Release Notes For GenBank Release 193
GBREL.TXT Genetic Sequence Data Bank
December 15 2012
NCBI-GenBank Flat File Release 193.0
Distribution Release Notes
161140325 loci, 148390863904 bases, from 161140325 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 193.0
1.2 Cutoff Date
1.3 Important Changes in Release 193.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 193.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for GenBank's web-based submission tool (BankIt) :
http://www.ncbi.nlm.nih.gov/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 193.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:
http://www.bio-mirror.net/
1.2 Cutoff Date
This full release, 193.0, incorporates data available to the collaborating
databases as of December 12, 2012 at approximately 1:30am EST. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 193.0
1.3.1 Organizational changes
The total number of sequence data files increased by 45 with this release:
- the BCT division is now composed of 94 files (+3)
- the CON division is now composed of 179 files (+3)
- the EST division is now composed of 469 files (+3)
- the GSS division is now composed of 266 files (+6)
- the PAT division is now composed of 186 files (+4)
- the PLN division is now composed of 60 files (+1)
- the ROD division is now composed of 30 files (+1)
- the TSA division is now composed of 133 files (+21)
- the VRL division is now composed of 24 files (+2)
- the VRT division is now composed of 28 files (+1)
The total number of 'index' files increased by 4 with this release:
- the AUT (author name) index is now composed of 106 files (+4)
1.3.2 Correction of /frequency change announced for GenBank 192.0
In Section 1.3.5 of the GenBank 192.0 Release Notes (gbrel.txt),
we incorrectly stated that:
"So as of the October 2012 GenBank release, the /frequency qualifier has
been deprecated. Existing values for the qualifier are now presented via the
/note qualifier of source features, and GenBank submission tools are being
updated to cease support of /frequency."
However, this *only* applies to /frequency qualifiers on source features.
Obviously, the /frequency qualifier provides information that is very
important for any variation feature, and it will continue to be supported
in that context. Only /frequency for source features has been deprecated.
Our apologies for mis-stating the nature of the /frequency change.
1.3.3 Correction of the format for /anticodon qualifiers
Subsequent to the generation of the GenBank Release 192.0 data files,
it was discovered that the new "seq" field for the /anticodon qualifier
was improperly formatted:
a) The sequence of the anticodon was presented in the RNA alphabet
rather than the DNA alphabet.
b) The sequence of the anticodon was presented in uppercase letters
rather than lowercase letters.
Here is an example that illustrates these problems:
LOCUS CP003206 2535346 bp DNA circular BCT 05-JUN-2012
DEFINITION Corynebacterium diphtheriae 31A, complete genome.
ACCESSION CP003206
VERSION CP003206.1 GI:371577018
DBLINK BioProject: PRJNA42399
....
tRNA complement(2017207..2017282)
/locus_tag="CD31A_t050"
/product="tRNA-Thr"
/anticodon=(pos:complement(2017247..2017249),aa:Thr,
seq:UGU)
The proper format for the qualifier is:
/anticodon=(pos:complement(2017247..2017249),aa:Thr,
seq:tgt)
An update of the flatfile generator software was deployed on October 24 2012
which corrected this problem, for records appearing in GenBank Incremental
Update products. And now, this error is also corrected for all of the
anticodon qualifers that appear in the December 2012 GenBank 193.0 data files.
Our apologies for any inconvenience that this may have caused for our users.
1.3.4 Release Catalog data files to replace old "index" files
As described in Section 1.3.5, the legacy "index" files that accompany
the sequence data files of GenBank releases have limited utility. For the
past six years we have provided only partial support for them, and have
warned that we plan to cease support entirely. As of GenBank 193.0 we are
introducing experimental "release catalog" products that will eventually
replace the old "index" files. We expect to make the release catalog(s)
and other supplemental files available shortly after Release 193.0 is
installed at the NCBI FTP site.
Every GenBank sequence record will be represented in the catalog by a
10-field, TAB-delimited row of data. The data fields are:
Accession Number
Accession.Version
NCBI GI Identifier
Molecule Type (dna, rna, mrna, etc)
Sequence Length
Organism Name
NCBI Taxonomy Database Identifier
Division Code
BioProject Accession Number
BioSample Accession Number
When a value does not exist for one of these fields, the field in the catalog
will be empty (eg, two sequential TAB characters can be present, with
nothing between them). Here is an example of the catalog data for CP003933:
CP003933 CP003933.1 429549985 dna 3618794 Sinorhizobium meliloti GR4 1235461 BCT PRJNA175860
It is our hope that the release catalog will be more useful than the current
accession number index files (gbacc*.idx).
The author-name (gbaut*.idx) and keyword (gbkey*.idx) and secondary-accession
(gbsec*.idx) index files will be discontinued without replacements.
However, new "PMID List" and "Gene List" TAB-delimited files will accompany
the release catalog. The format of the PubMed Identifier List is:
Accession1 Accession1.Version PMID-1,PMID-2,PMID-3,.....
Accession2 Accession2.Version PMID-1,PMID-2,PMID-3,.....
....
And the format of the Gene List is:
Accession1 Accession1.Version Gene-Symbol-1 Locus-Tag-1
Accession1 Accession1.Version Gene-Symbol-2 Locus-Tag-2
Accession1 Accession1.Version Gene-Symbol-3 Locus-Tag-3
Accession2 Accession2.Version Gene-Symbol-1 Locus-Tag-1
Accession2 Accession2.Version Gene-Symbol-2 Locus-Tag-2
Accession2 Accession2.Version Gene-Symbol-3 Locus-Tag-3
....
Note that either Gene Symbol or Locus Tag could be null for any given
gene.
For now, we plan to provide the release catalog and accompanying lists
via files that are specific to EST, GSS, and non-EST/GSS (everything else).
And, initially, the catalogs and lists will not include the contig
sequence records for WGS projects. The new files will be made available
in a new sub-directory of the GenBank FTP area:
genbank/catalog
And their names will be:
gb193.est.catalog.txt.gz
gb193.gss.catalog.txt.gz
gb193.other.catalog.txt.gz
gb193.est.pmid_list.txt.gz
gb193.gss.pmid_list.txt.gz
gb193.other.pmid_list.txt.gz
gb193.est.gene_list.txt.gz
gb193.gss.gene_list.txt.gz
gb193.other.gene_list.txt.gz
Our goal is to provide companion products for the release files which will
be of help for large-scale consumers of GenBank data. To that end, if you
have ideas for how to make the release catalog more useful, or have
suggestions for additional companion files like the PMID and Gene lists,
please let us know by contacting the NCBI Help Desk : [email protected] .
Be aware that these new products are still in the experimental stage.
If you encounter problems with their content, we would appreciate your
feedback (again, via the NCBI Help Desk).
1.3.5 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics from January 2005
seemed to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.6 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for 111
of the GSS flatfiles in Release 193.0. Consider gbgss156.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
December 15 2012
NCBI-GenBank Flat File Release 193.0
GSS Sequences (Part 1)
87073 loci, 63907368 bases, from 87073 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "156" based on the number of files dumped from the other
system. We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.
1.4 Upcoming Changes
No changes impacting the flatfile format are expected between the
December 2012 and February 2013 GenBank releases.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1936 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut100.idx - Index of the entries according to author name, part 100.
7. gbaut101.idx - Index of the entries according to author name, part 101.
8. gbaut102.idx - Index of the entries according to author name, part 102.
9. gbaut103.idx - Index of the entries according to author name, part 103.
10. gbaut104.idx - Index of the entries according to author name, part 104.
11. gbaut105.idx - Index of the entries according to author name, part 105.
12. gbaut106.idx - Index of the entries according to author name, part 106.
13. gbaut11.idx - Index of the entries according to author name, part 11.
14. gbaut12.idx - Index of the entries according to author name, part 12.
15. gbaut13.idx - Index of the entries according to author name, part 13.
16. gbaut14.idx - Index of the entries according to author name, part 14.
17. gbaut15.idx - Index of the entries according to author name, part 15.
18. gbaut16.idx - Index of the entries according to author name, part 16.
19. gbaut17.idx - Index of the entries according to author name, part 17.
20. gbaut18.idx - Index of the entries according to author name, part 18.
21. gbaut19.idx - Index of the entries according to author name, part 19.
22. gbaut2.idx - Index of the entries according to author name, part 2.
23. gbaut20.idx - Index of the entries according to author name, part 20.
24. gbaut21.idx - Index of the entries according to author name, part 21.
25. gbaut22.idx - Index of the entries according to author name, part 22.
26. gbaut23.idx - Index of the entries according to author name, part 23.
27. gbaut24.idx - Index of the entries according to author name, part 24.
28. gbaut25.idx - Index of the entries according to author name, part 25.
29. gbaut26.idx - Index of the entries according to author name, part 26.
30. gbaut27.idx - Index of the entries according to author name, part 27.
31. gbaut28.idx - Index of the entries according to author name, part 28.
32. gbaut29.idx - Index of the entries according to author name, part 29.
33. gbaut3.idx - Index of the entries according to author name, part 3.
34. gbaut30.idx - Index of the entries according to author name, part 30.
35. gbaut31.idx - Index of the entries according to author name, part 31.
36. gbaut32.idx - Index of the entries according to author name, part 32.
37. gbaut33.idx - Index of the entries according to author name, part 33.
38. gbaut34.idx - Index of the entries according to author name, part 34.
39. gbaut35.idx - Index of the entries according to author name, part 35.
40. gbaut36.idx - Index of the entries according to author name, part 36.
41. gbaut37.idx - Index of the entries according to author name, part 37.
42. gbaut38.idx - Index of the entries according to author name, part 38.
43. gbaut39.idx - Index of the entries according to author name, part 39.
44. gbaut4.idx - Index of the entries according to author name, part 4.
45. gbaut40.idx - Index of the entries according to author name, part 40.
46. gbaut41.idx - Index of the entries according to author name, part 41.
47. gbaut42.idx - Index of the entries according to author name, part 42.
48. gbaut43.idx - Index of the entries according to author name, part 43.
49. gbaut44.idx - Index of the entries according to author name, part 44.
50. gbaut45.idx - Index of the entries according to author name, part 45.
51. gbaut46.idx - Index of the entries according to author name, part 46.
52. gbaut47.idx - Index of the entries according to author name, part 47.
53. gbaut48.idx - Index of the entries according to author name, part 48.
54. gbaut49.idx - Index of the entries according to author name, part 49.
55. gbaut5.idx - Index of the entries according to author name, part 5.
56. gbaut50.idx - Index of the entries according to author name, part 50.
57. gbaut51.idx - Index of the entries according to author name, part 51.
58. gbaut52.idx - Index of the entries according to author name, part 52.
59. gbaut53.idx - Index of the entries according to author name, part 53.
60. gbaut54.idx - Index of the entries according to author name, part 54.
61. gbaut55.idx - Index of the entries according to author name, part 55.
62. gbaut56.idx - Index of the entries according to author name, part 56.
63. gbaut57.idx - Index of the entries according to author name, part 57.
64. gbaut58.idx - Index of the entries according to author name, part 58.
65. gbaut59.idx - Index of the entries according to author name, part 59.
66. gbaut6.idx - Index of the entries according to author name, part 6.
67. gbaut60.idx - Index of the entries according to author name, part 60.
68. gbaut61.idx - Index of the entries according to author name, part 61.
69. gbaut62.idx - Index of the entries according to author name, part 62.
70. gbaut63.idx - Index of the entries according to author name, part 63.
71. gbaut64.idx - Index of the entries according to author name, part 64.
72. gbaut65.idx - Index of the entries according to author name, part 65.
73. gbaut66.idx - Index of the entries according to author name, part 66.
74. gbaut67.idx - Index of the entries according to author name, part 67.
75. gbaut68.idx - Index of the entries according to author name, part 68.
76. gbaut69.idx - Index of the entries according to author name, part 69.
77. gbaut7.idx - Index of the entries according to author name, part 7.
78. gbaut70.idx - Index of the entries according to author name, part 70.
79. gbaut71.idx - Index of the entries according to author name, part 71.
80. gbaut72.idx - Index of the entries according to author name, part 72.
81. gbaut73.idx - Index of the entries according to author name, part 73.
82. gbaut74.idx - Index of the entries according to author name, part 74.
83. gbaut75.idx - Index of the entries according to author name, part 75.
84. gbaut76.idx - Index of the entries according to author name, part 76.
85. gbaut77.idx - Index of the entries according to author name, part 77.
86. gbaut78.idx - Index of the entries according to author name, part 78.
87. gbaut79.idx - Index of the entries according to author name, part 79.
88. gbaut8.idx - Index of the entries according to author name, part 8.
89. gbaut80.idx - Index of the entries according to author name, part 80.
90. gbaut81.idx - Index of the entries according to author name, part 81.
91. gbaut82.idx - Index of the entries according to author name, part 82.
92. gbaut83.idx - Index of the entries according to author name, part 83.
93. gbaut84.idx - Index of the entries according to author name, part 84.
94. gbaut85.idx - Index of the entries according to author name, part 85.
95. gbaut86.idx - Index of the entries according to author name, part 86.
96. gbaut87.idx - Index of the entries according to author name, part 87.
97. gbaut88.idx - Index of the entries according to author name, part 88.
98. gbaut89.idx - Index of the entries according to author name, part 89.
99. gbaut9.idx - Index of the entries according to author name, part 9.
100. gbaut90.idx - Index of the entries according to author name, part 90.
101. gbaut91.idx - Index of the entries according to author name, part 91.
102. gbaut92.idx - Index of the entries according to author name, part 92.
103. gbaut93.idx - Index of the entries according to author name, part 93.
104. gbaut94.idx - Index of the entries according to author name, part 94.
105. gbaut95.idx - Index of the entries according to author name, part 95.
106. gbaut96.idx - Index of the entries according to author name, part 96.
107. gbaut97.idx - Index of the entries according to author name, part 97.
108. gbaut98.idx - Index of the entries according to author name, part 98.
109. gbaut99.idx - Index of the entries according to author name, part 99.
110. gbbct1.seq - Bacterial sequence entries, part 1.
111. gbbct10.seq - Bacterial sequence entries, part 10.
112. gbbct11.seq - Bacterial sequence entries, part 11.
113. gbbct12.seq - Bacterial sequence entries, part 12.
114. gbbct13.seq - Bacterial sequence entries, part 13.
115. gbbct14.seq - Bacterial sequence entries, part 14.
116. gbbct15.seq - Bacterial sequence entries, part 15.
117. gbbct16.seq - Bacterial sequence entries, part 16.
118. gbbct17.seq - Bacterial sequence entries, part 17.
119. gbbct18.seq - Bacterial sequence entries, part 18.
120. gbbct19.seq - Bacterial sequence entries, part 19.
121. gbbct2.seq - Bacterial sequence entries, part 2.
122. gbbct20.seq - Bacterial sequence entries, part 20.
123. gbbct21.seq - Bacterial sequence entries, part 21.
124. gbbct22.seq - Bacterial sequence entries, part 22.
125. gbbct23.seq - Bacterial sequence entries, part 23.
126. gbbct24.seq - Bacterial sequence entries, part 24.
127. gbbct25.seq - Bacterial sequence entries, part 25.
128. gbbct26.seq - Bacterial sequence entries, part 26.
129. gbbct27.seq - Bacterial sequence entries, part 27.
130. gbbct28.seq - Bacterial sequence entries, part 28.
131. gbbct29.seq - Bacterial sequence entries, part 29.
132. gbbct3.seq - Bacterial sequence entries, part 3.
133. gbbct30.seq - Bacterial sequence entries, part 30.
134. gbbct31.seq - Bacterial sequence entries, part 31.
135. gbbct32.seq - Bacterial sequence entries, part 32.
136. gbbct33.seq - Bacterial sequence entries, part 33.
137. gbbct34.seq - Bacterial sequence entries, part 34.
138. gbbct35.seq - Bacterial sequence entries, part 35.
139. gbbct36.seq - Bacterial sequence entries, part 36.
140. gbbct37.seq - Bacterial sequence entries, part 37.
141. gbbct38.seq - Bacterial sequence entries, part 38.
142. gbbct39.seq - Bacterial sequence entries, part 39.
143. gbbct4.seq - Bacterial sequence entries, part 4.
144. gbbct40.seq - Bacterial sequence entries, part 40.
145. gbbct41.seq - Bacterial sequence entries, part 41.
146. gbbct42.seq - Bacterial sequence entries, part 42.
147. gbbct43.seq - Bacterial sequence entries, part 43.
148. gbbct44.seq - Bacterial sequence entries, part 44.
149. gbbct45.seq - Bacterial sequence entries, part 45.
150. gbbct46.seq - Bacterial sequence entries, part 46.
151. gbbct47.seq - Bacterial sequence entries, part 47.
152. gbbct48.seq - Bacterial sequence entries, part 48.
153. gbbct49.seq - Bacterial sequence entries, part 49.
154. gbbct5.seq - Bacterial sequence entries, part 5.
155. gbbct50.seq - Bacterial sequence entries, part 50.
156. gbbct51.seq - Bacterial sequence entries, part 51.
157. gbbct52.seq - Bacterial sequence entries, part 52.
158. gbbct53.seq - Bacterial sequence entries, part 53.
159. gbbct54.seq - Bacterial sequence entries, part 54.
160. gbbct55.seq - Bacterial sequence entries, part 55.
161. gbbct56.seq - Bacterial sequence entries, part 56.
162. gbbct57.seq - Bacterial sequence entries, part 57.
163. gbbct58.seq - Bacterial sequence entries, part 58.
164. gbbct59.seq - Bacterial sequence entries, part 59.
165. gbbct6.seq - Bacterial sequence entries, part 6.
166. gbbct60.seq - Bacterial sequence entries, part 60.
167. gbbct61.seq - Bacterial sequence entries, part 61.
168. gbbct62.seq - Bacterial sequence entries, part 62.
169. gbbct63.seq - Bacterial sequence entries, part 63.
170. gbbct64.seq - Bacterial sequence entries, part 64.
171. gbbct65.seq - Bacterial sequence entries, part 65.
172. gbbct66.seq - Bacterial sequence entries, part 66.
173. gbbct67.seq - Bacterial sequence entries, part 67.
174. gbbct68.seq - Bacterial sequence entries, part 68.
175. gbbct69.seq - Bacterial sequence entries, part 69.
176. gbbct7.seq - Bacterial sequence entries, part 7.
177. gbbct70.seq - Bacterial sequence entries, part 70.
178. gbbct71.seq - Bacterial sequence entries, part 71.
179. gbbct72.seq - Bacterial sequence entries, part 72.
180. gbbct73.seq - Bacterial sequence entries, part 73.
181. gbbct74.seq - Bacterial sequence entries, part 74.
182. gbbct75.seq - Bacterial sequence entries, part 75.
183. gbbct76.seq - Bacterial sequence entries, part 76.
184. gbbct77.seq - Bacterial sequence entries, part 77.
185. gbbct78.seq - Bacterial sequence entries, part 78.
186. gbbct79.seq - Bacterial sequence entries, part 79.
187. gbbct8.seq - Bacterial sequence entries, part 8.
188. gbbct80.seq - Bacterial sequence entries, part 80.
189. gbbct81.seq - Bacterial sequence entries, part 81.
190. gbbct82.seq - Bacterial sequence entries, part 82.
191. gbbct83.seq - Bacterial sequence entries, part 83.
192. gbbct84.seq - Bacterial sequence entries, part 84.
193. gbbct85.seq - Bacterial sequence entries, part 85.
194. gbbct86.seq - Bacterial sequence entries, part 86.
195. gbbct87.seq - Bacterial sequence entries, part 87.
196. gbbct88.seq - Bacterial sequence entries, part 88.
197. gbbct89.seq - Bacterial sequence entries, part 89.
198. gbbct9.seq - Bacterial sequence entries, part 9.
199. gbbct90.seq - Bacterial sequence entries, part 90.
200. gbbct91.seq - Bacterial sequence entries, part 91.
201. gbbct92.seq - Bacterial sequence entries, part 92.
202. gbbct93.seq - Bacterial sequence entries, part 93.
203. gbbct94.seq - Bacterial sequence entries, part 94.
204. gbchg.txt - Accession numbers of entries updated since the previous release.
