197 101986046
EST209 180084 101647848
EST21 217035 106291228
EST210 201547 123063255
EST211 193573 111781351
EST212 193319 123634351
EST213 156779 103959188
EST214 218947 141765002
EST215 235678 114622862
EST216 147247 103673940
EST217 162291 109343110
EST218 147438 94927316
EST219 177615 98532266
EST22 198923 66086149
EST220 189820 118130827
EST221 111640 87731326
EST222 134726 121259734
EST223 160083 93029254
EST224 148055 95107347
EST225 194881 107676223
EST226 166418 104031856
EST227 134162 92480363
EST228 142045 105257912
EST229 121269 87269510
EST23 141025 40096541
EST230 89557 60503553
EST231 144768 89897626
EST232 132135 93880853
EST233 142186 101213731
EST234 120293 86721421
EST235 125389 84242832
EST236 153351 106021853
EST237 160280 115759687
EST238 118523 122180889
EST239 148242 89064619
EST24 103792 28102294
EST240 183059 118560144
EST241 151203 92534285
EST242 170628 107952094
EST243 166943 121547985
EST244 146698 107320481
EST245 8906 6362041
EST246 151715 100082633
EST247 206418 97759831
EST248 197151 110513218
EST249 146753 91228207
EST25 121414 50823833
EST250 220509 24591012
EST251 220757 90237284
EST252 164684 118595620
EST253 177311 103387057
EST254 160930 107365116
EST255 174766 114833376
EST256 157398 114451736
EST257 101579 56552885
EST258 185289 97785186
EST259 177022 102341748
EST26 213500 97045520
EST260 165945 121340044
EST261 210626 102294901
EST262 269576 117341119
EST263 214173 122801359
EST264 182514 44136343
EST265 240417 107128719
EST266 174713 100608135
EST267 166978 104766781
EST268 92746 57343478
EST269 164030 113461012
EST27 218821 110004275
EST270 201476 103912213
EST271 152228 104687319
EST272 197831 116679450
EST273 195449 52611643
EST274 210331 39538497
EST275 182494 101653016
EST276 164496 115804753
EST277 189706 115628351
EST278 180337 107462954
EST279 160073 104297049
EST28 190221 88562402
EST280 106161 40386536
EST281 147593 85695119
EST282 117008 78203378
EST283 157394 106351340
EST284 244395 38946532
EST285 263887 24179927
EST286 171202 88731666
EST287 166715 109463390
EST288 160290 104734259
EST289 148715 92135281
EST29 158137 68948955
EST290 258880 39389841
EST291 177749 95033570
EST292 64615 47794566
EST293 192329 109522564
EST294 144559 79242536
EST295 178862 121744250
EST296 188894 110716047
EST297 151806 112642310
EST298 189987 105397790
EST299 180015 100585611
EST3 153587 54414675
EST30 171775 69728415
EST300 172988 111848667
EST301 188954 63258295
EST302 187215 68635882
EST303 187693 72975596
EST304 128011 46992822
EST305 192216 88863459
EST306 179877 125364399
EST307 160571 94456899
EST308 154557 91283219
EST309 127997 97520841
EST31 148798 63215048
EST310 148262 98976672
EST311 162521 99315208
EST312 167372 93658273
EST313 170432 103508709
EST314 150232 97259043
EST315 149921 101416373
EST316 164124 107807702
EST317 151489 104740027
EST318 178936 150072231
EST319 174213 115913600
EST32 168199 76004918
EST320 141271 75253084
EST321 144208 98288821
EST322 145437 100444605
EST323 132276 88878297
EST324 148786 98902731
EST325 147675 100667051
EST326 177734 112925291
EST327 153470 83493039
EST328 150358 86424952
EST329 150067 104616727
EST33 173584 66337909
EST330 156003 98409956
EST331 79566 47516640
EST332 143135 90981581
EST333 141827 89322854
EST334 205417 111667272
EST335 136843 74813880
EST336 92239 55003229
EST337 129775 85504198
EST338 137181 87085033
EST339 125452 80194113
EST34 123644 43757615
EST340 158696 85033857
EST341 216404 84676112
EST342 170951 87042309
EST343 170553 103357648
EST344 165588 98540663
EST345 85203 56823876
EST346 132584 88321762
EST347 135771 88421295
EST348 185463 121451604
EST349 160450 97083787
EST35 97392 29901461
EST350 158182 80551374
EST351 188239 128379925
EST352 116595 80633718
EST353 73345 44017433
EST354 138222 76212809
EST355 130208 77979115
EST356 148017 57271510
EST357 158629 32415880
EST358 158521 32654597
EST359 181804 105305259
EST36 97797 30574042
EST360 13077 9450809
EST361 226538 117641425
EST362 250983 114598125
EST363 201835 104342014