205. gbcon1.seq - Constructed sequence entries, part 1.
206. gbcon10.seq - Constructed sequence entries, part 10.
207. gbcon100.seq - Constructed sequence entries, part 100.
208. gbcon101.seq - Constructed sequence entries, part 101.
209. gbcon102.seq - Constructed sequence entries, part 102.
210. gbcon103.seq - Constructed sequence entries, part 103.
211. gbcon104.seq - Constructed sequence entries, part 104.
212. gbcon105.seq - Constructed sequence entries, part 105.
213. gbcon106.seq - Constructed sequence entries, part 106.
214. gbcon107.seq - Constructed sequence entries, part 107.
215. gbcon108.seq - Constructed sequence entries, part 108.
216. gbcon109.seq - Constructed sequence entries, part 109.
217. gbcon11.seq - Constructed sequence entries, part 11.
218. gbcon110.seq - Constructed sequence entries, part 110.
219. gbcon111.seq - Constructed sequence entries, part 111.
220. gbcon112.seq - Constructed sequence entries, part 112.
221. gbcon113.seq - Constructed sequence entries, part 113.
222. gbcon114.seq - Constructed sequence entries, part 114.
223. gbcon115.seq - Constructed sequence entries, part 115.
224. gbcon116.seq - Constructed sequence entries, part 116.
225. gbcon117.seq - Constructed sequence entries, part 117.
226. gbcon118.seq - Constructed sequence entries, part 118.
227. gbcon119.seq - Constructed sequence entries, part 119.
228. gbcon12.seq - Constructed sequence entries, part 12.
229. gbcon120.seq - Constructed sequence entries, part 120.
230. gbcon121.seq - Constructed sequence entries, part 121.
231. gbcon122.seq - Constructed sequence entries, part 122.
232. gbcon123.seq - Constructed sequence entries, part 123.
233. gbcon124.seq - Constructed sequence entries, part 124.
234. gbcon125.seq - Constructed sequence entries, part 125.
235. gbcon126.seq - Constructed sequence entries, part 126.
236. gbcon127.seq - Constructed sequence entries, part 127.
237. gbcon128.seq - Constructed sequence entries, part 128.
238. gbcon129.seq - Constructed sequence entries, part 129.
239. gbcon13.seq - Constructed sequence entries, part 13.
240. gbcon130.seq - Constructed sequence entries, part 130.
241. gbcon131.seq - Constructed sequence entries, part 131.
242. gbcon132.seq - Constructed sequence entries, part 132.
243. gbcon133.seq - Constructed sequence entries, part 133.
244. gbcon134.seq - Constructed sequence entries, part 134.
245. gbcon135.seq - Constructed sequence entries, part 135.
246. gbcon136.seq - Constructed sequence entries, part 136.
247. gbcon137.seq - Constructed sequence entries, part 137.
248. gbcon138.seq - Constructed sequence entries, part 138.
249. gbcon139.seq - Constructed sequence entries, part 139.
250. gbcon14.seq - Constructed sequence entries, part 14.
251. gbcon140.seq - Constructed sequence entries, part 140.
252. gbcon141.seq - Constructed sequence entries, part 141.
253. gbcon142.seq - Constructed sequence entries, part 142.
254. gbcon143.seq - Constructed sequence entries, part 143.
255. gbcon144.seq - Constructed sequence entries, part 144.
256. gbcon145.seq - Constructed sequence entries, part 145.
257. gbcon146.seq - Constructed sequence entries, part 146.
258. gbcon147.seq - Constructed sequence entries, part 147.
259. gbcon148.seq - Constructed sequence entries, part 148.
260. gbcon149.seq - Constructed sequence entries, part 149.
261. gbcon15.seq - Constructed sequence entries, part 15.
262. gbcon150.seq - Constructed sequence entries, part 150.
263. gbcon151.seq - Constructed sequence entries, part 151.
264. gbcon152.seq - Constructed sequence entries, part 152.
265. gbcon153.seq - Constructed sequence entries, part 153.
266. gbcon154.seq - Constructed sequence entries, part 154.
267. gbcon155.seq - Constructed sequence entries, part 155.
268. gbcon156.seq - Constructed sequence entries, part 156.
269. gbcon157.seq - Constructed sequence entries, part 157.
270. gbcon158.seq - Constructed sequence entries, part 158.
271. gbcon159.seq - Constructed sequence entries, part 159.
272. gbcon16.seq - Constructed sequence entries, part 16.
273. gbcon160.seq - Constructed sequence entries, part 160.
274. gbcon161.seq - Constructed sequence entries, part 161.
275. gbcon162.seq - Constructed sequence entries, part 162.
276. gbcon163.seq - Constructed sequence entries, part 163.
277. gbcon164.seq - Constructed sequence entries, part 164.
278. gbcon165.seq - Constructed sequence entries, part 165.
279. gbcon166.seq - Constructed sequence entries, part 166.
280. gbcon167.seq - Constructed sequence entries, part 167.
281. gbcon168.seq - Constructed sequence entries, part 168.
282. gbcon169.seq - Constructed sequence entries, part 169.
283. gbcon17.seq - Constructed sequence entries, part 17.
284. gbcon170.seq - Constructed sequence entries, part 170.
285. gbcon171.seq - Constructed sequence entries, part 171.
286. gbcon172.seq - Constructed sequence entries, part 172.
287. gbcon173.seq - Constructed sequence entries, part 173.
288. gbcon174.seq - Constructed sequence entries, part 174.
289. gbcon175.seq - Constructed sequence entries, part 175.
290. gbcon176.seq - Constructed sequence entries, part 176.
291. gbcon177.seq - Constructed sequence entries, part 177.
292. gbcon178.seq - Constructed sequence entries, part 178.
293. gbcon179.seq - Constructed sequence entries, part 179.
294. gbcon18.seq - Constructed sequence entries, part 18.
295. gbcon19.seq - Constructed sequence entries, part 19.
296. gbcon2.seq - Constructed sequence entries, part 2.
297. gbcon20.seq - Constructed sequence entries, part 20.
298. gbcon21.seq - Constructed sequence entries, part 21.
299. gbcon22.seq - Constructed sequence entries, part 22.
300. gbcon23.seq - Constructed sequence entries, part 23.
301. gbcon24.seq - Constructed sequence entries, part 24.
302. gbcon25.seq - Constructed sequence entries, part 25.
303. gbcon26.seq - Constructed sequence entries, part 26.
304. gbcon27.seq - Constructed sequence entries, part 27.
305. gbcon28.seq - Constructed sequence entries, part 28.
306. gbcon29.seq - Constructed sequence entries, part 29.
307. gbcon3.seq - Constructed sequence entries, part 3.
308. gbcon30.seq - Constructed sequence entries, part 30.
309. gbcon31.seq - Constructed sequence entries, part 31.
310. gbcon32.seq - Constructed sequence entries, part 32.
311. gbcon33.seq - Constructed sequence entries, part 33.
312. gbcon34.seq - Constructed sequence entries, part 34.
313. gbcon35.seq - Constructed sequence entries, part 35.
314. gbcon36.seq - Constructed sequence entries, part 36.
315. gbcon37.seq - Constructed sequence entries, part 37.
316. gbcon38.seq - Constructed sequence entries, part 38.
317. gbcon39.seq - Constructed sequence entries, part 39.
318. gbcon4.seq - Constructed sequence entries, part 4.
319. gbcon40.seq - Constructed sequence entries, part 40.
320. gbcon41.seq - Constructed sequence entries, part 41.
321. gbcon42.seq - Constructed sequence entries, part 42.
322. gbcon43.seq - Constructed sequence entries, part 43.
323. gbcon44.seq - Constructed sequence entries, part 44.
324. gbcon45.seq - Constructed sequence entries, part 45.
325. gbcon46.seq - Constructed sequence entries, part 46.
326. gbcon47.seq - Constructed sequence entries, part 47.
327. gbcon48.seq - Constructed sequence entries, part 48.
328. gbcon49.seq - Constructed sequence entries, part 49.
329. gbcon5.seq - Constructed sequence entries, part 5.
330. gbcon50.seq - Constructed sequence entries, part 50.
331. gbcon51.seq - Constructed sequence entries, part 51.
332. gbcon52.seq - Constructed sequence entries, part 52.
333. gbcon53.seq - Constructed sequence entries, part 53.
334. gbcon54.seq - Constructed sequence entries, part 54.
335. gbcon55.seq - Constructed sequence entries, part 55.
336. gbcon56.seq - Constructed sequence entries, part 56.
337. gbcon57.seq - Constructed sequence entries, part 57.
338. gbcon58.seq - Constructed sequence entries, part 58.
339. gbcon59.seq - Constructed sequence entries, part 59.
340. gbcon6.seq - Constructed sequence entries, part 6.
341. gbcon60.seq - Constructed sequence entries, part 60.
342. gbcon61.seq - Constructed sequence entries, part 61.
343. gbcon62.seq - Constructed sequence entries, part 62.
344. gbcon63.seq - Constructed sequence entries, part 63.
345. gbcon64.seq - Constructed sequence entries, part 64.
346. gbcon65.seq - Constructed sequence entries, part 65.
347. gbcon66.seq - Constructed sequence entries, part 66.
348. gbcon67.seq - Constructed sequence entries, part 67.
349. gbcon68.seq - Constructed sequence entries, part 68.
350. gbcon69.seq - Constructed sequence entries, part 69.
351. gbcon7.seq - Constructed sequence entries, part 7.
352. gbcon70.seq - Constructed sequence entries, part 70.
353. gbcon71.seq - Constructed sequence entries, part 71.
354. gbcon72.seq - Constructed sequence entries, part 72.
355. gbcon73.seq - Constructed sequence entries, part 73.
356. gbcon74.seq - Constructed sequence entries, part 74.
357. gbcon75.seq - Constructed sequence entries, part 75.
358. gbcon76.seq - Constructed sequence entries, part 76.
359. gbcon77.seq - Constructed sequence entries, part 77.
360. gbcon78.seq - Constructed sequence entries, part 78.
361. gbcon79.seq - Constructed sequence entries, part 79.
362. gbcon8.seq - Constructed sequence entries, part 8.
363. gbcon80.seq - Constructed sequence entries, part 80.
364. gbcon81.seq - Constructed sequence entries, part 81.
365. gbcon82.seq - Constructed sequence entries, part 82.
366. gbcon83.seq - Constructed sequence entries, part 83.
367. gbcon84.seq - Constructed sequence entries, part 84.
368. gbcon85.seq - Constructed sequence entries, part 85.
369. gbcon86.seq - Constructed sequence entries, part 86.
370. gbcon87.seq - Constructed sequence entries, part 87.
371. gbcon88.seq - Constructed sequence entries, part 88.
372. gbcon89.seq - Constructed sequence entries, part 89.
373. gbcon9.seq - Constructed sequence entries, part 9.
374. gbcon90.seq - Constructed sequence entries, part 90.
375. gbcon91.seq - Constructed sequence entries, part 91.
376. gbcon92.seq - Constructed sequence entries, part 92.
377. gbcon93.seq - Constructed sequence entries, part 93.
378. gbcon94.seq - Constructed sequence entries, part 94.
379. gbcon95.seq - Constructed sequence entries, part 95.
380. gbcon96.seq - Constructed sequence entries, part 96.
381. gbcon97.seq - Constructed sequence entries, part 97.
382. gbcon98.seq - Constructed sequence entries, part 98.
383. gbcon99.seq - Constructed sequence entries, part 99.
384. gbdel.txt - Accession numbers of entries deleted since the previous release.
385. gbenv1.seq - Environmental sampling sequence entries, part 1.
386. gbenv10.seq - Environmental sampling sequence entries, part 10.
387. gbenv11.seq - Environmental sampling sequence entries, part 11.
388. gbenv12.seq - Environmental sampling sequence entries, part 12.
389. gbenv13.seq - Environmental sampling sequence entries, part 13.
390. gbenv14.seq - Environmental sampling sequence entries, part 14.
391. gbenv15.seq - Environmental sampling sequence entries, part 15.
392. gbenv16.seq - Environmental sampling sequence entries, part 16.
393. gbenv17.seq - Environmental sampling sequence entries, part 17.
394. gbenv18.seq - Environmental sampling sequence entries, part 18.
395. gbenv19.seq - Environmental sampling sequence entries, part 19.
396. gbenv2.seq - Environmental sampling sequence entries, part 2.
397. gbenv20.seq - Environmental sampling sequence entries, part 20.
398. gbenv21.seq - Environmental sampling sequence entries, part 21.
399. gbenv22.seq - Environmental sampling sequence entries, part 22.
400. gbenv23.seq - Environmental sampling sequence entries, part 23.
401. gbenv24.seq - Environmental sampling sequence entries, part 24.
402. gbenv25.seq - Environmental sampling sequence entries, part 25.
403. gbenv26.seq - Environmental sampling sequence entries, part 26.
404. gbenv27.seq - Environmental sampling sequence entries, part 27.
405. gbenv28.seq - Environmental sampling sequence entries, part 28.
406. gbenv29.seq - Environmental sampling sequence entries, part 29.
407. gbenv3.seq - Environmental sampling sequence entries, part 3.
408. gbenv30.seq - Environmental sampling sequence entries, part 30.
409. gbenv31.seq - Environmental sampling sequence entries, part 31.
410. gbenv32.seq - Environmental sampling sequence entries, part 32.
411. gbenv33.seq - Environmental sampling sequence entries, part 33.
412. gbenv34.seq - Environmental sampling sequence entries, part 34.
413. gbenv35.seq - Environmental sampling sequence entries, part 35.
414. gbenv36.seq - Environmental sampling sequence entries, part 36.
415. gbenv37.seq - Environmental sampling sequence entries, part 37.
416. gbenv38.seq - Environmental sampling sequence entries, part 38.
417. gbenv39.seq - Environmental sampling sequence entries, part 39.
418. gbenv4.seq - Environmental sampling sequence entries, part 4.
419. gbenv40.seq - Environmental sampling sequence entries, part 40.
420. gbenv41.seq - Environmental sampling sequence entries, part 41.
421. gbenv42.seq - Environmental sampling sequence entries, part 42.
422. gbenv43.seq - Environmental sampling sequence entries, part 43.
423. gbenv44.seq - Environmental sampling sequence entries, part 44.
424. gbenv45.seq - Environmental sampling sequence entries, part 45.
425. gbenv46.seq - Environmental sampling sequence entries, part 46.
426. gbenv47.seq - Environmental sampling sequence entries, part 47.
427. gbenv48.seq - Environmental sampling sequence entries, part 48.
428. gbenv49.seq - Environmental sampling sequence entries, part 49.
429. gbenv5.seq - Environmental sampling sequence entries, part 5.
430. gbenv50.seq - Environmental sampling sequence entries, part 50.
431. gbenv51.seq - Environmental sampling sequence entries, part 51.
432. gbenv52.seq - Environmental sampling sequence entries, part 52.
433. gbenv53.seq - Environmental sampling sequence entries, part 53.
434. gbenv54.seq - Environmental sampling sequence entries, part 54.
435. gbenv55.seq - Environmental sampling sequence entries, part 55.
436. gbenv56.seq - Environmental sampling sequence entries, part 56.
437. gbenv57.seq - Environmental sampling sequence entries, part 57.
438. gbenv6.seq - Environmental sampling sequence entries, part 6.
439. gbenv7.seq - Environmental sampling sequence entries, part 7.
440. gbenv8.seq - Environmental sampling sequence entries, part 8.
441. gbenv9.seq - Environmental sampling sequence entries, part 9.
442. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
443. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
444. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
445. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
446. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
447. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
448. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
449. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
450. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
451. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
452. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
453. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
454. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
455. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
456. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
457. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
458. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
459. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
460. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
461. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
462. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
463. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
464. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
465. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
466. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
467. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
468. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
469. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
470. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
471. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
472. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
473. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
474. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
475. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
476. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
477. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
478. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
479. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
480. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
481. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
482. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
483. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
484. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
485. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
486. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
487. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
488. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
489. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
490. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
491. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
492. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
493. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
494. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
495. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
496. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
497. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
498. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
499. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
500. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
501. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
502. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
503. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
504. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
505. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
506. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
507. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
508. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
509. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
510. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
511. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
512. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
513. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
514. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
515. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
516. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
517. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
518. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
519. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
520. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
521. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
522. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
523. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
524. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
525. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
526. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
527. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
528. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
529. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
530. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
531. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
532. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
533. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
534. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
535. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
536. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
537. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
538. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
539. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
540. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
541. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
542. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
543. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
544. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
545. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
546. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
547. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
548. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
549. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
550. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
551. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
552. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
553. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
554. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
555. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
556. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
557. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
558. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
559. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
560. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
561. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
562. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
563. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
564. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
565. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
566. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
567. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
568. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
569. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
570. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
571. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
572. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
573. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
574. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
575. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
576. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
577. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
578. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
579. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
580. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
581. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
582. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
583. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
584. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
585. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
586. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
587. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
588. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
589. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
590. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
591. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
592. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
593. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
594. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
595. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
596. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
597. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
598. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
599. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
600. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
601. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
602. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
603. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
604. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
605. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
606. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
607. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
608. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
609. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
610. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
611. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
612. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
613. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
614. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
615. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
616. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
617. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
618. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
619. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
620. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
621. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
622. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
623. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
624. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
625. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
626. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
627. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
628. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
629. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
630. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
631. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
632. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
633. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
634. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
635. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
636. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
637. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
638. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
639. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
640. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
641. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
642. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
643. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
644. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
645. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
646. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
647. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
648. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
649. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
650. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
651. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
652. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
653. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
654. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
655. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
656. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
657. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
658. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
659. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
660. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
661. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
662. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
663. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
664. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
665. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
666. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
667. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
668. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
669. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
670. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
671. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
672. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
673. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
674. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
675. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
676. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
677. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
678. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
679. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
680. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
681. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
682. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
683. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
684. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
685. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
686. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
687. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
688. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
689. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
690. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
691. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
692. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
693. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
694. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
695. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
696. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
697. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
698. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
699. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
700. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
701. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
702. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
703. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
704. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
705. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
706. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
707. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
708. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
709. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
710. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
711. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
712. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
713. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
714. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
715. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
716. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
717. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
718. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
719. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
720. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
721. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
722. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
723. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
724. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
725. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
726. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
727. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
728. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
729. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
730. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
731. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
732. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
733. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
734. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
735. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
736. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
737. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
738. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
739. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
740. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
741. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
742. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
743. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
744. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
745. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
746. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
747. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
748. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
749. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
750. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
751. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
752. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
753. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
754. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
755. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
756. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
757. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
758. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
759. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
760. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
761. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
762. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
763. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
764. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
765. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
766. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
767. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
768. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
769. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
770. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
771. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
772. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
773. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
774. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
775. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
776. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
777. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
778. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
779. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
780. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
781. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
782. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
783. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
784. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
785. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
786. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
787. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
788. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
789. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
790. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
791. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
792. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
793. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
794. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
795. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
796. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
797. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
798. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
799. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
800. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
801. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
802. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
803. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
804. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
805. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
806. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
807. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
808. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
809. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
810. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
811. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
812. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
813. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
814. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
815. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
816. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
817. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
818. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
819. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
820. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
821. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
822. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
823. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
824. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
825. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
826. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
827. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
828. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
829. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
830. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
831. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
832. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
833. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
834. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
835. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
836. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
837. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
838. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
839. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
840. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
841. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
842. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
843. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
844. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
845. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
846. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
847. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
848. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
849. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
850. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
851. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
852. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
853. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
854. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
855. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
856. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
857. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
858. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
859. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
860. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
861. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
862. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
863. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
864. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
865. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
866. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
867. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
868. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
869. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
870. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
871. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
872. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
873. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
874. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
875. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
876. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
877. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
878. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
879. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
880. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
881. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
882. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
883. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
884. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
885. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
886. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
887. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
888. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
889. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
890. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
891. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
892. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
893. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
894. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
895. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
896. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
897. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
898. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
899. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
900. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
901. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
902. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
903. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
904. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
905. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
906. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
907. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
908. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
909. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
910. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
911. gbgen.idx - Index of the entries according to gene symbols.
912. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
913. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
914. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
915. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
916. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
917. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
918. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
919. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
920. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
921. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
922. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
923. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
924. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
925. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
926. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
927. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
928. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
929. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
930. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
931. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
932. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
933. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
934. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
935. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
936. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
937. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
938. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
939. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
940. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
941. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
942. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
943. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
944. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
945. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
946. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
947. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
948. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
949. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
950. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
951. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
952. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
953. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
954. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
955. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
956. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
957. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
958. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
959. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
960. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
961. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
962. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
963. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
964. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
965. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
966. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
967. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
968. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
969. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
970. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
971. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
972. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
973. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
974. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
975. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
976. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
977. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
978. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
979. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
980. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
981. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
982. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
983. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
984. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
985. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
986. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
987. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
988. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
989. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
990. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
991. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
992. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
993. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
994. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
995. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
996. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
997. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
998. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
999. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1000. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1001. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1002. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1003. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1004. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1005. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1006. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1007. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1008. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1009. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1010. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1011. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1012. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1013. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1014. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1015. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1016. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1017. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1018. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1019. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1020. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1021. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1022. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1023. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1024. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1025. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1026. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1027. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1028. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1029. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1030. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1031. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1032. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1033. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1034. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1035. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1036. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1037. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1038. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1039. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1040. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1041. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1042. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1043. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1044. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1045. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1046. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1047. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1048. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1049. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1050. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1051. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1052. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1053. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1054. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1055. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1056. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1057. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1058. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1059. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1060. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1061. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1062. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1063. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1064. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1065. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1066. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1067. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1068. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1069. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1070. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1071. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1072. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1073. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1074. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1075. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1076. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1077. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1078. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1079. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1080. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1081. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1082. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1083. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1084. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1085. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1086. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1087. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1088. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1089. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1090. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1091. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1092. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1093. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1094. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1095. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1096. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1097. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1098. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1099. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1100. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1101. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1102. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1103. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1104. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1105. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1106. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1107. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1108. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1109. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1110. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1111. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1112. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1113. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1114. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1115. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1116. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1117. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1118. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1119. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1120. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1121. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1122. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1123. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1124. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1125. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1126. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1127. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1128. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1129. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1130. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1131. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1132. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1133. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1134. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1135. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1136. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1137. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1138. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1139. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1140. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1141. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1142. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1143. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1144. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1145. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1146. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1147. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1148. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1149. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1150. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1151. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1152. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1153. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1154. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1155. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1156. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1157. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1158. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1159. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1160. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1161. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1162. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1163. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1164. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1165. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1166. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1167. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1168. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1169. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1170. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1171. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1172. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1173. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1174. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1175. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1176. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1177. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1178. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1179. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1180. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1181. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1182. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1183. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1184. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1185. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1186. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1187. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1188. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1189. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1190. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1191. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1192. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1193. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1194. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1195. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1196. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1197. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1198. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1199. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1200. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1201. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1202. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1203. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1204. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1205. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1206. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1207. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1208. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1209. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1210. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1211. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1212. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1213. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1214. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1215. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1216. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1217. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1218. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1219. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1220. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1221. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1222. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1223. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1224. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1225. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1226. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1227. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1228. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1229. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1230. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1231. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1232. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1233. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1234. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1235. gbhtg137.seq - HTGS (high throughput genomic sequencing) sequence entries, part 137.
1236. gbhtg138.seq - HTGS (high throughput genomic sequencing) sequence entries, part 138.
1237. gbhtg139.seq - HTGS (high throughput genomic sequencing) sequence entries, part 139.
1238. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1239. gbhtg140.seq - HTGS (high throughput genomic sequencing) sequence entries, part 140.
1240. gbhtg141.seq - HTGS (high throughput genomic sequencing) sequence entries, part 141.
1241. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1242. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1243. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1244. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1245. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1246. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1247. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1248. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1249. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1250. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1251. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1252. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1253. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1254. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1255. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1256. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1257. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1258. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1259. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1260. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1261. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1262. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1263. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1264. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1265. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1266. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1267. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1268. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1269. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1270. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1271. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1272. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1273. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1274. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1275. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1276. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1277. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1278. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1279. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1280. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1281. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1282. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1283. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1284. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1285. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1286. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1287. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1288. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1289. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1290. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1291. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1292. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1293. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1294. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1295. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1296. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1297. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1298. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1299. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1300. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1301. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1302. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1303. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1304. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1305. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1306. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1307. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1308. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1309. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1310. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1311. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1312. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1313. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1314. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1315. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1316. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1317. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1318. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1319. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1320. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1321. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1322. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1323. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1324. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1325. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1326. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1327. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1328. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1329. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1330. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1331. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1332. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1333. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1334. gbinv1.seq - Invertebrate sequence entries, part 1.
1335. gbinv10.seq - Invertebrate sequence entries, part 10.
1336. gbinv11.seq - Invertebrate sequence entries, part 11.
1337. gbinv12.seq - Invertebrate sequence entries, part 12.
1338. gbinv13.seq - Invertebrate sequence entries, part 13.
1339. gbinv14.seq - Invertebrate sequence entries, part 14.
1340. gbinv15.seq - Invertebrate sequence entries, part 15.
1341. gbinv16.seq - Invertebrate sequence entries, part 16.
1342. gbinv17.seq - Invertebrate sequence entries, part 17.
1343. gbinv18.seq - Invertebrate sequence entries, part 18.
1344. gbinv19.seq - Invertebrate sequence entries, part 19.
1345. gbinv2.seq - Invertebrate sequence entries, part 2.
1346. gbinv20.seq - Invertebrate sequence entries, part 20.
1347. gbinv21.seq - Invertebrate sequence entries, part 21.
1348. gbinv22.seq - Invertebrate sequence entries, part 22.
1349. gbinv23.seq - Invertebrate sequence entries, part 23.
1350. gbinv24.seq - Invertebrate sequence entries, part 24.
1351. gbinv25.seq - Invertebrate sequence entries, part 25.
1352. gbinv26.seq - Invertebrate sequence entries, part 26.
1353. gbinv27.seq - Invertebrate sequence entries, part 27.
1354. gbinv28.seq - Invertebrate sequence entries, part 28.
1355. gbinv29.seq - Invertebrate sequence entries, part 29.
1356. gbinv3.seq - Invertebrate sequence entries, part 3.
1357. gbinv30.seq - Invertebrate sequence entries, part 30.
1358. gbinv31.seq - Invertebrate sequence entries, part 31.
1359. gbinv32.seq - Invertebrate sequence entries, part 32.
1360. gbinv33.seq - Invertebrate sequence entries, part 33.
1361. gbinv4.seq - Invertebrate sequence entries, part 4.
1362. gbinv5.seq - Invertebrate sequence entries, part 5.
1363. gbinv6.seq - Invertebrate sequence entries, part 6.
1364. gbinv7.seq - Invertebrate sequence entries, part 7.
1365. gbinv8.seq - Invertebrate sequence entries, part 8.
1366. gbinv9.seq - Invertebrate sequence entries, part 9.
1367. gbjou1.idx - Index of the entries according to journal citation, part 1.
1368. gbjou10.idx - Index of the entries according to journal citation, part 10.
1369. gbjou11.idx - Index of the entries according to journal citation, part 11.
1370. gbjou12.idx - Index of the entries according to journal citation, part 12.
1371. gbjou13.idx - Index of the entries according to journal citation, part 13.
1372. gbjou14.idx - Index of the entries according to journal citation, part 14.
1373. gbjou2.idx - Index of the entries according to journal citation, part 2.
1374. gbjou3.idx - Index of the entries according to journal citation, part 3.
1375. gbjou4.idx - Index of the entries according to journal citation, part 4.
1376. gbjou5.idx - Index of the entries according to journal citation, part 5.
1377. gbjou6.idx - Index of the entries according to journal citation, part 6.
1378. gbjou7.idx - Index of the entries according to journal citation, part 7.
1379. gbjou8.idx - Index of the entries according to journal citation, part 8.
1380. gbjou9.idx - Index of the entries according to journal citation, part 9.
1381. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1382. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1383. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1384. gbkey4.idx - Index of the entries according to keyword phrase, part 4.
1385. gbkey5.idx - Index of the entries according to keyword phrase, part 5.
1386. gbkey6.idx - Index of the entries according to keyword phrase, part 6.
1387. gbkey7.idx - Index of the entries according to keyword phrase, part 7.
1388. gbmam1.seq - Other mammalian sequence entries, part 1.
1389. gbmam2.seq - Other mammalian sequence entries, part 2.
1390. gbmam3.seq - Other mammalian sequence entries, part 3.
1391. gbmam4.seq - Other mammalian sequence entries, part 4.
1392. gbmam5.seq - Other mammalian sequence entries, part 5.
1393. gbmam6.seq - Other mammalian sequence entries, part 6.
1394. gbmam7.seq - Other mammalian sequence entries, part 7.
1395. gbmam8.seq - Other mammalian sequence entries, part 8.
1396. gbnew.txt - Accession numbers of entries new since the previous release.
1397. gbpat1.seq - Patent sequence entries, part 1.
1398. gbpat10.seq - Patent sequence entries, part 10.
1399. gbpat100.seq - Patent sequence entries, part 100.
1400. gbpat101.seq - Patent sequence entries, part 101.
1401. gbpat102.seq - Patent sequence entries, part 102.
1402. gbpat103.seq - Patent sequence entries, part 103.
1403. gbpat104.seq - Patent sequence entries, part 104.
1404. gbpat105.seq - Patent sequence entries, part 105.
1405. gbpat106.seq - Patent sequence entries, part 106.
1406. gbpat107.seq - Patent sequence entries, part 107.
1407. gbpat108.seq - Patent sequence entries, part 108.
1408. gbpat109.seq - Patent sequence entries, part 109.
1409. gbpat11.seq - Patent sequence entries, part 11.
1410. gbpat110.seq - Patent sequence entries, part 110.
1411. gbpat111.seq - Patent sequence entries, part 111.
1412. gbpat112.seq - Patent sequence entries, part 112.
1413. gbpat113.seq - Patent sequence entries, part 113.
1414. gbpat114.seq - Patent sequence entries, part 114.
1415. gbpat115.seq - Patent sequence entries, part 115.
1416. gbpat116.seq - Patent sequence entries, part 116.
1417. gbpat117.seq - Patent sequence entries, part 117.
1418. gbpat118.seq - Patent sequence entries, part 118.
1419. gbpat119.seq - Patent sequence entries, part 119.
1420. gbpat12.seq - Patent sequence entries, part 12.
1421. gbpat120.seq - Patent sequence entries, part 120.
1422. gbpat121.seq - Patent sequence entries, part 121.
1423. gbpat122.seq - Patent sequence entries, part 122.
1424. gbpat123.seq - Patent sequence entries, part 123.
1425. gbpat124.seq - Patent sequence entries, part 124.
1426. gbpat125.seq - Patent sequence entries, part 125.
1427. gbpat126.seq - Patent sequence entries, part 126.
1428. gbpat127.seq - Patent sequence entries, part 127.
1429. gbpat128.seq - Patent sequence entries, part 128.
1430. gbpat129.seq - Patent sequence entries, part 129.
1431. gbpat13.seq - Patent sequence entries, part 13.
1432. gbpat130.seq - Patent sequence entries, part 130.
1433. gbpat131.seq - Patent sequence entries, part 131.
1434. gbpat132.seq - Patent sequence entries, part 132.
1435. gbpat133.seq - Patent sequence entries, part 133.
1436. gbpat134.seq - Patent sequence entries, part 134.
1437. gbpat135.seq - Patent sequence entries, part 135.
1438. gbpat136.seq - Patent sequence entries, part 136.
1439. gbpat137.seq - Patent sequence entries, part 137.
1440. gbpat138.seq - Patent sequence entries, part 138.
1441. gbpat139.seq - Patent sequence entries, part 139.
1442. gbpat14.seq - Patent sequence entries, part 14.
1443. gbpat140.seq - Patent sequence entries, part 140.
1444. gbpat141.seq - Patent sequence entries, part 141.
1445. gbpat142.seq - Patent sequence entries, part 142.
1446. gbpat143.seq - Patent sequence entries, part 143.
1447. gbpat144.seq - Patent sequence entries, part 144.
1448. gbpat145.seq - Patent sequence entries, part 145.
1449. gbpat146.seq - Patent sequence entries, part 146.
1450. gbpat147.seq - Patent sequence entries, part 147.
1451. gbpat148.seq - Patent sequence entries, part 148.
1452. gbpat149.seq - Patent sequence entries, part 149.
1453. gbpat15.seq - Patent sequence entries, part 15.
1454. gbpat150.seq - Patent sequence entries, part 150.
1455. gbpat151.seq - Patent sequence entries, part 151.
1456. gbpat152.seq - Patent sequence entries, part 152.
1457. gbpat153.seq - Patent sequence entries, part 153.
1458. gbpat154.seq - Patent sequence entries, part 154.
1459. gbpat155.seq - Patent sequence entries, part 155.
1460. gbpat156.seq - Patent sequence entries, part 156.
1461. gbpat157.seq - Patent sequence entries, part 157.
1462. gbpat158.seq - Patent sequence entries, part 158.
1463. gbpat159.seq - Patent sequence entries, part 159.
1464. gbpat16.seq - Patent sequence entries, part 16.
1465. gbpat160.seq - Patent sequence entries, part 160.
1466. gbpat161.seq - Patent sequence entries, part 161.
1467. gbpat162.seq - Patent sequence entries, part 162.
1468. gbpat163.seq - Patent sequence entries, part 163.
1469. gbpat164.seq - Patent sequence entries, part 164.
1470. gbpat165.seq - Patent sequence entries, part 165.
1471. gbpat166.seq - Patent sequence entries, part 166.
1472. gbpat167.seq - Patent sequence entries, part 167.
1473. gbpat168.seq - Patent sequence entries, part 168.
1474. gbpat169.seq - Patent sequence entries, part 169.
1475. gbpat17.seq - Patent sequence entries, part 17.
1476. gbpat170.seq - Patent sequence entries, part 170.
1477. gbpat171.seq - Patent sequence entries, part 171.
1478. gbpat172.seq - Patent sequence entries, part 172.
1479. gbpat173.seq - Patent sequence entries, part 173.
1480. gbpat174.seq - Patent sequence entries, part 174.
1481. gbpat175.seq - Patent sequence entries, part 175.
1482. gbpat176.seq - Patent sequence entries, part 176.
1483. gbpat177.seq - Patent sequence entries, part 177.
1484. gbpat178.seq - Patent sequence entries, part 178.
1485. gbpat179.seq - Patent sequence entries, part 179.
1486. gbpat18.seq - Patent sequence entries, part 18.
1487. gbpat180.seq - Patent sequence entries, part 180.
1488. gbpat181.seq - Patent sequence entries, part 181.
1489. gbpat182.seq - Patent sequence entries, part 182.
1490. gbpat183.seq - Patent sequence entries, part 183.
1491. gbpat184.seq - Patent sequence entries, part 184.
1492. gbpat185.seq - Patent sequence entries, part 185.
1493. gbpat186.seq - Patent sequence entries, part 186.
1494. gbpat19.seq - Patent sequence entries, part 19.
1495. gbpat2.seq - Patent sequence entries, part 2.
1496. gbpat20.seq - Patent sequence entries, part 20.
1497. gbpat21.seq - Patent sequence entries, part 21.
1498. gbpat22.seq - Patent sequence entries, part 22.
1499. gbpat23.seq - Patent sequence entries, part 23.
1500. gbpat24.seq - Patent sequence entries, part 24.
1501. gbpat25.seq - Patent sequence entries, part 25.
1502. gbpat26.seq - Patent sequence entries, part 26.
1503. gbpat27.seq - Patent sequence entries, part 27.
1504. gbpat28.seq - Patent sequence entries, part 28.
1505. gbpat29.seq - Patent sequence entries, part 29.
1506. gbpat3.seq - Patent sequence entries, part 3.
1507. gbpat30.seq - Patent sequence entries, part 30.
1508. gbpat31.seq - Patent sequence entries, part 31.
1509. gbpat32.seq - Patent sequence entries, part 32.
1510. gbpat33.seq - Patent sequence entries, part 33.
1511. gbpat34.seq - Patent sequence entries, part 34.
1512. gbpat35.seq - Patent sequence entries, part 35.
1513. gbpat36.seq - Patent sequence entries, part 36.
1514. gbpat37.seq - Patent sequence entries, part 37.
1515. gbpat38.seq - Patent sequence entries, part 38.
1516. gbpat39.seq - Patent sequence entries, part 39.
1517. gbpat4.seq - Patent sequence entries, part 4.
1518. gbpat40.seq - Patent sequence entries, part 40.
1519. gbpat41.seq - Patent sequence entries, part 41.
1520. gbpat42.seq - Patent sequence entries, part 42.
1521. gbpat43.seq - Patent sequence entries, part 43.
1522. gbpat44.seq - Patent sequence entries, part 44.
1523. gbpat45.seq - Patent sequence entries, part 45.
1524. gbpat46.seq - Patent sequence entries, part 46.
1525. gbpat47.seq - Patent sequence entries, part 47.
1526. gbpat48.seq - Patent sequence entries, part 48.
1527. gbpat49.seq - Patent sequence entries, part 49.
1528. gbpat5.seq - Patent sequence entries, part 5.
1529. gbpat50.seq - Patent sequence entries, part 50.
1530. gbpat51.seq - Patent sequence entries, part 51.
1531. gbpat52.seq - Patent sequence entries, part 52.
1532. gbpat53.seq - Patent sequence entries, part 53.
1533. gbpat54.seq - Patent sequence entries, part 54.
1534. gbpat55.seq - Patent sequence entries, part 55.
1535. gbpat56.seq - Patent sequence entries, part 56.
1536. gbpat57.seq - Patent sequence entries, part 57.
1537. gbpat58.seq - Patent sequence entries, part 58.
1538. gbpat59.seq - Patent sequence entries, part 59.
1539. gbpat6.seq - Patent sequence entries, part 6.
1540. gbpat60.seq - Patent sequence entries, part 60.
1541. gbpat61.seq - Patent sequence entries, part 61.
1542. gbpat62.seq - Patent sequence entries, part 62.
1543. gbpat63.seq - Patent sequence entries, part 63.
1544. gbpat64.seq - Patent sequence entries, part 64.
1545. gbpat65.seq - Patent sequence entries, part 65.
1546. gbpat66.seq - Patent sequence entries, part 66.
1547. gbpat67.seq - Patent sequence entries, part 67.
1548. gbpat68.seq - Patent sequence entries, part 68.
1549. gbpat69.seq - Patent sequence entries, part 69.
1550. gbpat7.seq - Patent sequence entries, part 7.
1551. gbpat70.seq - Patent sequence entries, part 70.
1552. gbpat71.seq - Patent sequence entries, part 71.
1553. gbpat72.seq - Patent sequence entries, part 72.
1554. gbpat73.seq - Patent sequence entries, part 73.
1555. gbpat74.seq - Patent sequence entries, part 74.
1556. gbpat75.seq - Patent sequence entries, part 75.
1557. gbpat76.seq - Patent sequence entries, part 76.
1558. gbpat77.seq - Patent sequence entries, part 77.
1559. gbpat78.seq - Patent sequence entries, part 78.
1560. gbpat79.seq - Patent sequence entries, part 79.
1561. gbpat8.seq - Patent sequence entries, part 8.
1562. gbpat80.seq - Patent sequence entries, part 80.
1563. gbpat81.seq - Patent sequence entries, part 81.
1564. gbpat82.seq - Patent sequence entries, part 82.
1565. gbpat83.seq - Patent sequence entries, part 83.
1566. gbpat84.seq - Patent sequence entries, part 84.
1567. gbpat85.seq - Patent sequence entries, part 85.
1568. gbpat86.seq - Patent sequence entries, part 86.
1569. gbpat87.seq - Patent sequence entries, part 87.
1570. gbpat88.seq - Patent sequence entries, part 88.
1571. gbpat89.seq - Patent sequence entries, part 89.
1572. gbpat9.seq - Patent sequence entries, part 9.
1573. gbpat90.seq - Patent sequence entries, part 90.