EST364 147076 94885274
EST365 135877 87084788
EST366 144707 86544214
EST367 182289 113096105
EST368 225276 81748103
EST369 191158 97518786
EST37 96709 29349943
EST370 211803 119277932
EST371 157752 87236129
EST372 145393 69125636
EST373 201120 119076785
EST374 147430 93853103
EST375 184777 135623589
EST376 180675 140237613
EST377 162441 103719561
EST378 163815 101383616
EST379 185150 109845679
EST38 98626 29830017
EST380 185900 107606436
EST381 204759 110493322
EST382 177833 106503783
EST383 140706 83614696
EST384 184888 123193897
EST385 202502 135592313
EST386 224387 131662624
EST387 205197 134235502
EST388 207701 168872743
EST389 217037 134499061
EST39 99403 31247415
EST390 158430 101400733
EST391 192884 106605953
EST392 170155 17606334
EST393 160048 13420760
EST394 155343 25059222
EST395 158743 32128889
EST396 158802 31980988
EST397 151345 73243802
EST398 170634 99022961
EST399 172359 117240294
EST4 170787 67086973
EST40 23394 5960537
EST400 167888 97345300
EST401 152779 107287996
EST402 141804 98688876
EST403 146874 102258710
EST404 157644 98700396
EST405 158792 116230830
EST406 165571 100003435
EST407 168536 54992304
EST408 167928 36585403
EST409 158219 106892944
EST41 101031 52982598
EST410 156617 102686648
EST411 177448 115036221
EST412 138141 78682108
EST413 196008 113343201
EST414 154707 111803794
EST415 133899 91294202
EST416 139958 91915593
EST417 151390 92109918
EST418 172620 96349653
EST419 178657 98447072
EST42 119515 50854874
EST420 151115 91296729
EST421 3205 1648527
EST422 179386 108550252
EST423 152941 93578663
EST424 110566 75940707
EST425 84176 64716552
EST426 99761 67092628
EST427 144453 82127402
EST428 132714 79310833
EST429 133470 84194551
EST43 165778 91712098
EST430 137728 86930253
EST431 147028 90049042
EST432 169517 91369843
EST433 190065 112219090
EST434 125176 80882316
EST435 193072 108261868
EST436 25051 13509557
EST437 177285 82519901
EST438 155861 89004474
EST439 156784 86944122
EST44 170232 72290930
EST440 217078 126740380
EST441 176835 108683958
EST442 175475 106743911
EST443 139251 101177034
EST444 141090 91804958
EST445 152980 76688720
EST446 194321 87523238
EST447 202110 82868529
EST448 190297 79548953
EST449 192635 88480793
EST45 167187 84789083
EST450 179737 110387142
EST451 185946 90491165
EST452 186591 85952296
EST453 203488 109960564
EST454 191770 117381197
EST455 174124 103156122
EST456 203130 126938910
EST457 143913 93964117
EST458 157479 105334647
EST459 169557 85557391
EST46 168565 86876384
EST460 63019 35533479
EST461 145900 81432787
EST462 159772 85934183
EST463 181490 100497999
EST464 165709 84828699
EST465 168377 58996777
EST466 152994 59624151
EST47 163200 87801704
EST48 162156 83302752
EST49 160123 91074967
EST5 168952 66190553
EST50 161537 88070818
EST51 157131 98922479
EST52 159531 69786471
EST53 145752 81582908
EST54 78262 50668846
EST55 167002 69861908
EST56 164697 74782148
EST57 164326 90717418
EST58 159166 97167069
EST59 156478 101495566
EST6 171459 66908856
EST60 164593 98906560
EST61 160089 108008836
EST62 171070 81443562
EST63 173109 92397867
EST64 155487 84167139
EST65 148903 81876026
EST66 158741 98434282
EST67 136338 77286727
EST68 149429 91682683
EST69 194816 108038490
EST7 169823 72788178
EST70 180869 95053427
EST71 221041 121169478
EST72 185579 110616973
EST73 203845 121318765
EST74 163289 90035751
EST75 134019 61456479
EST76 139678 68739806
EST77 154483 93936535
EST78 157733 100225893
EST79 141896 78481894
EST8 179311 72807239
EST80 53308 24839183
EST81 164043 100440633
EST82 211918 114774017
EST83 223617 123690011
EST84 200505 94287247
EST85 211035 93329196
EST86 162202 92842281
EST87 144116 86871979
EST88 164214 81058421
EST89 158054 79863325
EST9 168645 69366546
EST90 152888 102069318
EST91 152106 88935982
EST92 135247 87207724
EST93 156068 113044317
EST94 142346 104167411
EST95 143182 102384560
EST96 141140 97519750
EST97 147028 80995521
EST98 178710 111261867
EST99 224230 135786265
GSS1 200049 87610619
GSS10 132038 60282099
GSS100 145362 114337340
GSS101 141643 116113759
GSS102 143263 116656493