1574. gbpat91.seq - Patent sequence entries, part 91.
1575. gbpat92.seq - Patent sequence entries, part 92.
1576. gbpat93.seq - Patent sequence entries, part 93.
1577. gbpat94.seq - Patent sequence entries, part 94.
1578. gbpat95.seq - Patent sequence entries, part 95.
1579. gbpat96.seq - Patent sequence entries, part 96.
1580. gbpat97.seq - Patent sequence entries, part 97.
1581. gbpat98.seq - Patent sequence entries, part 98.
1582. gbpat99.seq - Patent sequence entries, part 99.
1583. gbphg1.seq - Phage sequence entries, part 1.
1584. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1585. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1586. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1587. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1588. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1589. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1590. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1591. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1592. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1593. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1594. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1595. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1596. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1597. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1598. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1599. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1600. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1601. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1602. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1603. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1604. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1605. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1606. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1607. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1608. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1609. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1610. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1611. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1612. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1613. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1614. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1615. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1616. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1617. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1618. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1619. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1620. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1621. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1622. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1623. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1624. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1625. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1626. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1627. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1628. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1629. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1630. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1631. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1632. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
1633. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
1634. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
1635. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
1636. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
1637. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
1638. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
1639. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1640. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
1641. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1642. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1643. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1644. gbpri1.seq - Primate sequence entries, part 1.
1645. gbpri10.seq - Primate sequence entries, part 10.
1646. gbpri11.seq - Primate sequence entries, part 11.
1647. gbpri12.seq - Primate sequence entries, part 12.
1648. gbpri13.seq - Primate sequence entries, part 13.
1649. gbpri14.seq - Primate sequence entries, part 14.
1650. gbpri15.seq - Primate sequence entries, part 15.
1651. gbpri16.seq - Primate sequence entries, part 16.
1652. gbpri17.seq - Primate sequence entries, part 17.
1653. gbpri18.seq - Primate sequence entries, part 18.
1654. gbpri19.seq - Primate sequence entries, part 19.
1655. gbpri2.seq - Primate sequence entries, part 2.
1656. gbpri20.seq - Primate sequence entries, part 20.
1657. gbpri21.seq - Primate sequence entries, part 21.
1658. gbpri22.seq - Primate sequence entries, part 22.
1659. gbpri23.seq - Primate sequence entries, part 23.
1660. gbpri24.seq - Primate sequence entries, part 24.
1661. gbpri25.seq - Primate sequence entries, part 25.
1662. gbpri26.seq - Primate sequence entries, part 26.
1663. gbpri27.seq - Primate sequence entries, part 27.
1664. gbpri28.seq - Primate sequence entries, part 28.
1665. gbpri29.seq - Primate sequence entries, part 29.
1666. gbpri3.seq - Primate sequence entries, part 3.
1667. gbpri30.seq - Primate sequence entries, part 30.
1668. gbpri31.seq - Primate sequence entries, part 31.
1669. gbpri32.seq - Primate sequence entries, part 32.
1670. gbpri33.seq - Primate sequence entries, part 33.
1671. gbpri34.seq - Primate sequence entries, part 34.
1672. gbpri35.seq - Primate sequence entries, part 35.
1673. gbpri36.seq - Primate sequence entries, part 36.
1674. gbpri37.seq - Primate sequence entries, part 37.
1675. gbpri38.seq - Primate sequence entries, part 38.
1676. gbpri39.seq - Primate sequence entries, part 39.
1677. gbpri4.seq - Primate sequence entries, part 4.
1678. gbpri40.seq - Primate sequence entries, part 40.
1679. gbpri41.seq - Primate sequence entries, part 41.
1680. gbpri42.seq - Primate sequence entries, part 42.
1681. gbpri43.seq - Primate sequence entries, part 43.
1682. gbpri44.seq - Primate sequence entries, part 44.
1683. gbpri45.seq - Primate sequence entries, part 45.
1684. gbpri5.seq - Primate sequence entries, part 5.
1685. gbpri6.seq - Primate sequence entries, part 6.
1686. gbpri7.seq - Primate sequence entries, part 7.
1687. gbpri8.seq - Primate sequence entries, part 8.
1688. gbpri9.seq - Primate sequence entries, part 9.
1689. gbrel.txt - Release notes (this document).
1690. gbrod1.seq - Rodent sequence entries, part 1.
1691. gbrod10.seq - Rodent sequence entries, part 10.
1692. gbrod11.seq - Rodent sequence entries, part 11.
1693. gbrod12.seq - Rodent sequence entries, part 12.
1694. gbrod13.seq - Rodent sequence entries, part 13.
1695. gbrod14.seq - Rodent sequence entries, part 14.
1696. gbrod15.seq - Rodent sequence entries, part 15.
1697. gbrod16.seq - Rodent sequence entries, part 16.
1698. gbrod17.seq - Rodent sequence entries, part 17.
1699. gbrod18.seq - Rodent sequence entries, part 18.
1700. gbrod19.seq - Rodent sequence entries, part 19.
1701. gbrod2.seq - Rodent sequence entries, part 2.
1702. gbrod20.seq - Rodent sequence entries, part 20.
1703. gbrod21.seq - Rodent sequence entries, part 21.
1704. gbrod22.seq - Rodent sequence entries, part 22.
1705. gbrod23.seq - Rodent sequence entries, part 23.
1706. gbrod24.seq - Rodent sequence entries, part 24.
1707. gbrod25.seq - Rodent sequence entries, part 25.
1708. gbrod26.seq - Rodent sequence entries, part 26.
1709. gbrod27.seq - Rodent sequence entries, part 27.
1710. gbrod28.seq - Rodent sequence entries, part 28.
1711. gbrod29.seq - Rodent sequence entries, part 29.
1712. gbrod3.seq - Rodent sequence entries, part 3.
1713. gbrod30.seq - Rodent sequence entries, part 30.
1714. gbrod4.seq - Rodent sequence entries, part 4.
1715. gbrod5.seq - Rodent sequence entries, part 5.
1716. gbrod6.seq - Rodent sequence entries, part 6.
1717. gbrod7.seq - Rodent sequence entries, part 7.
1718. gbrod8.seq - Rodent sequence entries, part 8.
1719. gbrod9.seq - Rodent sequence entries, part 9.
1720. gbsdr1.txt - Short directory of the data bank, part 1.
1721. gbsdr2.txt - Short directory of the data bank, part 2.
1722. gbsdr3.txt - Short directory of the data bank, part 3.
1723. gbsec.idx - Index of the entries according to secondary accession number.
1724. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1725. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1726. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1727. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1728. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1729. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1730. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
1731. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
1732. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
1733. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
1734. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
1735. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1736. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
1737. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1738. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1739. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1740. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1741. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1742. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1743. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1744. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1745. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1746. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
1747. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
1748. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
1749. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
1750. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
1751. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
1752. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
1753. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
1754. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
1755. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
1756. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
1757. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
1758. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
1759. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
1760. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
1761. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
1762. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
1763. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
1764. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
1765. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
1766. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
1767. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
1768. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
1769. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
1770. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
1771. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
1772. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
1773. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
1774. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
1775. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
1776. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
1777. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
1778. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
1779. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
1780. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
1781. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
1782. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
1783. gbtsa128.seq - TSA (transcriptome shotgun assembly) sequence entries, part 128.
1784. gbtsa129.seq - TSA (transcriptome shotgun assembly) sequence entries, part 129.
1785. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
1786. gbtsa130.seq - TSA (transcriptome shotgun assembly) sequence entries, part 130.
1787. gbtsa131.seq - TSA (transcriptome shotgun assembly) sequence entries, part 131.
1788. gbtsa132.seq - TSA (transcriptome shotgun assembly) sequence entries, part 132.
1789. gbtsa133.seq - TSA (transcriptome shotgun assembly) sequence entries, part 133.
1790. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
1791. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
1792. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
1793. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
1794. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
1795. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
1796. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
1797. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
1798. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
1799. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
1800. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
1801. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
1802. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
1803. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
1804. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
1805. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
1806. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
1807. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
1808. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
1809. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
1810. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
1811. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
1812. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
1813. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
1814. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
1815. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
1816. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
1817. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
1818. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
1819. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
1820. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
1821. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
1822. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
1823. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
1824. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
1825. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
1826. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
1827. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
1828. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
1829. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
1830. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
1831. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
1832. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
1833. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
1834. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
1835. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
1836. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
1837. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
1838. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
1839. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
1840. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
1841. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
1842. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
1843. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
1844. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
1845. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
1846. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
1847. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
1848. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
1849. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
1850. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
1851. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
1852. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
1853. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
1854. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
1855. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
1856. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
1857. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
1858. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
1859. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
1860. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
1861. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
1862. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
1863. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
1864. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
1865. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
1866. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
1867. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
1868. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
1869. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
1870. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
1871. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
1872. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
1873. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
1874. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
1875. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
1876. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
1877. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
1878. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
1879. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
1880. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
1881. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
1882. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
1883. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
1884. gbuna1.seq - Unannotated sequence entries, part 1.
1885. gbvrl1.seq - Viral sequence entries, part 1.
1886. gbvrl10.seq - Viral sequence entries, part 10.
1887. gbvrl11.seq - Viral sequence entries, part 11.
1888. gbvrl12.seq - Viral sequence entries, part 12.
1889. gbvrl13.seq - Viral sequence entries, part 13.
1890. gbvrl14.seq - Viral sequence entries, part 14.
1891. gbvrl15.seq - Viral sequence entries, part 15.
1892. gbvrl16.seq - Viral sequence entries, part 16.
1893. gbvrl17.seq - Viral sequence entries, part 17.
1894. gbvrl18.seq - Viral sequence entries, part 18.
1895. gbvrl19.seq - Viral sequence entries, part 19.
1896. gbvrl2.seq - Viral sequence entries, part 2.
1897. gbvrl20.seq - Viral sequence entries, part 20.
1898. gbvrl21.seq - Viral sequence entries, part 21.
1899. gbvrl22.seq - Viral sequence entries, part 22.
1900. gbvrl23.seq - Viral sequence entries, part 23.
1901. gbvrl24.seq - Viral sequence entries, part 24.
1902. gbvrl3.seq - Viral sequence entries, part 3.
1903. gbvrl4.seq - Viral sequence entries, part 4.
1904. gbvrl5.seq - Viral sequence entries, part 5.
1905. gbvrl6.seq - Viral sequence entries, part 6.
1906. gbvrl7.seq - Viral sequence entries, part 7.
1907. gbvrl8.seq - Viral sequence entries, part 8.
1908. gbvrl9.seq - Viral sequence entries, part 9.
1909. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1910. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1911. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1912. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1913. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1914. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1915. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1916. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1917. gbvrt17.seq - Other vertebrate sequence entries, part 17.
1918. gbvrt18.seq - Other vertebrate sequence entries, part 18.
1919. gbvrt19.seq - Other vertebrate sequence entries, part 19.
1920. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1921. gbvrt20.seq - Other vertebrate sequence entries, part 20.
1922. gbvrt21.seq - Other vertebrate sequence entries, part 21.
1923. gbvrt22.seq - Other vertebrate sequence entries, part 22.
1924. gbvrt23.seq - Other vertebrate sequence entries, part 23.
1925. gbvrt24.seq - Other vertebrate sequence entries, part 24.
1926. gbvrt25.seq - Other vertebrate sequence entries, part 25.
1927. gbvrt26.seq - Other vertebrate sequence entries, part 26.
1928. gbvrt27.seq - Other vertebrate sequence entries, part 27.
1929. gbvrt28.seq - Other vertebrate sequence entries, part 28.
1930. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1931. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1932. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1933. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1934. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1935. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1936. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 193.0 flatfiles require roughly 579 GB (sequence
files only) or 624 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
2252890810 gbacc1.idx
2442075042 gbacc2.idx
858169857 gbacc3.idx
183944916 gbaut1.idx
189787367 gbaut10.idx
185563715 gbaut100.idx
183962505 gbaut101.idx
194239750 gbaut102.idx
220898782 gbaut103.idx
186580576 gbaut104.idx
189343258 gbaut105.idx
118473176 gbaut106.idx
188376637 gbaut11.idx
188467116 gbaut12.idx
183868823 gbaut13.idx
183893276 gbaut14.idx
240844693 gbaut15.idx
184878034 gbaut16.idx
184453685 gbaut17.idx
187117227 gbaut18.idx
187410112 gbaut19.idx
186540356 gbaut2.idx
183888727 gbaut20.idx
244840816 gbaut21.idx
184931901 gbaut22.idx
187481439 gbaut23.idx
184696681 gbaut24.idx
249373081 gbaut25.idx
184099974 gbaut26.idx
186188797 gbaut27.idx
184373245 gbaut28.idx
183856169 gbaut29.idx
185962654 gbaut3.idx
188414616 gbaut30.idx
186554598 gbaut31.idx
184942411 gbaut32.idx
184048390 gbaut33.idx
184364905 gbaut34.idx
184361235 gbaut35.idx
198027708 gbaut36.idx
185196871 gbaut37.idx
187885829 gbaut38.idx
183957148 gbaut39.idx
186784751 gbaut4.idx
236678080 gbaut40.idx
183974729 gbaut41.idx
184409045 gbaut42.idx
207900568 gbaut43.idx
185885670 gbaut44.idx
184339484 gbaut45.idx
198651679 gbaut46.idx
191327566 gbaut47.idx
184239891 gbaut48.idx
186690817 gbaut49.idx
183949977 gbaut5.idx
239950535 gbaut50.idx
227402724 gbaut51.idx
199223140 gbaut52.idx
183975799 gbaut53.idx
183925698 gbaut54.idx
184100904 gbaut55.idx
185577471 gbaut56.idx
186553732 gbaut57.idx
186168990 gbaut58.idx
184555154 gbaut59.idx
183810649 gbaut6.idx
184581278 gbaut60.idx
183975598 gbaut61.idx
184193314 gbaut62.idx
190896873 gbaut63.idx
249567240 gbaut64.idx
184211756 gbaut65.idx
186626413 gbaut66.idx
186577876 gbaut67.idx
184713332 gbaut68.idx
184139833 gbaut69.idx
193648366 gbaut7.idx
200610139 gbaut70.idx
184083789 gbaut71.idx
184391146 gbaut72.idx
184652167 gbaut73.idx
186630205 gbaut74.idx
254684381 gbaut75.idx
201272693 gbaut76.idx
184776635 gbaut77.idx
184765732 gbaut78.idx
184193152 gbaut79.idx
189006739 gbaut8.idx
194179672 gbaut80.idx
185350898 gbaut81.idx
185329120 gbaut82.idx
225957603 gbaut83.idx
185999876 gbaut84.idx
186148953 gbaut85.idx
186122427 gbaut86.idx
183915625 gbaut87.idx
185742887 gbaut88.idx
226692026 gbaut89.idx
190828058 gbaut9.idx
186194537 gbaut90.idx
251509317 gbaut91.idx
225505211 gbaut92.idx
197955612 gbaut93.idx
183884211 gbaut94.idx
184350123 gbaut95.idx
187099704 gbaut96.idx
187947092 gbaut97.idx
245466947 gbaut98.idx
191109182 gbaut99.idx
249998391 gbbct1.seq
248280704 gbbct10.seq
239032349 gbbct11.seq
248802484 gbbct12.seq
241799740 gbbct13.seq
116713215 gbbct14.seq
243275401 gbbct15.seq
249804949 gbbct16.seq
245562691 gbbct17.seq
248629470 gbbct18.seq
248235166 gbbct19.seq
244967609 gbbct2.seq
249282753 gbbct20.seq
246199154 gbbct21.seq
245694143 gbbct22.seq
217807723 gbbct23.seq
242804118 gbbct24.seq
241841514 gbbct25.seq
248677810 gbbct26.seq
247876263 gbbct27.seq
249388763 gbbct28.seq
244186506 gbbct29.seq
246044946 gbbct3.seq
247337485 gbbct30.seq
249997215 gbbct31.seq
249762317 gbbct32.seq
249909655 gbbct33.seq
242887141 gbbct34.seq
241640993 gbbct35.seq
164823977 gbbct36.seq
243029977 gbbct37.seq
244359083 gbbct38.seq
249250156 gbbct39.seq
247626341 gbbct4.seq
247838775 gbbct40.seq
246706753 gbbct41.seq
241266255 gbbct42.seq
249895642 gbbct43.seq
248792467 gbbct44.seq
244002372 gbbct45.seq
240748115 gbbct46.seq
247084697 gbbct47.seq
231587110 gbbct48.seq
244589739 gbbct49.seq
223235354 gbbct5.seq
243720390 gbbct50.seq
248498852 gbbct51.seq
239600080 gbbct52.seq
248233154 gbbct53.seq
247217566 gbbct54.seq
244234321 gbbct55.seq
249995286 gbbct56.seq
247368800 gbbct57.seq
238687106 gbbct58.seq
245836487 gbbct59.seq
242232877 gbbct6.seq
244743445 gbbct60.seq
132596150 gbbct61.seq
248050306 gbbct62.seq
249888092 gbbct63.seq
243822607 gbbct64.seq
245731403 gbbct65.seq
247903631 gbbct66.seq
249619243 gbbct67.seq
249695609 gbbct68.seq
244821086 gbbct69.seq
243751964 gbbct7.seq
248730794 gbbct70.seq
238479130 gbbct71.seq
188296214 gbbct72.seq
6890880 gbbct73.seq
14105269 gbbct74.seq
23218539 gbbct75.seq
45127213 gbbct76.seq
87803103 gbbct77.seq
170367280 gbbct78.seq
249996594 gbbct79.seq
228520804 gbbct8.seq
249999203 gbbct80.seq
244424291 gbbct81.seq
239418491 gbbct82.seq
248687151 gbbct83.seq
247078288 gbbct84.seq
249997325 gbbct85.seq
243798785 gbbct86.seq
224324388 gbbct87.seq
249178920 gbbct88.seq
243294919 gbbct89.seq
244779785 gbbct9.seq
249993926 gbbct90.seq
249997613 gbbct91.seq
249998509 gbbct92.seq
247046952 gbbct93.seq
138196485 gbbct94.seq
12859305 gbchg.txt
249996987 gbcon1.seq
249995919 gbcon10.seq
249999018 gbcon100.seq
249995506 gbcon101.seq
249999938 gbcon102.seq
249996196 gbcon103.seq
249994668 gbcon104.seq
158184767 gbcon105.seq
249997662 gbcon106.seq
249996981 gbcon107.seq
249998026 gbcon108.seq
249999534 gbcon109.seq
249296974 gbcon11.seq
73726548 gbcon110.seq
213431083 gbcon111.seq
249999151 gbcon112.seq
249998618 gbcon113.seq
249995107 gbcon114.seq
249967505 gbcon115.seq
109513271 gbcon116.seq
249993276 gbcon117.seq
249998037 gbcon118.seq
181287823 gbcon119.seq
248941833 gbcon12.seq
249997376 gbcon120.seq
249999771 gbcon121.seq
250000264 gbcon122.seq
222531140 gbcon123.seq
248967835 gbcon124.seq
249958023 gbcon125.seq
249453966 gbcon126.seq
249995345 gbcon127.seq
249997413 gbcon128.seq
249998315 gbcon129.seq
246391796 gbcon13.seq
34329576 gbcon130.seq
249971298 gbcon131.seq
249997710 gbcon132.seq
249994690 gbcon133.seq
249959868 gbcon134.seq
249943571 gbcon135.seq
249999699 gbcon136.seq
249977443 gbcon137.seq
234884818 gbcon138.seq
246632932 gbcon139.seq
247925207 gbcon14.seq
247296216 gbcon140.seq
249988778 gbcon141.seq
249290559 gbcon142.seq
119574088 gbcon143.seq
249999844 gbcon144.seq
249373810 gbcon145.seq
249997543 gbcon146.seq
249998015 gbcon147.seq
249999766 gbcon148.seq
249998672 gbcon149.seq
213221182 gbcon15.seq
249029886 gbcon150.seq
249999587 gbcon151.seq
207804410 gbcon152.seq
249998414 gbcon153.seq
249998663 gbcon154.seq
249993208 gbcon155.seq
249959557 gbcon156.seq
249998679 gbcon157.seq
249996396 gbcon158.seq
45344421 gbcon159.seq
249999398 gbcon16.seq
249999135 gbcon160.seq
249991601 gbcon161.seq
249999804 gbcon162.seq
249996164 gbcon163.seq
249999423 gbcon164.seq
249773141 gbcon165.seq
52285967 gbcon166.seq
249995096 gbcon167.seq
249587803 gbcon168.seq
249994475 gbcon169.seq
249931808 gbcon17.seq
249995901 gbcon170.seq
249963614 gbcon171.seq
249830321 gbcon172.seq
249998471 gbcon173.seq
249998296 gbcon174.seq
249999888 gbcon175.seq
249617567 gbcon176.seq
249768315 gbcon177.seq
41536534 gbcon178.seq
18871647 gbcon179.seq
249999709 gbcon18.seq
240825022 gbcon19.seq
249330552 gbcon2.seq
249994640 gbcon20.seq
249193119 gbcon21.seq
117444305 gbcon22.seq
249998736 gbcon23.seq
119794062 gbcon24.seq
249993709 gbcon25.seq
249727153 gbcon26.seq
249999409 gbcon27.seq
249996705 gbcon28.seq
192075300 gbcon29.seq
249817269 gbcon3.seq
249998917 gbcon30.seq
249996531 gbcon31.seq
249997326 gbcon32.seq
249998915 gbcon33.seq
249952952 gbcon34.seq
238918179 gbcon35.seq
249997270 gbcon36.seq
249999221 gbcon37.seq
249994732 gbcon38.seq
249996897 gbcon39.seq
249994866 gbcon4.seq
249997078 gbcon40.seq
249997414 gbcon41.seq
63412389 gbcon42.seq
249995423 gbcon43.seq
249997315 gbcon44.seq
249997250 gbcon45.seq
249997590 gbcon46.seq
249996159 gbcon47.seq
44928861 gbcon48.seq
249994872 gbcon49.seq
249999657 gbcon5.seq
249995799 gbcon50.seq
249997684 gbcon51.seq
249996690 gbcon52.seq
249997782 gbcon53.seq
38241897 gbcon54.seq
249998302 gbcon55.seq
249999150 gbcon56.seq
249998346 gbcon57.seq
249994564 gbcon58.seq
249999492 gbcon59.seq
249994057 gbcon6.seq
154672375 gbcon60.seq
249999016 gbcon61.seq
249996777 gbcon62.seq
249999159 gbcon63.seq
249995190 gbcon64.seq
185611272 gbcon65.seq
249996810 gbcon66.seq
249998700 gbcon67.seq
249997155 gbcon68.seq
249997874 gbcon69.seq
93508945 gbcon7.seq
247616447 gbcon70.seq
249998269 gbcon71.seq
249995941 gbcon72.seq
249998068 gbcon73.seq
249999277 gbcon74.seq
249999797 gbcon75.seq
98773033 gbcon76.seq
249997150 gbcon77.seq
249997442 gbcon78.seq
249995516 gbcon79.seq
249993190 gbcon8.seq
249996111 gbcon80.seq
249995971 gbcon81.seq
64633499 gbcon82.seq
249998451 gbcon83.seq
249995859 gbcon84.seq
249994386 gbcon85.seq
249994858 gbcon86.seq
249998199 gbcon87.seq
23638323 gbcon88.seq
249997115 gbcon89.seq
249996650 gbcon9.seq
249995538 gbcon90.seq
249998987 gbcon91.seq
249999150 gbcon92.seq
199759401 gbcon93.seq
249994089 gbcon94.seq
249998565 gbcon95.seq
249998526 gbcon96.seq
249996032 gbcon97.seq
249999284 gbcon98.seq
135141018 gbcon99.seq
103367 gbdel.txt
249998727 gbenv1.seq
249999326 gbenv10.seq
249999236 gbenv11.seq
60430194 gbenv12.seq
249998160 gbenv13.seq
250000198 gbenv14.seq
249997627 gbenv15.seq
249999423 gbenv16.seq
249999525 gbenv17.seq
249999802 gbenv18.seq
249997371 gbenv19.seq
249999413 gbenv2.seq
221032055 gbenv20.seq
249999550 gbenv21.seq
249996983 gbenv22.seq
249999844 gbenv23.seq
249999953 gbenv24.seq
157076308 gbenv25.seq
249999635 gbenv26.seq
249983465 gbenv27.seq
249999792 gbenv28.seq
250000067 gbenv29.seq
249999849 gbenv3.seq
249998010 gbenv30.seq
209248844 gbenv31.seq
249999624 gbenv32.seq
249999196 gbenv33.seq
250000100 gbenv34.seq
249997626 gbenv35.seq
187291512 gbenv36.seq
249999075 gbenv37.seq
249999864 gbenv38.seq
249997124 gbenv39.seq
250000157 gbenv4.seq
249996944 gbenv40.seq
249996351 gbenv41.seq
249998914 gbenv42.seq
46038946 gbenv43.seq
249997879 gbenv44.seq
249998763 gbenv45.seq
250000009 gbenv46.seq
249998886 gbenv47.seq
177240691 gbenv48.seq
249995875 gbenv49.seq
249998153 gbenv5.seq
249999505 gbenv50.seq
249998834 gbenv51.seq
249999798 gbenv52.seq
250000077 gbenv53.seq
249999197 gbenv54.seq
249999121 gbenv55.seq
249999881 gbenv56.seq
238237372 gbenv57.seq
250000082 gbenv6.seq
19915231 gbenv7.seq
249998628 gbenv8.seq
249999068 gbenv9.seq
524291258 gbest1.seq
524290491 gbest10.seq
524290836 gbest100.seq
524291966 gbest101.seq
524288902 gbest102.seq
524288884 gbest103.seq
360440996 gbest104.seq
524290200 gbest105.seq
524289858 gbest106.seq
524292607 gbest107.seq
385863710 gbest108.seq
389646132 gbest109.seq
524290352 gbest11.seq
383415138 gbest110.seq
384187439 gbest111.seq
381052342 gbest112.seq
385313054 gbest113.seq
390040206 gbest114.seq
388173328 gbest115.seq
387306402 gbest116.seq
383869023 gbest117.seq
407525421 gbest118.seq
510811517 gbest119.seq
524290424 gbest12.seq
524289812 gbest120.seq
524288880 gbest121.seq
524292244 gbest122.seq
524289178 gbest123.seq
430373608 gbest124.seq
524288893 gbest125.seq
524291101 gbest126.seq
524290945 gbest127.seq
524288894 gbest128.seq
524289062 gbest129.seq
157960451 gbest13.seq
524289818 gbest130.seq
524289671 gbest131.seq
524291527 gbest132.seq
524289084 gbest133.seq
524291939 gbest134.seq
524291614 gbest135.seq
524292432 gbest136.seq
301936087 gbest137.seq
524289397 gbest138.seq
524289067 gbest139.seq
524288901 gbest14.seq
524292737 gbest140.seq
524290383 gbest141.seq
524290736 gbest142.seq
524291377 gbest143.seq
524290490 gbest144.seq
524290755 gbest145.seq
524289788 gbest146.seq
524290897 gbest147.seq
524289770 gbest148.seq
524290282 gbest149.seq
524292257 gbest15.seq
524288886 gbest150.seq
466126057 gbest151.seq
524289118 gbest152.seq
524289912 gbest153.seq
524288825 gbest154.seq
524289530 gbest155.seq
524290106 gbest156.seq
524289394 gbest157.seq
524290234 gbest158.seq
524289947 gbest159.seq
524289253 gbest16.seq
524289264 gbest160.seq
524289984 gbest161.seq
524288962 gbest162.seq
524289647 gbest163.seq
247735796 gbest164.seq
524292093 gbest165.seq
524289151 gbest166.seq
524288726 gbest167.seq
524290915 gbest168.seq
524289051 gbest169.seq
524290653 gbest17.seq
524291032 gbest170.seq
524290869 gbest171.seq
524289011 gbest172.seq
524292093 gbest173.seq
524289036 gbest174.seq
524290094 gbest175.seq
524291637 gbest176.seq
524290827 gbest177.seq
114247995 gbest178.seq
524289128 gbest179.seq
524291103 gbest18.seq
524291234 gbest180.seq
524289309 gbest181.seq
524291057 gbest182.seq
524289677 gbest183.seq
524290531 gbest184.seq
524290327 gbest185.seq
524291149 gbest186.seq
524291722 gbest187.seq
524289945 gbest188.seq
524290250 gbest189.seq
524292512 gbest19.seq
524289119 gbest190.seq
474308640 gbest191.seq
524292016 gbest192.seq
524291722 gbest193.seq
524293431 gbest194.seq
524289109 gbest195.seq
524292781 gbest196.seq
524288982 gbest197.seq
524290844 gbest198.seq
524289979 gbest199.seq
524290885 gbest2.seq
524289644 gbest20.seq
524289601 gbest200.seq
524291499 gbest201.seq
524290430 gbest202.seq
524289846 gbest203.seq
524291404 gbest204.seq
78644273 gbest205.seq
524291161 gbest206.seq
524290427 gbest207.seq
524289659 gbest208.seq
524290205 gbest209.seq
524290085 gbest21.seq
524291567 gbest210.seq
524291267 gbest211.seq
524292238 gbest212.seq
524290005 gbest213.seq
524290729 gbest214.seq
524289707 gbest215.seq
425467153 gbest216.seq
524290219 gbest217.seq
524290155 gbest218.seq
524288979 gbest219.seq
512311332 gbest22.seq
524289106 gbest220.seq
524290472 gbest221.seq
524295199 gbest222.seq
524291629 gbest223.seq
524291747 gbest224.seq
524288822 gbest225.seq
524289016 gbest226.seq
524289889 gbest227.seq
524289165 gbest228.seq
524292000 gbest229.seq
500293133 gbest23.seq
350787407 gbest230.seq
524290933 gbest231.seq
524292472 gbest232.seq
524289516 gbest233.seq
524290878 gbest234.seq
524291049 gbest235.seq
524288897 gbest236.seq
524292527 gbest237.seq
524290134 gbest238.seq
524291764 gbest239.seq
509287062 gbest24.seq
524291129 gbest240.seq
524289592 gbest241.seq
524289591 gbest242.seq
524290534 gbest243.seq
524289116 gbest244.seq
32954592 gbest245.seq
524289110 gbest246.seq