GSS103 167236 128919983
GSS104 149785 82570423
GSS105 191525 120852658
GSS106 167632 112045681
GSS107 197296 115492795
GSS108 204965 134781001
GSS109 209819 138217602
GSS11 137026 73963370
GSS110 207582 140843676
GSS111 206233 142445590
GSS112 205238 143755060
GSS113 205194 143913008
GSS114 202116 146642001
GSS115 182317 139928302
GSS116 18567 10955671
GSS117 132846 84050698
GSS118 169072 79781623
GSS119 183491 78755162
GSS12 147892 75892995
GSS120 169917 147882911
GSS121 177511 120185913
GSS122 179713 146295726
GSS123 187250 120318213
GSS124 187061 139575183
GSS125 192224 126960331
GSS126 192031 92815068
GSS127 167984 157295485
GSS128 163017 113624848
GSS129 63314 38570390
GSS13 145394 68606312
GSS130 171035 155492836
GSS131 172358 154451939
GSS132 172393 155154973
GSS133 173792 154156214
GSS134 171958 154859390
GSS135 180250 138356993
GSS136 178139 146370889
GSS137 165379 118879881
GSS138 189590 95371943
GSS139 265791 41849675
GSS14 169793 84763419
GSS140 265731 40965131
GSS141 81220 12472457
GSS142 254320 58600070
GSS143 260083 56261687
GSS144 190600 86306160
GSS145 196144 66077329
GSS146 186142 147967569
GSS147 182754 151060616
GSS148 167958 155156816
GSS149 171115 157881251
GSS15 161094 97661031
GSS150 235018 72740193
GSS151 227933 79457580
GSS152 136166 57238196
GSS153 179645 71123213
GSS154 122314 72860319
GSS155 87077 63914781
GSS156 83559 62803060
GSS157 103633 48602104
GSS158 68640 58496681
GSS159 7828 7140695
GSS16 172835 87034673
GSS160 68591 57924394
GSS161 69224 56650935
GSS162 69460 56187403
GSS163 71202 55998401
GSS164 68561 51865315
GSS165 75915 58209304
GSS166 87237 74898207
GSS167 81504 44375177
GSS168 92239 44894040
GSS169 63973 47973862
GSS17 183363 113392831
GSS170 77367 61295678
GSS171 69656 58696022
GSS172 67712 62704471
GSS173 61920 53368409
GSS174 95643 42963254
GSS175 21165 4933990
GSS176 112938 70877522
GSS177 822 559311
GSS178 23226 28867035
GSS179 109092 70683886
GSS18 192347 114304499
GSS180 84555 34682016
GSS181 35744 22177639
GSS182 103304 62490220
GSS183 102329 63761256
GSS184 104268 67656826
GSS185 82099 41276456
GSS186 83102 54651503
GSS187 95684 61343347
GSS188 107373 78577773
GSS189 106314 76646515
GSS19 114273 52228513
GSS190 106101 79982459
GSS191 104015 80025091
GSS192 76402 51055333
GSS193 104482 63232426
GSS194 109868 66415305
GSS195 106047 59222776
GSS196 68381 37443617
GSS197 69506 38725653
GSS198 37368 17878843
GSS199 85481 46023427
GSS2 182295 92190515
GSS20 181787 101769657
GSS200 96935 55799967
GSS201 95009 49632000
GSS202 95897 55649530
GSS203 42678 23961360
GSS204 114055 43442995
GSS205 116422 39251295
GSS206 108882 55041759
GSS207 101472 78371349
GSS208 72643 46689469
GSS209 95891 36542252
GSS21 166208 114174113
GSS210 95417 37268709
GSS211 96671 35161518
GSS212 94285 39167432
GSS213 37736 17626556
GSS214 103939 66277823
GSS215 94551 61190929
GSS216 95128 60357048
GSS217 94773 60868501
GSS218 75675 70017159
GSS219 80787 68603070
GSS22 169505 97608334
GSS220 32556 33612970
GSS221 83736 28233267
GSS222 84219 27346468
GSS223 84926 25909272
GSS224 14851 4422302
GSS225 16547 7508221
GSS226 92128 59308050
GSS227 84494 52388719
GSS228 94098 50827589
GSS229 88585 48343496
GSS23 187250 126684076
GSS230 11366 6197879
GSS231 90648 56882510
GSS232 89662 61882079
GSS233 88553 63641206
GSS234 89283 62505584
GSS235 9890 7129098
GSS236 87995 63795538
GSS237 90151 62444409
GSS238 94367 59805167
GSS239 74143 62678833
GSS24 194054 130219272
GSS240 84189 78959221
GSS241 83078 80516319
GSS242 71019 53174669
GSS243 117650 64297121
GSS244 108874 55446727
GSS245 107533 52125503
GSS246 96658 43251344
GSS247 109801 49060015
GSS248 98194 46325477
GSS249 73059 72225597
GSS25 177482 105208945
GSS250 77252 72611065
GSS251 92149 71193561
GSS252 92496 70717940
GSS253 91063 68371307
GSS254 53301 32810242
GSS255 94787 57200301
GSS256 93517 59081345
GSS257 93900 58510429
GSS258 94714 57307691
GSS259 94197 58070562
GSS26 185732 107675520
GSS260 12741 6343956
GSS27 170506 151234083
GSS28 190511 146386306
GSS29 151054 106332306
GSS3 174946 87828983
GSS30 192536 132230345
GSS31 13906 8947947
GSS32 195895 127234153
GSS33 216654 116238131
GSS34 218577 113597712
GSS35 219716 112030658
GSS36 213973 121865192
GSS37 198560 156440039
GSS38 194985 146794861
GSS39 197291 73457394
GSS4 167157 85100788
GSS40 185038 97613049
GSS41 189714 125917418
GSS42 170994 159189605
GSS43 8594 5601792
GSS44 183999 100320381
GSS45 172666 121431355
GSS46 183067 123301526
GSS47 188535 120735257
GSS48 75421 65817457
GSS49 171545 101809563
GSS5 53455 31623154
GSS50 167648 103033730
GSS51 167797 102601882
GSS52 181966 120030309
GSS53 183671 115951946
GSS54 180675 122324637
GSS55 186380 112373101
GSS56 188973 135398180
GSS57 177496 103715733
GSS58 193462 118790383
GSS59 179834 130483059
GSS6 161617 84471320
GSS60 11859 10778852
GSS61 172841 138946229
GSS62 161635 111553131
GSS63 161673 111573561
GSS64 158830 107594298
GSS65 156726 129035698
GSS66 170186 142548648
GSS67 178808 116414085
GSS68 202003 126663756
GSS69 193525 110351742
GSS7 165321 79360873
GSS70 243841 125953050
GSS71 161398 107375254
GSS72 158017 118089918
GSS73 162108 124120427
GSS74 162074 124178449
GSS75 174033 108804801
GSS76 191241 140117430
GSS77 18382 11726115
GSS78 196572 124895921
GSS79 169659 110747724
GSS8 165782 88979534
GSS80 198937 130327630
GSS81 209570 89241268
GSS82 190513 95607097
GSS83 133194 93196958
GSS84 146028 117260125
GSS85 139698 116905241
GSS86 142745 113865568
GSS87 144086 119923469
GSS88 141642 115507937
GSS89 110756 92378197
GSS9 137999 67157719
GSS90 149425 122240891
GSS91 147663 117692857
GSS92 143995 113064403
GSS93 142869 115422868
GSS94 144203 119656289
GSS95 148069 121684067
GSS96 147696 117745472
GSS97 146077 121054040
GSS98 146145 120923099
GSS99 146569 120073651
HTC1 25057 27045808
HTC10 55896 70693175
HTC11 80041 70778311
HTC12 7835 9353773
HTC13 66993 60073171
HTC14 68563 69502858
HTC15 24588 16709696
HTC2 16086 36243320
HTC3 16029 36627693
HTC4 16251 35560357
HTC5 15980 40344457
HTC6 16068 37474845
HTC7 53834 31477922
HTC8 31137 19451907
HTC9 60957 77955151
HTG1 1318 188771164
HTG10 1297 186285876
HTG100 990 189440077
HTG101 996 189331054
HTG102 985 189419172
HTG103 1161 190585510
HTG104 30 4314892
HTG105 1087 189854687
HTG106 1046 189729798
HTG107 1386 191260179
HTG108 1295 190792465
HTG109 1639 191129237
HTG11 9 1245953
HTG110 1338 191984286
HTG111 945 138226591
HTG112 1435 191002309
HTG113 1522 189585821
HTG114 1413 178051407
HTG115 1209 154073372
HTG116 1330 173624734
HTG117 1256 189207285
HTG118 1061 185389901
HTG119 541 86944292
HTG12 1452 184004673
HTG120 1509 182779454
HTG121 1010 191768926
HTG122 1027 187615238
HTG123 1065 193671779
HTG124 1102 193157342
HTG125 130 24778576
HTG126 1029 189520679
HTG127 1054 192676832
HTG128 1163 191937540
HTG129 1080 192382243
HTG13 875 191786413
HTG130 1084 193101052
HTG131 592 104413873
HTG132 1122 192576031
HTG133 1080 192404979
HTG134 1078 192326016
HTG135 1166 191911933
HTG136 1517 191826635
HTG137 1069 192141286
HTG138 1069 192408918
HTG139 1130 191785062
HTG14 753 191921309
HTG140 1404 187560343
HTG141 395 55012384
HTG15 745 191963148
HTG16 785 191933231
HTG17 796 191351096
HTG18 775 192103394
HTG19 2069 170638342
HTG2 2468 186022324
HTG20 1096 187413748
HTG21 887 180042173
HTG22 785 191651644
HTG23 928 190141652
HTG24 907 190491600
HTG25 811 191323929
HTG26 784 191771279
HTG27 874 191079273
HTG28 896 190515178
HTG29 939 189959636
HTG3 2515 185223642
HTG30 911 190941779
HTG31 841 171449145
HTG32 875 191097680
HTG33 968 189501635
HTG34 884 191025385
HTG35 868 191276405
HTG36 825 191702609
HTG37 949 189868158
HTG38 949 190351720
HTG39 940 190045229
HTG4 2549 188262266
HTG40 1049 189067591
HTG41 1089 167537350
HTG42 1256 188119418
HTG43 1169 188010117
HTG44 1150 188080035
HTG45 1117 191232412
HTG46 1269 190634433
HTG47 1176 190820695
HTG48 1128 191324694
HTG49 1046 191269623
HTG5 1283 185544093
HTG50 1030 189585714
HTG51 1041 178589404
HTG52 968 190052338
HTG53 1105 190148899
HTG54 1046 190158403
HTG55 1014 189831932
HTG56 969 189170679
HTG57 81 14306584