524288913 gbest247.seq
524291060 gbest248.seq
524289770 gbest249.seq
320561998 gbest25.seq
524288951 gbest250.seq
524290821 gbest251.seq
524289513 gbest252.seq
524291174 gbest253.seq
524288866 gbest254.seq
524290005 gbest255.seq
524290127 gbest256.seq
270649163 gbest257.seq
524291321 gbest258.seq
524289496 gbest259.seq
524289294 gbest26.seq
524288825 gbest260.seq
524289905 gbest261.seq
524289589 gbest262.seq
524290043 gbest263.seq
524291349 gbest264.seq
524290228 gbest265.seq
524291441 gbest266.seq
524290770 gbest267.seq
300443416 gbest268.seq
524291233 gbest269.seq
524289782 gbest27.seq
524291566 gbest270.seq
524290910 gbest271.seq
524291222 gbest272.seq
524288778 gbest273.seq
524289039 gbest274.seq
524290265 gbest275.seq
524289606 gbest276.seq
524290730 gbest277.seq
524291323 gbest278.seq
524292902 gbest279.seq
524291498 gbest28.seq
312700494 gbest280.seq
524290186 gbest281.seq
524291080 gbest282.seq
524290593 gbest283.seq
524289715 gbest284.seq
524290712 gbest285.seq
524291178 gbest286.seq
524290662 gbest287.seq
524290067 gbest288.seq
524289297 gbest289.seq
524290846 gbest29.seq
524290603 gbest290.seq
524290380 gbest291.seq
223448100 gbest292.seq
524288774 gbest293.seq
524290845 gbest294.seq
524289687 gbest295.seq
524290807 gbest296.seq
524288998 gbest297.seq
524289356 gbest298.seq
524290032 gbest299.seq
497614745 gbest3.seq
524289723 gbest30.seq
524289554 gbest300.seq
477207026 gbest301.seq
484974472 gbest302.seq
487589658 gbest303.seq
328634197 gbest304.seq
524290295 gbest305.seq
524291259 gbest306.seq
524289859 gbest307.seq
524290055 gbest308.seq
524289545 gbest309.seq
524291943 gbest31.seq
524291614 gbest310.seq
524290349 gbest311.seq
524290319 gbest312.seq
524290835 gbest313.seq
524290952 gbest314.seq
524291782 gbest315.seq
524291740 gbest316.seq
506267392 gbest317.seq
524291481 gbest318.seq
524291381 gbest319.seq
524288815 gbest32.seq
524291725 gbest320.seq
524289394 gbest321.seq
524291854 gbest322.seq
524289639 gbest323.seq
524288971 gbest324.seq
524290065 gbest325.seq
524290847 gbest326.seq
524289319 gbest327.seq
524289900 gbest328.seq
524290459 gbest329.seq
524290416 gbest33.seq
524288976 gbest330.seq
254883457 gbest331.seq
524291632 gbest332.seq
524289975 gbest333.seq
524290517 gbest334.seq
524293806 gbest335.seq
500866393 gbest336.seq
524290097 gbest337.seq
524291870 gbest338.seq
524290095 gbest339.seq
520131040 gbest34.seq
524290941 gbest340.seq
524291569 gbest341.seq
524292318 gbest342.seq
524290261 gbest343.seq
524291030 gbest344.seq
350275144 gbest345.seq
524289776 gbest346.seq
524289087 gbest347.seq
524291171 gbest348.seq
524291501 gbest349.seq
492756006 gbest35.seq
524288860 gbest350.seq
524289192 gbest351.seq
524290191 gbest352.seq
524295648 gbest353.seq
524291950 gbest354.seq
524290000 gbest355.seq
524290384 gbest356.seq
524289621 gbest357.seq
524292020 gbest358.seq
524291013 gbest359.seq
494458040 gbest36.seq
38761305 gbest360.seq
524289453 gbest361.seq
524290031 gbest362.seq
524290459 gbest363.seq
524289061 gbest364.seq
524291265 gbest365.seq
524290540 gbest366.seq
524289071 gbest367.seq
524289441 gbest368.seq
524289249 gbest369.seq
493332922 gbest37.seq
524290625 gbest370.seq
404361612 gbest371.seq
524291157 gbest372.seq
524289411 gbest373.seq
524290748 gbest374.seq
524289825 gbest375.seq
524289630 gbest376.seq
524288739 gbest377.seq
524290849 gbest378.seq
524288753 gbest379.seq
487995824 gbest38.seq
524290776 gbest380.seq
524289087 gbest381.seq
524290575 gbest382.seq
318561922 gbest383.seq
524290866 gbest384.seq
524290494 gbest385.seq
524289092 gbest386.seq
524289621 gbest387.seq
524289114 gbest388.seq
524289195 gbest389.seq
493158121 gbest39.seq
524290097 gbest390.seq
524289600 gbest391.seq
524291397 gbest392.seq
524291833 gbest393.seq
378210810 gbest394.seq
524290817 gbest395.seq
524291622 gbest396.seq
524290621 gbest397.seq
524291308 gbest398.seq
524290108 gbest399.seq
524289662 gbest4.seq
112919429 gbest40.seq
524289804 gbest400.seq
524289832 gbest401.seq
524289889 gbest402.seq
524289790 gbest403.seq
524290837 gbest404.seq
524291925 gbest405.seq
524292041 gbest406.seq
524288763 gbest407.seq
44548198 gbest408.seq
524289921 gbest409.seq
524292838 gbest41.seq
524290874 gbest410.seq
524291354 gbest411.seq
524291979 gbest412.seq
524289985 gbest413.seq
524289790 gbest414.seq
524290642 gbest415.seq
524291983 gbest416.seq
524290506 gbest417.seq
524290767 gbest418.seq
524290397 gbest419.seq
524290625 gbest42.seq
524291890 gbest420.seq
447551071 gbest421.seq
524288932 gbest422.seq
524289147 gbest423.seq
524288964 gbest424.seq
524292368 gbest425.seq
524293291 gbest426.seq
524291121 gbest427.seq
524289880 gbest428.seq
524291547 gbest429.seq
524290602 gbest43.seq
524290789 gbest430.seq
524292120 gbest431.seq
524291330 gbest432.seq
524288823 gbest433.seq
524289222 gbest434.seq
524293617 gbest435.seq
243727760 gbest436.seq
524288839 gbest437.seq
524289426 gbest438.seq
524291608 gbest439.seq
524290394 gbest44.seq
524288974 gbest440.seq
524290309 gbest441.seq
524293004 gbest442.seq
524289642 gbest443.seq
524294096 gbest444.seq
524291805 gbest445.seq
524289053 gbest446.seq
524290114 gbest447.seq
513021706 gbest448.seq
524289475 gbest449.seq
524289641 gbest45.seq
524289797 gbest450.seq
524290387 gbest451.seq
524290843 gbest452.seq
524289766 gbest453.seq
524288799 gbest454.seq
524291356 gbest455.seq
524289095 gbest456.seq
524288795 gbest457.seq
524288745 gbest458.seq
524291166 gbest459.seq
524289787 gbest46.seq
53115268 gbest460.seq
524291171 gbest461.seq
524291792 gbest462.seq
524292442 gbest463.seq
524290057 gbest464.seq
524291568 gbest465.seq
524289634 gbest466.seq
524290822 gbest467.seq
524289224 gbest468.seq
166287434 gbest469.seq
524291144 gbest47.seq
524291542 gbest48.seq
524291876 gbest49.seq
524290143 gbest5.seq
524290828 gbest50.seq
524290816 gbest51.seq
524290577 gbest52.seq
524288756 gbest53.seq
254312311 gbest54.seq
524289836 gbest55.seq
524289203 gbest56.seq
524289150 gbest57.seq
524290623 gbest58.seq
524288779 gbest59.seq
524289793 gbest6.seq
524291058 gbest60.seq
524292182 gbest61.seq
524288799 gbest62.seq
524288797 gbest63.seq
524290586 gbest64.seq
524292053 gbest65.seq
524290274 gbest66.seq
464607537 gbest67.seq
524293063 gbest68.seq
524289394 gbest69.seq
524291602 gbest7.seq
524289340 gbest70.seq
524288857 gbest71.seq
524289255 gbest72.seq
524289251 gbest73.seq
524289042 gbest74.seq
524291640 gbest75.seq
524289649 gbest76.seq
524289658 gbest77.seq
524290166 gbest78.seq
524290464 gbest79.seq
524289599 gbest8.seq
192249580 gbest80.seq
524291003 gbest81.seq
524290550 gbest82.seq
524290016 gbest83.seq
524289714 gbest84.seq
524289321 gbest85.seq
524288941 gbest86.seq
524290361 gbest87.seq
524291779 gbest88.seq
524289574 gbest89.seq
524292205 gbest9.seq
524289971 gbest90.seq
524289997 gbest91.seq
463226494 gbest92.seq
524291002 gbest93.seq
524291499 gbest94.seq
524291112 gbest95.seq
524289764 gbest96.seq
524292383 gbest97.seq
524289934 gbest98.seq
524290811 gbest99.seq
201814586 gbgen.idx
524289026 gbgss1.seq
524289844 gbgss10.seq
524292593 gbgss100.seq
524289703 gbgss101.seq
524291138 gbgss102.seq
524288836 gbgss103.seq
418618222 gbgss104.seq
524291713 gbgss105.seq
524289316 gbgss106.seq
524290741 gbgss107.seq
524289083 gbgss108.seq
524290725 gbgss109.seq
524291170 gbgss11.seq
524289982 gbgss110.seq
524288916 gbgss111.seq
524289888 gbgss112.seq
524290929 gbgss113.seq
524290980 gbgss114.seq
524290919 gbgss115.seq
56017889 gbgss116.seq
524291185 gbgss117.seq
524291250 gbgss118.seq
524288915 gbgss119.seq
524291525 gbgss12.seq
524289494 gbgss120.seq
524290592 gbgss121.seq
524289578 gbgss122.seq
524288786 gbgss123.seq
524290399 gbgss124.seq
524290777 gbgss125.seq
524288992 gbgss126.seq
524292648 gbgss127.seq
524290759 gbgss128.seq
205860585 gbgss129.seq
524290301 gbgss13.seq
524288727 gbgss130.seq
524291361 gbgss131.seq
524289314 gbgss132.seq
524290882 gbgss133.seq
524290446 gbgss134.seq
524289077 gbgss135.seq
524288773 gbgss136.seq
524289512 gbgss137.seq
524289529 gbgss138.seq
517498040 gbgss139.seq
524290907 gbgss14.seq
516021159 gbgss140.seq
157657040 gbgss141.seq
524290166 gbgss142.seq
524290567 gbgss143.seq
524289172 gbgss144.seq
524291451 gbgss145.seq
524289910 gbgss146.seq
524289696 gbgss147.seq
524288735 gbgss148.seq
524290937 gbgss149.seq
524291028 gbgss15.seq
524290571 gbgss150.seq
524289870 gbgss151.seq
325849535 gbgss152.seq
524289205 gbgss153.seq
524290938 gbgss154.seq
12228199 gbgss155.seq
249999496 gbgss156.seq
249999889 gbgss157.seq
249998684 gbgss158.seq
250000145 gbgss159.seq
524291189 gbgss16.seq
29276135 gbgss160.seq
249997137 gbgss161.seq
250000033 gbgss162.seq
249998542 gbgss163.seq
249998333 gbgss164.seq
224919493 gbgss165.seq
249998415 gbgss166.seq
249998761 gbgss167.seq
249999722 gbgss168.seq
249998936 gbgss169.seq
524289284 gbgss17.seq
191344183 gbgss170.seq
249997564 gbgss171.seq
249996752 gbgss172.seq
249999513 gbgss173.seq
249997874 gbgss174.seq
249999326 gbgss175.seq
77035229 gbgss176.seq
249999189 gbgss177.seq
2090297 gbgss178.seq
79542394 gbgss179.seq
524290445 gbgss18.seq
249998428 gbgss180.seq
249999593 gbgss181.seq
87205952 gbgss182.seq
249999685 gbgss183.seq
249998355 gbgss184.seq
249998984 gbgss185.seq
202702168 gbgss186.seq
249999232 gbgss187.seq
249998752 gbgss188.seq
250000079 gbgss189.seq
315745412 gbgss19.seq
246010499 gbgss190.seq
249997836 gbgss191.seq
249998110 gbgss192.seq
249999870 gbgss193.seq
243311140 gbgss194.seq
249999336 gbgss195.seq
249999577 gbgss196.seq
250000236 gbgss197.seq
249997665 gbgss198.seq
123207544 gbgss199.seq
524290822 gbgss2.seq
524289846 gbgss20.seq
249998013 gbgss200.seq
249999792 gbgss201.seq
249998459 gbgss202.seq
249998343 gbgss203.seq
95905540 gbgss204.seq
249999742 gbgss205.seq
249999443 gbgss206.seq
249998384 gbgss207.seq
249999963 gbgss208.seq
183118490 gbgss209.seq
524288871 gbgss21.seq
249999236 gbgss210.seq
249997993 gbgss211.seq
249998006 gbgss212.seq
249999353 gbgss213.seq
95926739 gbgss214.seq
249999461 gbgss215.seq
249999350 gbgss216.seq
249998406 gbgss217.seq
249998619 gbgss218.seq
249999398 gbgss219.seq
524290551 gbgss22.seq
249998401 gbgss220.seq
99057250 gbgss221.seq
249999424 gbgss222.seq
249999963 gbgss223.seq
249997369 gbgss224.seq
43648880 gbgss225.seq
52925443 gbgss226.seq
249997818 gbgss227.seq
249998543 gbgss228.seq
249997629 gbgss229.seq
524289209 gbgss23.seq
249998343 gbgss230.seq
32070531 gbgss231.seq
249997670 gbgss232.seq
249997588 gbgss233.seq
249999018 gbgss234.seq
250000000 gbgss235.seq
28042636 gbgss236.seq
249997661 gbgss237.seq
250000032 gbgss238.seq
249998827 gbgss239.seq
524290237 gbgss24.seq
249999616 gbgss240.seq
249999456 gbgss241.seq
249997806 gbgss242.seq
180456815 gbgss243.seq
249999812 gbgss244.seq
249998926 gbgss245.seq
249999095 gbgss246.seq
220154622 gbgss247.seq
250000034 gbgss248.seq
249997956 gbgss249.seq
524289518 gbgss25.seq
250000074 gbgss250.seq
249999182 gbgss251.seq
249999521 gbgss252.seq
249999273 gbgss253.seq
249999982 gbgss254.seq
141286832 gbgss255.seq
249999562 gbgss256.seq
249998752 gbgss257.seq
249999600 gbgss258.seq
249999029 gbgss259.seq
524289126 gbgss26.seq
221982324 gbgss260.seq
249999142 gbgss261.seq
249998695 gbgss262.seq
249999858 gbgss263.seq
249999896 gbgss264.seq
249999864 gbgss265.seq
152554870 gbgss266.seq
524291999 gbgss27.seq
524289238 gbgss28.seq
524290063 gbgss29.seq
524291579 gbgss3.seq
524291675 gbgss30.seq
39710031 gbgss31.seq
524291118 gbgss32.seq
524290113 gbgss33.seq
524289714 gbgss34.seq
524289477 gbgss35.seq
524289253 gbgss36.seq
524289803 gbgss37.seq
524290304 gbgss38.seq
509235276 gbgss39.seq
524290702 gbgss4.seq
524291637 gbgss40.seq
524290175 gbgss41.seq
524289258 gbgss42.seq
27372575 gbgss43.seq
524288946 gbgss44.seq
524288881 gbgss45.seq
524289248 gbgss46.seq
524288900 gbgss47.seq
223531204 gbgss48.seq
524290426 gbgss49.seq
168385992 gbgss5.seq
524289735 gbgss50.seq
524291269 gbgss51.seq
524290992 gbgss52.seq
524290041 gbgss53.seq
524288997 gbgss54.seq
524290556 gbgss55.seq
524291355 gbgss56.seq
524290944 gbgss57.seq
524289892 gbgss58.seq
524288808 gbgss59.seq
524290951 gbgss6.seq
36638942 gbgss60.seq
524291638 gbgss61.seq
524290608 gbgss62.seq
524291618 gbgss63.seq
461802182 gbgss64.seq
524290190 gbgss65.seq
524290828 gbgss66.seq
524290508 gbgss67.seq
524290868 gbgss68.seq
524289498 gbgss69.seq
524288841 gbgss7.seq
524288938 gbgss70.seq
524290467 gbgss71.seq
524288729 gbgss72.seq
524290924 gbgss73.seq
524289241 gbgss74.seq
524290569 gbgss75.seq
524289070 gbgss76.seq
49646918 gbgss77.seq
524291014 gbgss78.seq
524289021 gbgss79.seq
524291665 gbgss8.seq
524290279 gbgss80.seq
524290660 gbgss81.seq
524291034 gbgss82.seq
524290373 gbgss83.seq
524289673 gbgss84.seq
524289427 gbgss85.seq
524291776 gbgss86.seq
524289284 gbgss87.seq
524289797 gbgss88.seq
390928760 gbgss89.seq
524290499 gbgss9.seq
524292172 gbgss90.seq
524291677 gbgss91.seq
524291807 gbgss92.seq
524292003 gbgss93.seq
524289134 gbgss94.seq
524289592 gbgss95.seq
524289866 gbgss96.seq
524291875 gbgss97.seq
524291048 gbgss98.seq
524291620 gbgss99.seq
250000034 gbhtc1.seq
249998281 gbhtc10.seq
249998762 gbhtc11.seq
33437576 gbhtc12.seq
249997337 gbhtc13.seq
249994828 gbhtc14.seq
67274350 gbhtc15.seq
249992681 gbhtc2.seq
249996913 gbhtc3.seq
249991889 gbhtc4.seq
249985674 gbhtc5.seq
249997743 gbhtc6.seq
249996123 gbhtc7.seq
84096736 gbhtc8.seq
249996193 gbhtc9.seq
249909524 gbhtg1.seq
249801162 gbhtg10.seq
249894657 gbhtg100.seq
249851463 gbhtg101.seq
249884880 gbhtg102.seq
249950252 gbhtg103.seq
5461914 gbhtg104.seq
249937699 gbhtg105.seq
249890707 gbhtg106.seq
249627730 gbhtg107.seq
249965955 gbhtg108.seq
249971004 gbhtg109.seq
1643239 gbhtg11.seq
249972658 gbhtg110.seq
176571089 gbhtg111.seq
249888132 gbhtg112.seq
249872097 gbhtg113.seq
249841740 gbhtg114.seq
249832541 gbhtg115.seq
249995085 gbhtg116.seq
249945710 gbhtg117.seq
249836693 gbhtg118.seq
126275116 gbhtg119.seq
249888438 gbhtg12.seq
249867337 gbhtg120.seq
249979076 gbhtg121.seq
249936855 gbhtg122.seq
249805169 gbhtg123.seq
249979619 gbhtg124.seq
31665342 gbhtg125.seq
249945569 gbhtg126.seq
249834856 gbhtg127.seq
249925989 gbhtg128.seq
249893130 gbhtg129.seq
249970556 gbhtg13.seq
249991866 gbhtg130.seq
135260137 gbhtg131.seq
249837708 gbhtg132.seq
249847144 gbhtg133.seq
249810959 gbhtg134.seq
249845531 gbhtg135.seq
249864213 gbhtg136.seq
249977117 gbhtg137.seq
249910837 gbhtg138.seq
249836598 gbhtg139.seq
249587437 gbhtg14.seq
249920124 gbhtg140.seq
75375275 gbhtg141.seq
249775919 gbhtg15.seq
249742391 gbhtg16.seq
249169910 gbhtg17.seq
249983662 gbhtg18.seq
249677588 gbhtg19.seq
249996466 gbhtg2.seq
249988774 gbhtg20.seq
237145184 gbhtg21.seq
249760635 gbhtg22.seq
249868408 gbhtg23.seq
249987789 gbhtg24.seq
249921752 gbhtg25.seq
249761262 gbhtg26.seq
249891641 gbhtg27.seq
249961480 gbhtg28.seq
249842167 gbhtg29.seq
249996431 gbhtg3.seq
249992987 gbhtg30.seq
225324756 gbhtg31.seq
249827828 gbhtg32.seq
249920778 gbhtg33.seq
249929470 gbhtg34.seq
249919058 gbhtg35.seq
249858216 gbhtg36.seq
249814780 gbhtg37.seq
249767485 gbhtg38.seq
249627604 gbhtg39.seq
249972999 gbhtg4.seq
249839726 gbhtg40.seq
224363181 gbhtg41.seq
249889409 gbhtg42.seq
249786859 gbhtg43.seq
249974474 gbhtg44.seq
249775813 gbhtg45.seq
249912495 gbhtg46.seq
249597904 gbhtg47.seq
249994359 gbhtg48.seq
249827714 gbhtg49.seq
249989014 gbhtg5.seq
249877445 gbhtg50.seq
234821586 gbhtg51.seq
249732630 gbhtg52.seq
249917798 gbhtg53.seq
249773220 gbhtg54.seq
249971346 gbhtg55.seq
249962503 gbhtg56.seq
18795866 gbhtg57.seq
249861298 gbhtg58.seq
249823559 gbhtg59.seq
249770427 gbhtg6.seq
249990589 gbhtg60.seq
249921231 gbhtg61.seq
225131050 gbhtg62.seq
249853671 gbhtg63.seq
249787654 gbhtg64.seq
249883726 gbhtg65.seq
249980288 gbhtg66.seq
249833261 gbhtg67.seq
16614633 gbhtg68.seq
249960711 gbhtg69.seq
249852195 gbhtg7.seq
249973591 gbhtg70.seq
249953795 gbhtg71.seq
249976849 gbhtg72.seq
224833550 gbhtg73.seq
249811083 gbhtg74.seq
249874989 gbhtg75.seq
249800328 gbhtg76.seq
249959811 gbhtg77.seq
244236597 gbhtg78.seq
249884075 gbhtg79.seq
249758882 gbhtg8.seq
249989775 gbhtg80.seq
249840148 gbhtg81.seq
249838461 gbhtg82.seq
216751404 gbhtg83.seq
249966974 gbhtg84.seq
249803238 gbhtg85.seq
249757896 gbhtg86.seq
249849119 gbhtg87.seq
220831501 gbhtg88.seq
249970341 gbhtg89.seq
249968894 gbhtg9.seq
249954491 gbhtg90.seq
249999471 gbhtg91.seq
249963741 gbhtg92.seq
208664273 gbhtg93.seq
249905573 gbhtg94.seq
249944588 gbhtg95.seq
249904036 gbhtg96.seq
249769960 gbhtg97.seq
167889800 gbhtg98.seq
249798606 gbhtg99.seq
249998712 gbinv1.seq
249997945 gbinv10.seq
249997501 gbinv11.seq
193099722 gbinv12.seq
249998180 gbinv13.seq
249998605 gbinv14.seq
249999157 gbinv15.seq
160522773 gbinv16.seq
250000178 gbinv17.seq
249508872 gbinv18.seq
250000063 gbinv19.seq
249850930 gbinv2.seq
249996998 gbinv20.seq
249997898 gbinv21.seq
9690167 gbinv22.seq
224112048 gbinv23.seq
175506967 gbinv24.seq
249998732 gbinv25.seq
249997951 gbinv26.seq
112392647 gbinv27.seq
249996385 gbinv28.seq
249999761 gbinv29.seq
242181932 gbinv3.seq
249997292 gbinv30.seq
249997932 gbinv31.seq
249998522 gbinv32.seq
105364397 gbinv33.seq
249995925 gbinv4.seq
249997904 gbinv5.seq
249646019 gbinv6.seq
249998864 gbinv7.seq
41769375 gbinv8.seq
249999371 gbinv9.seq
139653117 gbjou1.idx
305951738 gbjou10.idx
302516740 gbjou11.idx
262372455 gbjou12.idx
238703697 gbjou13.idx
45025896 gbjou14.idx
140234453 gbjou2.idx
182631018 gbjou3.idx
142011534 gbjou4.idx