HTG58 1010 189338312
HTG59 1029 189903667
HTG6 1273 185016781
HTG60 1078 187304761
HTG61 1125 188308213
HTG62 987 170842440
HTG63 1085 189487801
HTG64 1064 189415560
HTG65 1169 188798107
HTG66 1179 187545797
HTG67 1282 184397923
HTG68 94 12194080
HTG69 1221 185314622
HTG7 1275 185326125
HTG70 1239 184674446
HTG71 1244 184625496
HTG72 1183 187688486
HTG73 1018 169945682
HTG74 1118 188293510
HTG75 1103 190775743
HTG76 1135 190789237
HTG77 1182 190871034
HTG78 1096 185997580
HTG79 1171 190202119
HTG8 1459 184462575
HTG80 1115 190063261
HTG81 1213 189874691
HTG82 1120 189645029
HTG83 959 164682536
HTG84 1229 188409093
HTG85 1250 187741728
HTG86 1141 189879061
HTG87 1144 189686641
HTG88 978 167870813
HTG89 1182 189961005
HTG9 1200 186951993
HTG90 1104 190233697
HTG91 1146 190217975
HTG92 1109 190471215
HTG93 961 159222190
HTG94 1056 190754252
HTG95 1160 191011164
HTG96 1031 189156227
HTG97 1071 189497493
HTG98 684 127508859
HTG99 1018 189641315
INV1 93717 48141883
INV10 57031 86473273
INV11 82669 65187399
INV12 60583 47682023
INV13 84605 65952024
INV14 80801 66808385
INV15 78783 66596571
INV16 47784 45625390
INV17 28346 113157120
INV18 8495 142340684
INV19 42234 112389064
INV2 28149 143964755
INV20 77367 56584700
INV21 73112 62453629
INV22 2973 1941579
INV23 21249 126088063
INV24 6 133712559
INV25 53768 98902097
INV26 78392 53888751
INV27 31620 23186152
INV28 79292 57250558
INV29 77128 59009531
INV3 1707 176149992
INV30 74525 57124752
INV31 74564 50273225
INV32 52336 88512070
INV33 79 1036276
INV4 3854 133939858
INV5 78653 73290083
INV6 55794 94947866
INV7 47535 92725482
INV8 13002 12571168
INV9 80296 71523615
MAM1 16561 160752238
MAM2 19032 158658630
MAM3 59766 81443232
MAM4 6886 185756498
MAM5 79395 74716859
MAM6 48824 125606524
MAM7 73885 63393224
MAM8 20925 19872355
PAT1 222551 70117059
PAT10 124441 102578063
PAT100 178185 3385515
PAT101 132610 2848492
PAT102 342935 8573375
PAT103 188806 88519660
PAT104 111348 132068608
PAT105 3850 194703659
PAT106 131292 110979300
PAT107 158599 54826034
PAT108 224730 34113420
PAT109 250080 15844360
PAT11 98661 64110448
PAT110 180676 63661713
PAT111 51652 26061632
PAT112 114181 110461986
PAT113 137698 83276559
PAT114 164170 99350467
PAT115 158877 103325984
PAT116 137417 114988187
PAT117 42311 27994848
PAT118 193712 81686401
PAT119 150217 108404022
PAT12 142059 62828666
PAT120 356051 11379688
PAT121 257211 57607099
PAT122 138161 48226925
PAT123 322021 22795469
PAT124 155639 102753887
PAT125 132727 110696284
PAT126 128341 121313309
PAT127 21664 184390005
PAT128 144888 112900567
PAT129 171997 96403773
PAT13 105889 59875047
PAT130 44618 171217879
PAT131 9167 47581637
PAT132 33645 178334734
PAT133 153558 109675196
PAT134 178705 90913377
PAT135 136049 115324159
PAT136 120392 123342367
PAT137 8527 8992390
PAT138 155429 101473147
PAT139 184764 88815933
PAT14 103637 50157591
PAT140 182409 85292093
PAT141 174403 93928365
PAT142 125174 122942590
PAT143 140680 35530029
PAT144 203662 47737230
PAT145 277828 9627968
PAT146 220409 46465135
PAT147 106719 2881142
PAT148 270386 21672571
PAT149 186749 61237793
PAT15 121135 53308801
PAT150 109797 106057638
PAT151 47522 9551625
PAT152 87296 88239857
PAT153 78458 95572890
PAT154 145142 77718129
PAT155 167508 71368818
PAT156 121467 92946689
PAT157 103008 85350819
PAT158 165593 46060796
PAT159 270022 5130418
PAT16 113128 61270845
PAT160 269978 5129582
PAT161 269978 5129582
PAT162 237888 4519872
PAT163 269396 5118524
PAT164 235480 25575098
PAT165 203727 47154186
PAT166 12040 422808
PAT167 165317 74871979
PAT168 91686 126656173
PAT169 172584 71662747
PAT17 39191 16250237
PAT170 137842 72230817
PAT171 9556 14012460
PAT172 93111 87244841
PAT173 91680 79829497
PAT174 83213 91466816
PAT175 109148 53718640
PAT176 119767 63745357
PAT177 156331 19195880
PAT178 108126 30306626
PAT179 86862 129980830
PAT18 146771 52594264
PAT180 159196 78756411
PAT181 211906 48209823
PAT182 93359 41229190
PAT19 153705 78039102
PAT2 194513 84656825
PAT20 104751 118096823
PAT21 133743 95365390
PAT22 84649 79535519