229603727 gbjou5.idx
289646521 gbjou6.idx
256639195 gbjou7.idx
290258399 gbjou8.idx
283033399 gbjou9.idx
369527497 gbkey1.idx
180097514 gbkey2.idx
179558259 gbkey3.idx
309611238 gbkey4.idx
247536231 gbkey5.idx
183461792 gbkey6.idx
137586030 gbkey7.idx
249935240 gbmam1.seq
249998953 gbmam2.seq
249898511 gbmam3.seq
249999810 gbmam4.seq
249999619 gbmam5.seq
249998002 gbmam6.seq
250000165 gbmam7.seq
87479973 gbmam8.seq
52390479 gbnew.txt
249998193 gbpat1.seq
249966570 gbpat10.seq
249999793 gbpat100.seq
149112469 gbpat101.seq
249999880 gbpat102.seq
249999565 gbpat103.seq
249929731 gbpat104.seq
249824879 gbpat105.seq
249998856 gbpat106.seq
192957907 gbpat107.seq
249999593 gbpat108.seq
249999662 gbpat109.seq
179860803 gbpat11.seq
249998806 gbpat110.seq
80199260 gbpat111.seq
250000209 gbpat112.seq
250000211 gbpat113.seq
249936636 gbpat114.seq
249999449 gbpat115.seq
249935711 gbpat116.seq
66835452 gbpat117.seq
249999441 gbpat118.seq
249999845 gbpat119.seq
249999826 gbpat12.seq
249999888 gbpat120.seq
249999095 gbpat121.seq
160256390 gbpat122.seq
249999974 gbpat123.seq
249999633 gbpat124.seq
234784218 gbpat125.seq
249991591 gbpat126.seq
249970935 gbpat127.seq
249999681 gbpat128.seq
249997397 gbpat129.seq
249995908 gbpat13.seq
249997452 gbpat130.seq
66832984 gbpat131.seq
249992315 gbpat132.seq
249999867 gbpat133.seq
250000197 gbpat134.seq
249999821 gbpat135.seq
249998337 gbpat136.seq
18437114 gbpat137.seq
249999655 gbpat138.seq
249998828 gbpat139.seq
249999124 gbpat14.seq
249999803 gbpat140.seq
249999630 gbpat141.seq
249999242 gbpat142.seq
249999273 gbpat143.seq
55168479 gbpat144.seq
249999438 gbpat145.seq
250000200 gbpat146.seq
249999807 gbpat147.seq
86173512 gbpat148.seq
249999922 gbpat149.seq
249999985 gbpat15.seq
249999961 gbpat150.seq
249999277 gbpat151.seq
63637512 gbpat152.seq
249994851 gbpat153.seq
249999301 gbpat154.seq
249999991 gbpat155.seq
249999773 gbpat156.seq
249999088 gbpat157.seq
249998425 gbpat158.seq
222475328 gbpat159.seq
249999418 gbpat16.seq
250000249 gbpat160.seq
249999893 gbpat161.seq
249999893 gbpat162.seq
220539897 gbpat163.seq
249999753 gbpat164.seq
249998873 gbpat165.seq
250000178 gbpat166.seq
12440475 gbpat167.seq
249997373 gbpat168.seq
249999251 gbpat169.seq
65986598 gbpat17.seq
249999441 gbpat170.seq
249999482 gbpat171.seq
35449233 gbpat172.seq
249999552 gbpat173.seq
250000201 gbpat174.seq
250000025 gbpat175.seq
249999693 gbpat176.seq
249999040 gbpat177.seq
249998959 gbpat178.seq
247951065 gbpat179.seq
250000027 gbpat18.seq
249999285 gbpat180.seq
249997244 gbpat181.seq
42044900 gbpat182.seq
249999620 gbpat183.seq
249999541 gbpat184.seq
249997935 gbpat185.seq
189314626 gbpat186.seq
249999801 gbpat19.seq
249998159 gbpat2.seq
249999814 gbpat20.seq
249999778 gbpat21.seq
186212090 gbpat22.seq
249999692 gbpat23.seq
249800945 gbpat24.seq
249999794 gbpat25.seq
249999392 gbpat26.seq
71609071 gbpat27.seq
249996649 gbpat28.seq
249999808 gbpat29.seq
249999030 gbpat3.seq
249999481 gbpat30.seq
250000189 gbpat31.seq
249996516 gbpat32.seq
180287970 gbpat33.seq
249998977 gbpat34.seq
250000259 gbpat35.seq
249998189 gbpat36.seq
249999049 gbpat37.seq
130633235 gbpat38.seq
249999173 gbpat39.seq
249998670 gbpat4.seq
249937583 gbpat40.seq
249999520 gbpat41.seq
249999371 gbpat42.seq
249999481 gbpat43.seq
249903319 gbpat44.seq
249999213 gbpat45.seq
249996593 gbpat46.seq
171732671 gbpat47.seq
249999839 gbpat48.seq
249997524 gbpat49.seq
71721496 gbpat5.seq
249999853 gbpat50.seq
249999528 gbpat51.seq
222937739 gbpat52.seq
249999057 gbpat53.seq
249999815 gbpat54.seq
250000246 gbpat55.seq
164998761 gbpat56.seq
249900380 gbpat57.seq
249997770 gbpat58.seq
249999301 gbpat59.seq
249999527 gbpat6.seq
250000043 gbpat60.seq
135013469 gbpat61.seq
249999749 gbpat62.seq
249999978 gbpat63.seq
249999690 gbpat64.seq
249998210 gbpat65.seq
249999753 gbpat66.seq
249999446 gbpat67.seq
144888062 gbpat68.seq
249999889 gbpat69.seq
249998838 gbpat7.seq
249999899 gbpat70.seq
249998837 gbpat71.seq
244404758 gbpat72.seq
248969093 gbpat73.seq
244459306 gbpat74.seq
247876384 gbpat75.seq
249999948 gbpat76.seq
160624439 gbpat77.seq
250000121 gbpat78.seq
249999657 gbpat79.seq
249995557 gbpat8.seq
249999470 gbpat80.seq
249999644 gbpat81.seq
249998084 gbpat82.seq
249999401 gbpat83.seq
93400075 gbpat84.seq
249158865 gbpat85.seq
249999180 gbpat86.seq
249999967 gbpat87.seq
249999380 gbpat88.seq
249999163 gbpat89.seq
249999808 gbpat9.seq
249999627 gbpat90.seq
145305049 gbpat91.seq
249999937 gbpat92.seq
249998980 gbpat93.seq
249999939 gbpat94.seq
250000257 gbpat95.seq
196964910 gbpat96.seq
249999051 gbpat97.seq
249998995 gbpat98.seq
249999064 gbpat99.seq
230818025 gbphg1.seq
249997545 gbpln1.seq
249998565 gbpln10.seq
249993306 gbpln11.seq
250000254 gbpln12.seq
249900575 gbpln13.seq
214586113 gbpln14.seq
249969765 gbpln15.seq
249989406 gbpln16.seq
249992843 gbpln17.seq
249924507 gbpln18.seq
249996257 gbpln19.seq
249918275 gbpln2.seq
249952454 gbpln20.seq
249995704 gbpln21.seq
33983526 gbpln22.seq
249992921 gbpln23.seq
97754938 gbpln24.seq
249999382 gbpln25.seq
249995970 gbpln26.seq
249848261 gbpln27.seq
221260740 gbpln28.seq
181007284 gbpln29.seq
249994029 gbpln3.seq
249671356 gbpln30.seq
249895640 gbpln31.seq
249994023 gbpln32.seq
249997908 gbpln33.seq
249999059 gbpln34.seq
156502746 gbpln35.seq
249999752 gbpln36.seq
249999041 gbpln37.seq
249999001 gbpln38.seq
249997563 gbpln39.seq
249917005 gbpln4.seq
144167610 gbpln40.seq
249997477 gbpln41.seq
249845452 gbpln42.seq
249997485 gbpln43.seq
249998476 gbpln44.seq
249996109 gbpln45.seq
227633133 gbpln46.seq
249998503 gbpln47.seq
249751888 gbpln48.seq
249995936 gbpln49.seq
249842114 gbpln5.seq
250000244 gbpln50.seq
249997310 gbpln51.seq
31368295 gbpln52.seq
249997726 gbpln53.seq
249998384 gbpln54.seq
249999465 gbpln55.seq
249999877 gbpln56.seq
249999223 gbpln57.seq
249999833 gbpln58.seq
249952509 gbpln59.seq
249880283 gbpln6.seq
75545322 gbpln60.seq
249978864 gbpln7.seq
249999164 gbpln8.seq
145209295 gbpln9.seq
148969497 gbpri1.seq
249993033 gbpri10.seq
131938294 gbpri11.seq
249962747 gbpri12.seq
249896480 gbpri13.seq
249896770 gbpri14.seq
249947119 gbpri15.seq
249902715 gbpri16.seq
249876249 gbpri17.seq
249992266 gbpri18.seq
249904047 gbpri19.seq
249807913 gbpri2.seq
249955645 gbpri20.seq
250000172 gbpri21.seq
249994114 gbpri22.seq
60000368 gbpri23.seq
177493190 gbpri24.seq
249999059 gbpri25.seq
211357951 gbpri26.seq
249984227 gbpri27.seq
249987897 gbpri28.seq
249947758 gbpri29.seq
249763617 gbpri3.seq
249952378 gbpri30.seq
249928541 gbpri31.seq
249929431 gbpri32.seq
249781192 gbpri33.seq
249998148 gbpri34.seq
98516387 gbpri35.seq
249993971 gbpri36.seq
249995813 gbpri37.seq
249991821 gbpri38.seq
249997505 gbpri39.seq
249866503 gbpri4.seq
249998577 gbpri40.seq
185177533 gbpri41.seq
249970794 gbpri42.seq
249994227 gbpri43.seq
249986882 gbpri44.seq
96978239 gbpri45.seq
249944069 gbpri5.seq
249730784 gbpri6.seq
249931207 gbpri7.seq
249905792 gbpri8.seq
249912971 gbpri9.seq
345156 gbrel.txt
249949785 gbrod1.seq
249717957 gbrod10.seq
63680045 gbrod11.seq
249871284 gbrod12.seq
249783783 gbrod13.seq
249992872 gbrod14.seq
249651633 gbrod15.seq
249953778 gbrod16.seq
249885197 gbrod17.seq
249979586 gbrod18.seq
249999251 gbrod19.seq
249919186 gbrod2.seq
2229303 gbrod20.seq
249995210 gbrod21.seq
249874132 gbrod22.seq
229587598 gbrod23.seq
249999481 gbrod24.seq
249998968 gbrod25.seq
249953950 gbrod26.seq
249850861 gbrod27.seq
249999639 gbrod28.seq
249999941 gbrod29.seq
249817179 gbrod3.seq
236163617 gbrod30.seq
249758303 gbrod4.seq
249923723 gbrod5.seq
249926300 gbrod6.seq
249975620 gbrod7.seq
249873596 gbrod8.seq
249907491 gbrod9.seq
4737614390 gbsdr1.txt
5930250779 gbsdr2.txt
2813319338 gbsdr3.txt
168328240 gbsec.idx
249996594 gbsts1.seq
249997720 gbsts10.seq
210919464 gbsts11.seq
249996524 gbsts12.seq
249998812 gbsts13.seq
250000101 gbsts14.seq
249999569 gbsts15.seq
24453604 gbsts16.seq
249999107 gbsts17.seq
249999933 gbsts18.seq
249998944 gbsts19.seq
249998310 gbsts2.seq
148913001 gbsts20.seq
250000245 gbsts3.seq
249996479 gbsts4.seq
39285911 gbsts5.seq
249997411 gbsts6.seq
249997774 gbsts7.seq
249997192 gbsts8.seq
249999304 gbsts9.seq
249995920 gbsyn1.seq
249981623 gbsyn2.seq
249997554 gbsyn3.seq
249996353 gbsyn4.seq
249975878 gbsyn5.seq
249955425 gbsyn6.seq
144783288 gbsyn7.seq
249998949 gbtsa1.seq
60152536 gbtsa10.seq
249997003 gbtsa100.seq
249999281 gbtsa101.seq
1334675 gbtsa102.seq
249998403 gbtsa103.seq
249999879 gbtsa104.seq
249998407 gbtsa105.seq
220751547 gbtsa106.seq
249998876 gbtsa107.seq
249999656 gbtsa108.seq
249999002 gbtsa109.seq
249997488 gbtsa11.seq
249999943 gbtsa110.seq
249999202 gbtsa111.seq
249998716 gbtsa112.seq
86653500 gbtsa113.seq
249999536 gbtsa114.seq
249998915 gbtsa115.seq
250000174 gbtsa116.seq
249999584 gbtsa117.seq
249997105 gbtsa118.seq
196200322 gbtsa119.seq
249995952 gbtsa12.seq
249999600 gbtsa120.seq
249997177 gbtsa121.seq
249997962 gbtsa122.seq
249998009 gbtsa123.seq
249998087 gbtsa124.seq
141344419 gbtsa125.seq
249999992 gbtsa126.seq
249998022 gbtsa127.seq
249999451 gbtsa128.seq
249997691 gbtsa129.seq
249999431 gbtsa13.seq
250000208 gbtsa130.seq
249999426 gbtsa131.seq
249999178 gbtsa132.seq
62449604 gbtsa133.seq
249999867 gbtsa14.seq
249998879 gbtsa15.seq
95217644 gbtsa16.seq
249998989 gbtsa17.seq
249996697 gbtsa18.seq
250000256 gbtsa19.seq
249997872 gbtsa2.seq
250000004 gbtsa20.seq
176116574 gbtsa21.seq
249999624 gbtsa22.seq
249998425 gbtsa23.seq
249999518 gbtsa24.seq
249998454 gbtsa25.seq
250000040 gbtsa26.seq
249999767 gbtsa27.seq
41959363 gbtsa28.seq
249999943 gbtsa29.seq
249998023 gbtsa3.seq
249997667 gbtsa30.seq
249999230 gbtsa31.seq
249999662 gbtsa32.seq
249999628 gbtsa33.seq
249998835 gbtsa34.seq
249997944 gbtsa35.seq
31386227 gbtsa36.seq
249997659 gbtsa37.seq
249999281 gbtsa38.seq
249999924 gbtsa39.seq
249999252 gbtsa4.seq
249999417 gbtsa40.seq
63239206 gbtsa41.seq
249998923 gbtsa42.seq
249998706 gbtsa43.seq
249998890 gbtsa44.seq
249998517 gbtsa45.seq
142526862 gbtsa46.seq
249999615 gbtsa47.seq
249998316 gbtsa48.seq
250000207 gbtsa49.seq
89230768 gbtsa5.seq
249998646 gbtsa50.seq
249998977 gbtsa51.seq
250000181 gbtsa52.seq
249997869 gbtsa53.seq
179226620 gbtsa54.seq
249996642 gbtsa55.seq
249998501 gbtsa56.seq
249999029 gbtsa57.seq
249999341 gbtsa58.seq
249997360 gbtsa59.seq
250000053 gbtsa6.seq
249999156 gbtsa60.seq
214694295 gbtsa61.seq
249999216 gbtsa62.seq
250000224 gbtsa63.seq
249997709 gbtsa64.seq
249998145 gbtsa65.seq
250000254 gbtsa66.seq
249998340 gbtsa67.seq
38814484 gbtsa68.seq
249999943 gbtsa69.seq
250000072 gbtsa7.seq
249997909 gbtsa70.seq
249999642 gbtsa71.seq
249997773 gbtsa72.seq
250000145 gbtsa73.seq
27201327 gbtsa74.seq
249998262 gbtsa75.seq
249998150 gbtsa76.seq
250000055 gbtsa77.seq
249999298 gbtsa78.seq
249999514 gbtsa79.seq
250000052 gbtsa8.seq
249998034 gbtsa80.seq
249999155 gbtsa81.seq
249997971 gbtsa82.seq
60599946 gbtsa83.seq
249999275 gbtsa84.seq
250000004 gbtsa85.seq
249999185 gbtsa86.seq
249998243 gbtsa87.seq
249998072 gbtsa88.seq
249998426 gbtsa89.seq
249997923 gbtsa9.seq
123684162 gbtsa90.seq
249999742 gbtsa91.seq
249999761 gbtsa92.seq
249999367 gbtsa93.seq
249999468 gbtsa94.seq
249999164 gbtsa95.seq
192781125 gbtsa96.seq
249998447 gbtsa97.seq
249998988 gbtsa98.seq
249999713 gbtsa99.seq
496452 gbuna1.seq
250000095 gbvrl1.seq
249999180 gbvrl10.seq
249999071 gbvrl11.seq
5759641 gbvrl12.seq
249994930 gbvrl13.seq
249994236 gbvrl14.seq
249997861 gbvrl15.seq
249998218 gbvrl16.seq
166109485 gbvrl17.seq
249998013 gbvrl18.seq
249998801 gbvrl19.seq
249997820 gbvrl2.seq
249997152 gbvrl20.seq
249995004 gbvrl21.seq
249996808 gbvrl22.seq
249998984 gbvrl23.seq
414375 gbvrl24.seq
249926101 gbvrl3.seq
249999003 gbvrl4.seq
209976944 gbvrl5.seq
249994294 gbvrl6.seq
249994836 gbvrl7.seq
249999911 gbvrl8.seq
250000232 gbvrl9.seq
249961254 gbvrt1.seq
249895356 gbvrt10.seq
249750874 gbvrt11.seq
184127575 gbvrt12.seq
249999279 gbvrt13.seq
249959170 gbvrt14.seq
249924716 gbvrt15.seq
249999237 gbvrt16.seq
249998367 gbvrt17.seq
250000235 gbvrt18.seq
98742075 gbvrt19.seq
249850143 gbvrt2.seq
249887121 gbvrt20.seq
250000208 gbvrt21.seq
249997224 gbvrt22.seq
249998545 gbvrt23.seq
249999933 gbvrt24.seq
249999417 gbvrt25.seq
249998562 gbvrt26.seq
249997507 gbvrt27.seq
97158439 gbvrt28.seq
249963547 gbvrt3.seq
249996506 gbvrt4.seq
131426440 gbvrt5.seq
249997623 gbvrt6.seq
249997706 gbvrt7.seq
249845786 gbvrt8.seq
249966600 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 63888 86340600
BCT10 66 116730258
BCT11 74 112572581
BCT12 115 115325441
BCT13 44 113286588
BCT14 16101 45900496
BCT15 53933 85391494
BCT16 93 110189094
BCT17 151 93915681
BCT18 61 112455059
BCT19 52 112042350
BCT2 9303 107386669
BCT20 46 114233015
BCT21 58 114931588
BCT22 67 111284815
BCT23 36 96325907
BCT24 40 106881287
BCT25 58 105533856
BCT26 74 111675186
BCT27 55 110045255
BCT28 63 106845575
BCT29 55 109391288
BCT3 51 111730201
BCT30 53 108650404
BCT31 46 110496749
BCT32 95 109522868
BCT33 59 110966729
BCT34 67 108616570
BCT35 124 106350090
BCT36 37 71643089
BCT37 200 108779787
BCT38 53 109968995
BCT39 38 108760252
BCT4 57 110144992
BCT40 58 108566760
BCT41 56 107056790
BCT42 44 107631668
BCT43 74 110145776
BCT44 63 109222644
BCT45 45 107106306
BCT46 59 105661869
BCT47 80 110031975
BCT48 76 103598262
BCT49 67 109336234
BCT5 38316 85872926
BCT50 60 103344001
BCT51 51 106715862
BCT52 56 105766361
BCT53 54 107452055
BCT54 64 111546035
BCT55 47 104055611
BCT56 69 108689945
BCT57 61 113403997
BCT58 63 109502277
BCT59 59 106513356
BCT6 39042 82648525
BCT60 50 113684587
BCT61 44 59244432
BCT62 45 109838849
BCT63 54 116177316
BCT64 57 111090564
BCT65 56 111571292
BCT66 102 116204889
BCT67 67 109027650
BCT68 80 111435017
BCT69 68 113994403
BCT7 5518 94828825
BCT70 52 113913938
BCT71 225 95528479
BCT72 376 72290807
BCT73 1589 2511877
BCT74 3179 5215935
BCT75 6347 7902871
BCT76 12648 15076979
BCT77 25619 27730021
BCT78 50524 54036409
BCT79 76139 77858274
BCT8 13773 81411004
BCT80 71233 77102794
BCT81 10094 94548001
BCT82 5443 100113481
BCT83 3211 107502572
BCT84 39 113461033
BCT85 1377 109099320
BCT86 6934 106002415
BCT87 40874 79680103
BCT88 67835 79701972
BCT89 4480 124690675
BCT9 6838 96099579
BCT90 26527 101207057
BCT91 75346 79675337
BCT92 75194 79002058
BCT93 67762 84441790
BCT94 23257 49538984
ENV1 94080 70634002
ENV10 93250 72982637
ENV11 82332 86662857
ENV12 21644 18468544
ENV13 84743 80841658
ENV14 118364 43039093
ENV15 89233 77180489
ENV16 96479 67794543
ENV17 96133 63327718
ENV18 110416 66944404
ENV19 117227 67803293
ENV2 94934 68860711
ENV20 56903 76832675
ENV21 67983 87505211
ENV22 91115 74560969
ENV23 128216 34623603
ENV24 123049 29082800
ENV25 78030 17901364
ENV26 123116 49780205
ENV27 97684 67397751
ENV28 115376 56410520
ENV29 136243 52741590
ENV3 84741 75594626
ENV30 109360 60400528
ENV31 76826 57924657
ENV32 62536 84995133
ENV33 88978 73398407
ENV34 102577 44130007
ENV35 96856 56219030
ENV36 70729 54730318
ENV37 111261 47217346
ENV38 101113 61216049
ENV39 107371 63129753
ENV4 79371 84820489
ENV40 63539 90710507
ENV41 72606 78834702
ENV42 62030 84259217
ENV43 11413 15551065
ENV44 71764 79089616
ENV45 108513 49125613
ENV46 112296 56650035
ENV47 104745 61113822
ENV48 72555 38307336
ENV49 100648 44043310
ENV5 90282 82759129
ENV50 42759 53800802
ENV51 42382 55133702
ENV52 60220 57366478
ENV53 97363 60217263
ENV54 97682 61842906
ENV55 78540 75931392
ENV56 84767 73451588
ENV57 83498 68007280
ENV6 96541 71902999
ENV7 11642 1204124
ENV8 131425 31030486
ENV9 86267 70399540
EST1 158919 61572670
EST10 167129 71984323
EST100 231749 140772529
EST101 237802 124863586
EST102 190114 104224412
EST103 184389 101964766
EST104 103247 71881159
EST105 160238 119729344
EST106 172270 105499510
EST107 135008 84836872
EST108 64411 24033505
EST109 63775 22429972
EST11 169726 74101477
EST110 64301 23292833
EST111 64312 27064478
EST112 64824 23109396
EST113 65040 24787956
EST114 63924 27183288
EST115 64305 26427792
EST116 64500 27446016
EST117 64330 25257084
EST118 61687 34900199
EST119 143038 68917528
EST12 166639 70027404
EST120 160823 84983810
EST121 177040 92870397
EST122 149336 96412173
EST123 156334 91869623
EST124 120478 78374164
EST125 189366 90775248
EST126 156190 83094079
EST127 157289 84434694
EST128 156452 84631956
EST129 151662 85045913
EST13 73158 35011848
EST130 172863 92801648
EST131 183341 116977842
EST132 202662 102437436
EST133 159016 87139471
EST134 163141 82938644
EST135 142115 83539088
EST136 144994 89684657
EST137 100783 53711430
EST138 173395 97925516
EST139 245193 113138870
EST14 217745 109271346
EST140 154619 83534807
EST141 167331 92303829
EST142 150640 88090999
EST143 133588 81688242
EST144 154274 96742808
EST145 155932 85644492
EST146 124543 63435615
EST147 121489 65221020
EST148 127996 58061797
EST149 127406 51316910
EST15 168431 105132539
EST150 128755 51319502
EST151 114833 42807416
EST152 163801 82660437
EST153 176181 73812304
EST154 162348 110217304
EST155 199927 122648309
EST156 214268 121769023
EST157 175422 97166329
EST158 154750 108205291
EST159 141959 95121101
EST16 179084 112633161
EST160 154676 96139161
EST161 157581 82568247
EST162 139275 78418222
EST163 167513 93150805
EST164 72232 44782245
EST165 150029 91764362
EST166 191840 110265818
EST167 145721 83919302
EST168 142893 72433927
EST169 148912 87008316
EST17 195685 113131970
EST170 190780 104719634
EST171 156408 95941430
EST172 168551 82345345
EST173 125071 86537416
EST174 169937 99558203