PAT23 123506 103386772
PAT24 119472 105675014
PAT25 145423 86657448
PAT26 175150 64309743
PAT27 71449 1786225
PAT28 102171 77387698
PAT29 93951 87640330
PAT3 171983 95896583
PAT30 119941 61674794
PAT31 96634 78969836
PAT32 128390 55023697
PAT33 92223 51126479
PAT34 111296 78150585
PAT35 138098 29120154
PAT36 158504 24081221
PAT37 114675 49019980
PAT38 44875 54580173
PAT39 95732 83191686
PAT4 153749 106054879
PAT40 100232 70984798
PAT41 136205 39303239
PAT42 143773 35446818
PAT43 123732 64730827
PAT44 104362 81213845
PAT45 93445 74211542
PAT46 113254 66591441
PAT47 65219 54831918
PAT48 135192 108000182
PAT49 167081 97031566
PAT5 57141 23924741
PAT50 116396 127556602
PAT51 196341 76723288
PAT52 80306 127991232
PAT53 27631 180872621
PAT54 185408 93066629
PAT55 274259 6856475
PAT56 129447 31627433
PAT57 161320 77719729
PAT58 92802 89391390
PAT59 106504 74790004
PAT6 170642 91909261
PAT60 122362 64031281
PAT61 67447 30302020
PAT62 70750 109767817
PAT63 87947 82758966
PAT64 92971 78937516
PAT65 93166 72441718
PAT66 93384 75085880
PAT67 115775 60531183
PAT68 102736 9941783
PAT69 175933 10547809
PAT7 154761 88225542
PAT70 171510 10872561
PAT71 171496 10866737
PAT72 99859 86225043
PAT73 99 196466297
PAT74 67 192869889
PAT75 103 195600591
PAT76 1137 196318757
PAT77 97599 5772236
PAT78 151009 9636510
PAT79 151022 9621259
PAT8 131223 96905365
PAT80 151024 9622125
PAT81 151021 9620837
PAT82 94632 88056898
PAT83 93686 93467861
PAT84 34076 33981506
PAT85 83459 93185861
PAT86 15570 180450165
PAT87 164895 19209843
PAT88 178944 3399936
PAT89 177434 3371246
PAT9 129357 101143197
PAT90 175305 3330795
PAT91 101394 1926486
PAT92 169171 12412246
PAT93 178699 3395281
PAT94 178691 3395129
PAT95 178677 3394863
PAT96 140780 2674820
PAT97 178683 3394977
PAT98 178342 3388498
PAT99 178198 3385762
PHG1 6800 88051367
PLN1 59892 93459938
PLN10 73051 75858823
PLN11 37378 49292346
PLN12 40286 65711024
PLN13 22491 123979778
PLN14 21103 99490647
PLN15 17566 144768265
PLN16 17622 146203357
PLN17 17550 146317118
PLN18 24673 128747914
PLN19 5999 149130224
PLN2 47988 105940773
PLN20 1268 170558125
PLN21 13938 156108362
PLN22 7326 8521642
PLN23 67245 69725654
PLN24 29383 31608736
PLN25 76929 76345439
PLN26 64743 80334247
PLN27 61757 100531789
PLN28 76 95744252
PLN29 3 61743175
PLN3 1370 174115808
PLN30 55 125319454
PLN31 13939 137855186
PLN32 15876 135265682
PLN33 76914 74968057
PLN34 82790 71605112
PLN35 62168 33035047
PLN36 80347 71630908
PLN37 77830 75855781
PLN38 80049 70442372
PLN39 82068 75439466
PLN4 1783 185053409
PLN40 58155 31974407
PLN41 98606 55074243
PLN42 82034 68836091
PLN43 45781 98633973
PLN44 19096 132048240
PLN45 31034 127255332
PLN46 62510 70172190
PLN47 81378 72267422
PLN48 63367 82047041
PLN49 28631 110321321
PLN5 1882 193563346
PLN50 82749 65441045
PLN51 95297 56954582
PLN52 10330 7723427
PLN53 76921 72400257
PLN54 70843 83894218
PLN55 76169 69230265
PLN56 71731 74932527
PLN57 76844 66483273
PLN58 74293 71964552
PLN59 25534 48286602
PLN6 1690 194505017
PLN7 1601 183601704
PLN8 67406 87527710
PLN9 30967 29230389
PRI1 23019 59656550
PRI10 1272 179228181
PRI11 784 95380628
PRI12 1278 179183454
PRI13 1451 177770436
PRI14 1589 180081042
PRI15 1591 181937113
PRI16 1285 191720215
PRI17 1137 193666240
PRI18 1099 194310776
PRI19 1166 193657185
PRI2 18799 148619340
PRI20 1737 191818169
PRI21 2646 189795035
PRI22 9854 177039796
PRI23 11136 25136628
PRI24 31572 84615190
PRI25 61951 78207697
PRI26 31350 70628098
PRI27 8521 161801360
PRI28 2251 180645625
PRI29 1618 181509288
PRI3 1433 175175982
PRI30 2007 181705860
PRI31 1957 180746291
PRI32 13185 156514786
PRI33 1328 183749995
PRI34 41218 106774346
PRI35 23502 34414975
PRI36 32189 63608729
PRI37 20152 117784920
PRI38 18563 147331908
PRI39 66684 86887520
PRI4 1282 185562541
PRI40 49540 89482517
PRI41 40721 74985611
PRI42 45376 95601075
PRI43 17838 108091368
PRI44 70268 81069782
PRI45 12132 43769329
PRI5 1326 184326659
PRI6 1180 179899565
PRI7 1241 180866429
PRI8 1216 178447980
PRI9 1366 174657467
ROD1 33176 139427209
ROD10 989 181485158
ROD11 240 45576056
ROD12 1034 185475616
ROD13 940 182703335
ROD14 1040 189324025
ROD15 950 180306408
ROD16 967 182057152
ROD17 991 185811349
ROD18 1190 190606461
ROD19 16786 156932257
ROD2 916 175542994
ROD20 20349 148361192
ROD21 1132 182075942
ROD22 1079 168189648
ROD23 12239 164894390
ROD24 39631 69428417
ROD25 22367 102345594
ROD26 1533 187671189
ROD27 131992 39944307
ROD28 85469 70135982
ROD29 63484 67317397
ROD3 905 173326813
ROD4 901 173780081
ROD5 920 174266650
ROD6 966 178082195
ROD7 970 179708672
ROD8 979 181294026
ROD9 993 181869376
STS1 85257 36750501
STS10 57907 44420267
STS11 48910 37503235
STS12 57924 43637361
STS13 64283 42850336
STS14 93614 34186498
STS15 104286 26517058
STS16 10109 2739230
STS17 103611 27476228
STS18 86926 34447437
STS19 99725 33367017
STS2 84327 49855709
STS20 55000 21032797
STS3 66836 26359108
STS4 77030 36944377
STS5 8484 4973721
STS6 54259 31650966
STS7 54162 31838227
STS8 54316 31957697
STS9 55716 37767321
SYN1 42701 77371229
SYN2 49461 67941274
SYN3 11382 159376687
SYN4 4599 176566897
SYN5 4596 176481368
SYN6 4600 176570409
SYN7 6279 94761394
TSA1 119977 38112352
TSA10 19782 21876029
TSA100 62796 68082050
TSA101 83597 81259826
TSA102 77368 53642425
TSA103 52890 45157231
TSA104 78372 34800123
TSA105 74786 67822110
TSA106 81274 78630897
TSA107 77057 65556747
TSA108 79784 74400901
TSA109 74319 61098092
TSA11 104981 27321556
TSA110 91897 74868705
TSA111 86386 74020888
TSA112 43900 36607150
TSA12 63093 36049176
TSA13 78048 76369363
TSA14 108605 44529741
TSA15 100309 35637870
TSA16 15339 6761707
TSA17 85951 70204975
TSA18 120164 38802704
TSA19 134981 34131922
TSA2 113082 41399259
TSA20 61572 79385070
TSA21 41183 55937127
TSA22 70040 97061853
TSA23 99922 57201815
TSA24 110032 52097937
TSA25 103116 51778350
TSA26 101845 53640384
TSA27 101699 46128965
TSA28 13624 8614501
TSA29 66220 59270523
TSA3 109975 40913799
TSA30 92600 67995596
TSA31 91392 64594868
TSA32 78714 86314225
TSA33 103047 46070815
TSA34 113079 34914472
TSA35 93836 70176444
TSA36 2112 1500534
TSA37 94687 35571775
TSA38 78620 36299174
TSA39 109341 44676061
TSA4 110065 45517449
TSA40 116437 47138299
TSA41 22643 16977488
TSA42 105982 50234310
TSA43 100439 54422418
TSA44 89580 68296946
TSA45 90589 73571296
TSA46 35138 10891113
TSA47 90399 71322568
TSA48 97571 54486833
TSA49 62913 108042465
TSA5 45423 11642796
TSA50 85439 75882018
TSA51 86233 63222818
TSA52 86360 67566262
TSA53 77742 78893627
TSA54 47671 69732863
TSA55 90605 66610069
TSA56 75924 84434075
TSA57 75363 75755380
TSA58 70635 62157721
TSA59 86644 78135154
TSA6 111608 58989548
TSA60 83656 81544536
TSA61 64829 90463011
TSA62 87304 70844407
TSA63 85576 52138686
TSA64 99116 67787357
TSA65 99642 53410162
TSA66 75547 66538074
TSA67 44523 23875700
TSA68 89929 79960169
TSA69 90764 69533926
TSA7 87587 57991023
TSA70 78679 53875805
TSA71 79619 56783359
TSA72 102372 58740394
TSA73 11697 6440378
TSA74 108728 48398903
TSA75 88607 73686611
TSA76 76866 86493420
TSA77 93182 49901432
TSA78 93430 44364550
TSA79 88575 73970519
TSA8 103411 71945868
TSA80 58475 74485382
TSA81 12365 12212328
TSA82 68511 112244496
TSA83 92752 71643895
TSA84 105411 57089509
TSA85 117326 53642858
TSA86 62444 120412832
TSA87 12933 6093884
TSA88 109175 49378845
TSA89 67049 70014304
TSA9 108865 60366586
TSA90 80457 88837063
TSA91 72654 76075978
TSA92 55504 121200688
TSA93 72298 66388986
TSA94 84628 73090568
TSA95 83568 67487308
TSA96 89927 48091175
TSA97 66473 60653547
TSA98 64087 65481741
TSA99 62776 67314514
UNA1 244 127803
VRL1 67289 69767191
VRL10 66775 68557099
VRL11 50876 67828724
VRL12 62897 71030516
VRL13 57325 72815886
VRL14 63393 64987711
VRL15 56576 73520618
VRL16 38778 46425267
VRL17 54784 72428389
VRL18 59012 71112175
VRL19 56513 73056047
VRL2 73234 64405149
VRL20 55192 74154058
VRL21 53957 79484205
VRL22 33681 31590999
VRL3 69958 60695478
VRL4 68785 69425931
VRL5 53005 55565304
VRL6 48159 77521072
VRL7 46988 72893597
VRL8 60802 69715533
VRL9 61191 73147540
VRT1 45539 117207363
VRT10 1256 189217442
VRT11 8274 177839690
VRT12 3993 136596069
VRT13 13101 170790688
VRT14 5342 182610424
VRT15 3935 185842273
VRT16 37528 134645100
VRT17 79785 68467943
VRT18 78197 66347379
VRT19 31154 25132902
VRT2 1157 194206412
VRT20 71392 77137953
VRT21 46473 121897819
VRT22 77598 62957978
VRT23 78499 62446115
VRT24 80526 57652426
VRT25 103679 65946589
VRT26 83350 54907487
VRT27 53725 40338379
VRT3 72602 78698133
VRT4 8183 173309062
VRT5 31678 33998960
VRT6 73012 66723579
VRT7 31769 63580804
VRT8 30616 112218539
VRT9 1201 189867913
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 192.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:
Entries Bases Species
20038080 16323766903 Homo sapiens
9698460 9975576594 Mus musculus
2188186 6521766255 Rattus norvegicus
2201180 5386471428 Bos taurus
3934468 5062779765 Zea mays
3286972 4888152421 Sus scrofa
1725384 3120424194 Danio rerio
257584 1435236537 Strongylocentrotus purpuratus
453184 1256236621 Macaca mulatta
1348576 1255716225 Oryza sativa Japonica Group
1588281 1249950189 Xenopus (Silurana) tropicalis
1774386 1197402826 Nicotiana tabacum
2331653 1144645070 Arabidopsis thaliana
1778663 1132439488 Triticum aestivum
1253886 1120678925 Drosophila melanogaster
457436 1089324157 Hordeum vulgare subsp. vulgare
216843 1008548378 Pan troglodytes
766866 999034823 Vitis vinifera
1455881 951282544 Canis lupus familiaris
1902893 906665374 Glycine max
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
187 Dec 2011 135117731375 146413798
188 Feb 2012 137384889783 149819246
189 Apr 2012 139266481398 151824421
190 Jun 2012 141343240755 154130210
191 Aug 2012 143081765233 156424033
192 Oct 2012 145430961262 157889737
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
187 Dec 2011 239868309609 73729553
188 Feb 2012 261370512675 78656704
189 Apr 2012 272693351548 80905298
190 Jun 2012 287577367116 82076779
191 Aug 2012 308196411905 84020064
192 Oct 2012 333881846451 86480509
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
October 15 2012
NCBI-GenBank Flat File Release 192.0
Bacterial Sequences (Part 1)
51396 loci, 92682287 bases, from 51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
or 2010.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
June 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA).
Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
DBLINK Project:18787
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("Project"), while the
second contains the actual cross-reference identifier ("18787").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK Project:100,200,300
DBLINK cross-references of type 'Project' are identifiers within the
'Entrez:Project' database at the NCBI:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the
sequencing projects (underway or completed) for Anolis carolinensis, the
centers performing the sequencing and annotation, information about the
organism, etc. For a more detailed overview of Entrez's Project database:
http://www.ncbi.nlm.nih.gov/genomes/static/gprj_help.html#introduction
As of April 2009, the supported DBLINK cross-reference types are "Project"
and "Trace Assembly Archive" .
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 192.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Jianli Dai, Michel Eschenbrenner, Irene Fang,
Michael Fetchko, Linda Frisse, Andrea Gocke, Brian Henson, Anjanette Johnston,
Mark Landree, Jason Lowry, Suzanne Mate, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Beverly Underwood,
Melissa Wright, and Linda Yankie
Data Management and Preparation
Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
Ilya Dondoshansky, J. Bradley Holmes, WonHee Jang, Jonathan Kans,
Leonid Khotomliansky, Michael Kimelman, Michael Kornbluh, Jim Ostell,
Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov
Database Administration
Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
Ben Slade, Constantin Vasilyev
User Support
Peter Cooper, Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris,
Steve Pechous, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