EST175 173293 100698263
EST176 122559 68070004
EST177 157100 90321357
EST178 36849 21420370
EST179 169725 102574547
EST18 190561 121379316
EST180 180456 118976550
EST181 143353 116926014
EST182 194741 99546613
EST183 153266 102154770
EST184 154550 102140845
EST185 141624 81872080
EST186 175373 70836836
EST187 150651 85177237
EST188 158231 99169959
EST189 155010 96146820
EST19 159386 114142539
EST190 139183 82593535
EST191 165735 100288856
EST192 145555 93181300
EST193 129262 90353064
EST194 144242 88158686
EST195 135838 88463392
EST196 129805 92785173
EST197 162715 86807031
EST198 173959 95599987
EST199 173380 96533469
EST2 161834 61542584
EST20 186577 99324176
EST200 171665 95207781
EST201 168844 95359055
EST202 171389 95601548
EST203 173218 95039162
EST204 173942 95722301
EST205 26179 14201628
EST206 188666 105140228
EST207 204788 104607185
EST208 172206 101984825
EST209 180082 101645409
EST21 217052 106282093
EST210 201557 123069738
EST211 193564 111778688
EST212 193327 123632162
EST213 156762 103960559
EST214 218953 141758937
EST215 235670 114634893
EST216 147262 103665363
EST217 162301 109349330
EST218 147453 94939632
EST219 177633 98544294
EST22 198935 66110089
EST220 189815 118129668
EST221 111639 87731310
EST222 134723 121253778
EST223 160087 93034720
EST224 148056 95110635
EST225 194888 107673099
EST226 166409 104030420
EST227 134164 92479723
EST228 142048 105261689
EST229 121265 87265744
EST23 141044 40102142
EST230 89519 60493727
EST231 144781 89891979
EST232 132135 93877362
EST233 142188 101215783
EST234 120293 86724357
EST235 125389 84240669
EST236 153342 106012548
EST237 160290 115762472
EST238 118512 122182911
EST239 148247 89069377
EST24 103792 28101228
EST240 183055 118555478
EST241 151201 92537859
EST242 170706 107985212
EST243 166992 121549203
EST244 146652 107340931
EST245 8821 6297674
EST246 151698 100083615
EST247 206401 97760018
EST248 197190 110509881
EST249 146730 91246012
EST25 121417 50819791
EST250 220509 24591161
EST251 220757 90224198
EST252 164688 118586858
EST253 177323 103391478
EST254 160925 107362888
EST255 174767 114828245
EST256 157396 114454754
EST257 101587 56562872
EST258 185290 97789542
EST259 177020 102333462
EST26 213499 97038736
EST260 165945 121341562
EST261 210617 102298223
EST262 269626 117361536
EST263 214175 122803863
EST264 182515 44130788
EST265 240429 107139169
EST266 174699 100603188
EST267 166980 104768422
EST268 92703 57317152
EST269 164008 113448082
EST27 218820 110009166
EST270 201482 103908892
EST271 152198 104671676
EST272 197849 116698704
EST273 195435 52634508
EST274 210345 39515235
EST275 182487 101639428
EST276 164485 115829460
EST277 189723 115609496
EST278 180324 107444175
EST279 160100 104323634
EST28 190225 88566306
EST280 106176 40415616
EST281 147608 85688358
EST282 116997 78196969
EST283 157391 106345076
EST284 244371 38963066
EST285 263888 24179822
EST286 171226 88713415
EST287 166713 109455599
EST288 160236 104721685
EST289 148728 92147699
EST29 158140 68949619
EST290 258853 39411731
EST291 177774 95011198
EST292 64658 47807914
EST293 192288 109495949
EST294 144676 79301602
EST295 178867 121754101
EST296 188874 110715732
EST297 151815 112638053
EST298 189996 105406429
EST299 180003 100584020
EST3 153587 54414675
EST30 171784 69731783
EST300 172989 111835990
EST301 188954 63259286
EST302 187215 68636618
EST303 187693 72978089
EST304 127943 46965613
EST305 192220 88859029
EST306 179878 125359922
EST307 160577 94461608
EST308 154562 91289178
EST309 127998 97518571
EST31 148798 63215415
EST310 148257 98975851
EST311 162514 99311486
EST312 167380 93661022
EST313 170425 103508452
EST314 150236 97256011
EST315 149921 101418600
EST316 164126 107808123
EST317 151477 104729984
EST318 178930 150066110
EST319 174220 115922241
EST32 168191 75999485
EST320 140807 74916813
EST321 144272 98338473
EST322 145476 100501581
EST323 132260 88840633
EST324 148766 98875203
EST325 147534 100652148
EST326 177704 112958795
EST327 153640 83501446
EST328 150332 86440107
EST329 150028 104615003
EST33 173575 66331428
EST330 155928 98370097
EST331 80103 47809043
EST332 143136 90983412
EST333 141822 89323839
EST334 205406 111660479
EST335 136866 74830597
EST336 92239 54998932
EST337 129768 85498810
EST338 137181 87079823
EST339 125454 80203777
EST34 123666 43772322
EST340 158680 85031716
EST341 216415 84673734
EST342 170961 87043911
EST343 170542 103355429
EST344 165599 98545174
EST345 85195 56818958
EST346 132583 88321712
EST347 135769 88417064
EST348 185447 121452557
EST349 160052 96829127
EST35 97392 29901612
EST350 157821 80458615
EST351 188325 128200311
EST352 117008 80983529
EST353 73337 44043339
EST354 137990 76044685
EST355 130199 78001499
EST356 147893 57472031
EST357 158641 32388545
EST358 158522 32654000
EST359 181690 104863591
EST36 97797 30573657
EST360 13830 10020203
EST361 226528 117645043
EST362 250986 114594557
EST363 201849 104346552
EST364 147077 94884500
EST365 135875 87086452
EST366 144697 86543814
EST367 182282 113094802
EST368 225276 81760271
EST369 191174 97506223
EST37 96709 29350645
EST370 211794 119278204
EST371 157756 90550200
EST372 205453 123923147
EST373 139288 65105629
EST374 209944 126465253
EST375 144698 91227909
EST376 181593 135807337
EST377 182798 142044087
EST378 158803 98929133
EST379 163881 102967917
EST38 98626 29829355
EST380 184919 108478171
EST381 186900 111119928
EST382 201318 103514413
EST383 120404 69929361
EST384 193588 119297215
EST385 184194 122739203
EST386 202901 136477088
EST387 225010 130652354
EST388 205470 134198299
EST389 206163 168424965
EST39 99402 31247597
EST390 219274 137317096
EST391 157523 99741031
EST392 194974 109669944
EST393 171234 24001559
EST394 118241 9489162
EST395 155674 18314756
EST396 158493 32725445
EST397 158488 32733839
EST398 155723 50099644
EST399 158803 92844614
EST4 170787 67086973
EST40 23376 5955593
EST400 176396 117072092
EST401 167310 104812372
EST402 162548 108170858
EST403 142770 95452735
EST404 141845 100825922
EST405 148885 95509032
EST406 178022 128561198
EST407 150361 97253853
EST408 16453 7432944
EST409 169111 70776368
EST41 101036 52978962
EST410 167342 26337577
EST411 162793 98210764
EST412 154013 103007271
EST413 173191 113644512
EST414 137734 77075106
EST415 200105 105982021
EST416 162490 124574583
EST417 133943 91628649
EST418 137442 91638883
EST419 149610 93722780
EST42 119505 50852299
EST420 173153 95340281
EST421 158985 84597038
EST422 137678 87926718
EST423 179612 104468439
EST424 173789 105686718
EST425 122778 79345530
EST426 89212 67518421
EST427 88058 63485828
EST428 117338 74142897
EST429 152103 84937546
EST43 165753 91693048
EST430 128497 78453720
EST431 137855 92049560
EST432 141896 83863152
EST433 165605 96459432
EST434 179331 94028194
EST435 167935 107128098
EST436 44101 31379519
EST437 194789 107638049
EST438 176037 83187413
EST439 163153 93351865
EST44 170246 72313271
EST440 151200 83335227
EST441 213433 124419036
EST442 186315 112790815
EST443 172457 104000167
EST444 143630 105708096
EST445 137733 88422716
EST446 147212 79775262
EST447 201789 85354600
EST448 190935 80752211
EST449 205900 86947156
EST45 167182 84780659
EST450 193893 86903149
EST451 179916 111179980
EST452 193079 99553005
EST453 187333 87185961
EST454 195461 99324430
EST455 208536 121717032
EST456 165170 101267401
EST457 199219 125399307
EST458 160114 96178414
EST459 143327 108717908
EST46 168571 86876213
EST460 19441 10175048
EST461 164128 88978553
EST462 173618 90062718
EST463 158160 84781954
EST464 152945 80138932
EST465 186606 112639643
EST466 169043 102017115
EST467 161553 58670660
EST468 167250 62408250
EST469 54078 19775154
EST47 163197 87800226
EST48 162159 83311032
EST49 160130 91073106
EST5 168952 66190553
EST50 161519 88055872
EST51 157142 98931862
EST52 159534 69783474
EST53 145744 81580446
EST54 78282 50684489
EST55 166998 69861335
EST56 164703 74781569
EST57 164316 90708006
EST58 159172 97176000
EST59 156478 101488510
EST6 171459 66908856
EST60 164590 98897469
EST61 160097 108007536
EST62 171062 81460929
EST63 173105 92388448
EST64 155492 84170199
EST65 148906 81879959
EST66 158744 98435905
EST67 136336 77286380
EST68 149444 91685980
EST69 194804 108030504
EST7 169831 72796891
EST70 180865 95055169
EST71 221042 121169840
EST72 185580 110616087
EST73 203853 121323409
EST74 163284 90034017
EST75 134028 61460929
EST76 139672 68734673
EST77 154478 93937758
EST78 157740 100227793
EST79 141893 78483123
EST8 179310 72804476
EST80 53302 24833375
EST81 164021 100432976
EST82 211918 114767416
EST83 223611 123692820
EST84 200512 94285645
EST85 211029 93336864
EST86 162223 92841079
EST87 144119 86882732
EST88 164216 81048622
EST89 158046 79866714
EST9 168652 69370591
EST90 152900 102080272
EST91 152111 88935308
EST92 135239 87202192
EST93 156077 113043871
EST94 142346 104167726
EST95 143182 102383328
EST96 141134 97515737
EST97 147035 81003833
EST98 178708 111255302
EST99 224217 135780018
GSS1 200048 87610092
GSS10 132038 60282099
GSS100 145362 114337340
GSS101 141643 116113759
GSS102 143263 116656493
GSS103 167236 128919983
GSS104 149785 82570423
GSS105 191524 120851950
GSS106 167632 112045614
GSS107 197296 115493118
GSS108 204965 134780727
GSS109 209819 138217689
GSS11 137026 73963370
GSS110 207582 140843516
GSS111 206233 142445620
GSS112 205238 143754971
GSS113 205194 143913071
GSS114 202116 146642681
GSS115 182317 139927856
GSS116 18568 10956232
GSS117 132846 84050698
GSS118 169072 79781623
GSS119 183491 78755162
GSS12 147892 75892995
GSS120 169916 147882149
GSS121 177512 120186675
GSS122 179713 146295726
GSS123 187250 120318213
GSS124 187062 139575867
GSS125 192224 126960214
GSS126 192029 92813578
GSS127 167985 157296408
GSS128 162913 113579956
GSS129 63418 38615282
GSS13 145394 68606312
GSS130 171035 155492836
GSS131 172358 154451939
GSS132 172393 155154973
GSS133 173792 154156214
GSS134 171958 154859390
GSS135 180250 138356993
GSS136 178139 146370889
GSS137 165379 118879881
GSS138 189589 95371310
GSS139 265791 41850257
GSS14 169793 84763419
GSS140 265731 40965089
GSS141 81219 12472225
GSS142 254318 58599684
GSS143 260089 56261917
GSS144 190610 86317232
GSS145 196144 66075506
GSS146 186142 147967035
GSS147 182754 151060436
GSS148 167957 155155954
GSS149 171115 157882127
GSS15 161094 97661031
GSS150 235017 72742338
GSS151 227934 79455322
GSS152 136153 57238868
GSS153 179653 71119162
GSS154 168958 109397161
GSS155 4299 2111577
GSS156 87073 63907368
GSS157 83560 62804048
GSS158 103629 48601102
GSS159 68649 58501218
GSS16 172835 87034673
GSS160 7850 7157001
GSS161 68591 57924394
GSS162 69224 56650935
GSS163 69460 56187403
GSS164 71202 55998401
GSS165 68561 51865315
GSS166 75915 58209304
GSS167 87237 74898207
GSS168 81504 44375177
GSS169 92239 44894040
GSS17 183363 113392831
GSS170 63973 47973862
GSS171 77367 61295678
GSS172 69656 58696022
GSS173 67712 62704471
GSS174 61920 53368409
GSS175 95643 42963254
GSS176 21165 4933990
GSS177 112938 70877522
GSS178 822 559311
GSS179 23226 28867035
GSS18 192347 114304499
GSS180 109092 70683886
GSS181 84555 34682016
GSS182 35744 22177639
GSS183 103304 62490220
GSS184 102329 63761256
GSS185 104268 67656826
GSS186 82099 41276456
GSS187 83102 54651503
GSS188 95684 61343347
GSS189 107373 78577773
GSS19 114273 52228513
GSS190 106314 76646515
GSS191 106101 79982459
GSS192 104015 80025091
GSS193 76402 51055333
GSS194 104482 63232426
GSS195 109868 66415305
GSS196 106047 59222776
GSS197 68381 37443617
GSS198 69506 38725653
GSS199 37368 17878843
GSS2 182295 92190391
GSS20 181787 101769657
GSS200 85481 46023427
GSS201 96935 55799967
GSS202 95009 49632000
GSS203 95897 55649530
GSS204 42678 23961360
GSS205 114055 43442995
GSS206 116422 39251295
GSS207 108882 55041759
GSS208 101472 78371349
GSS209 72643 46689469
GSS21 166208 114174113
GSS210 95891 36542252
GSS211 95417 37268709
GSS212 96671 35161518
GSS213 94285 39167432
GSS214 37736 17626556
GSS215 103939 66277823
GSS216 94551 61190929
GSS217 95128 60357048
GSS218 94773 60868501
GSS219 75675 70017159
GSS22 169505 97608334
GSS220 80787 68603070
GSS221 32556 33612970
GSS222 83736 28233267
GSS223 84219 27346468
GSS224 84926 25909272
GSS225 14851 4422302
GSS226 16547 7508221
GSS227 92128 59308050
GSS228 84494 52388719
GSS229 94098 50827589
GSS23 187250 126684076
GSS230 88585 48343496
GSS231 11366 6197879
GSS232 90648 56882510
GSS233 89662 61882079
GSS234 88553 63641206
GSS235 89283 62505584
GSS236 9890 7129098
GSS237 87995 63795538
GSS238 90151 62444409
GSS239 94367 59805167
GSS24 194054 130219272
GSS240 74143 62678833
GSS241 84189 78959221
GSS242 83078 80516319
GSS243 71019 53174669
GSS244 117650 64297121
GSS245 108874 55446727
GSS246 107533 52125503
GSS247 96658 43251344
GSS248 109801 49060015
GSS249 98194 46325477
GSS25 177482 105208945
GSS250 73059 72225597
GSS251 77252 72611065
GSS252 92149 71193561
GSS253 92496 70717940
GSS254 91063 68371307
GSS255 53301 32810242
GSS256 94787 57200301
GSS257 93517 59081345
GSS258 93900 58510429
GSS259 94714 57307691
GSS26 185732 107675520
GSS260 83843 51265303
GSS261 104611 69763654
GSS262 105287 75066211
GSS263 110489 69022026
GSS264 108021 71886884
GSS265 110248 69303823
GSS266 65254 35509779
GSS27 170506 151234083
GSS28 190511 146386306
GSS29 151054 106332306
GSS3 174946 87829277
GSS30 192536 132230345
GSS31 13906 8947947
GSS32 195895 127234153
GSS33 216654 116238131
GSS34 218577 113597712
GSS35 219716 112030658
GSS36 213973 121865192
GSS37 198560 156440039
GSS38 194985 146794861
GSS39 197291 73457394
GSS4 167157 85100622
GSS40 185038 97613049
GSS41 189684 125898180
GSS42 170997 159194265
GSS43 8621 5616370
GSS44 183999 100320381
GSS45 172666 121431355
GSS46 183067 123301526
GSS47 188535 120735257
GSS48 75421 65817457
GSS49 171545 101809563
GSS5 53456 31623677
GSS50 167648 103033730
GSS51 167797 102601882
GSS52 181966 120030309
GSS53 183671 115951946
GSS54 180675 122324637
GSS55 186379 112372275
GSS56 188973 135398337
GSS57 177496 103715769
GSS58 193462 118790361
GSS59 179834 130482915
GSS6 161617 84471320
GSS60 11860 10779651
GSS61 172841 138946229
GSS62 161635 111553131
GSS63 161673 111573561
GSS64 158830 107594298
GSS65 156726 129035698
GSS66 170186 142548648
GSS67 178808 116414085
GSS68 202003 126663756
GSS69 193525 110351742
GSS7 165321 79360873
GSS70 243841 125953050
GSS71 161398 107375254
GSS72 158017 118089918
GSS73 162108 124120427
GSS74 162074 124178449
GSS75 174033 108804801
GSS76 191241 140117430
GSS77 18382 11726115
GSS78 196572 124895921
GSS79 169659 110747724
GSS8 165782 88979534
GSS80 198937 130327630
GSS81 209570 89241268
GSS82 190513 95607097
GSS83 133194 93196958
GSS84 146028 117260125
GSS85 139698 116905241
GSS86 142745 113865568
GSS87 144086 119923469
GSS88 141642 115507937
GSS89 110756 92378197
GSS9 137999 67157719
GSS90 149425 122240891
GSS91 147663 117692857
GSS92 143995 113064403
GSS93 142869 115422868
GSS94 144203 119656289
GSS95 148069 121684067
GSS96 147696 117745472
GSS97 146077 121054040
GSS98 146145 120923099
GSS99 146569 120073651
HTC1 25057 27045808
HTC10 55931 70660984
HTC11 80030 70789209
HTC12 7857 9385264
HTC13 66993 60073171
HTC14 68549 69496172
HTC15 24817 16901385
HTC2 16086 36243320
HTC3 16029 36627693
HTC4 16251 35560357
HTC5 15980 40344457
HTC6 16068 37474845
HTC7 53834 31477922
HTC8 31137 19451907
HTC9 60957 77955151
HTG1 1318 188778000
HTG10 1297 186285876
HTG100 990 189420681
HTG101 996 189336500
HTG102 985 189405998
HTG103 1161 190556178
HTG104 29 4156502
HTG105 1087 189854687
HTG106 1046 189729798
HTG107 1386 191260179
HTG108 1295 190933319
HTG109 1640 191162004
HTG11 9 1245953
HTG110 1335 192052037
HTG111 931 135593148
HTG112 1437 190950899
HTG113 1519 189540628
HTG114 1405 177099108
HTG115 1212 154134340
HTG116 1333 174549428
HTG117 1272 189503757
HTG118 1062 185383424
HTG119 590 95141577
HTG12 1452 184004673
HTG120 1509 182779454
HTG121 1010 191768926
HTG122 1027 187650118
HTG123 1065 193666200
HTG124 1103 193211366
HTG125 128 24518186
HTG126 1029 189543270
HTG127 1054 192676832
HTG128 1163 191937540
HTG129 1080 192382243
HTG13 875 191786413
HTG130 1084 193101052
HTG131 592 104413873
HTG132 1122 192576031
HTG133 1080 192404979
HTG134 1078 192326016
HTG135 1166 191911933
HTG136 1510 191865092
HTG137 1070 192304332
HTG138 1069 192357596
HTG139 1131 191728372
HTG14 753 191921309
HTG140 1402 187480357
HTG141 376 53448499
HTG15 745 191963148
HTG16 785 191933231
HTG17 796 191351096
HTG18 775 192103394
HTG19 2069 170638342
HTG2 2464 186026155
HTG20 1096 187413748
HTG21 887 180042173
HTG22 785 191651644
HTG23 928 190141652
HTG24 907 190491600
HTG25 811 191323929
HTG26 784 191771279
HTG27 874 191079273
HTG28 896 190515178
HTG29 939 189959636
HTG3 2513 185231866
HTG30 911 190941779
HTG31 841 171449145
HTG32 875 191097680
HTG33 968 189501635
HTG34 884 191025385
HTG35 868 191276405
HTG36 825 191702609
HTG37 949 189868158
HTG38 949 190351720
HTG39 940 190045229
HTG4 2556 188418164
HTG40 1049 189067591
HTG41 1089 167537350
HTG42 1256 188119418
HTG43 1169 188010117
HTG44 1150 188080035
HTG45 1117 191232412
HTG46 1269 190634433
HTG47 1176 190820695
HTG48 1128 191324694
HTG49 1046 191269623
HTG5 1283 185544093
HTG50 1030 189585714
HTG51 1041 178589404
HTG52 968 190052338
HTG53 1105 190148899
HTG54 1046 190158403
HTG55 1014 189831932
HTG56 969 189170679
HTG57 81 14306584
HTG58 1010 189338312
HTG59 1029 189903667
HTG6 1273 185016781
HTG60 1078 187304761
HTG61 1125 188308213
HTG62 987 170842440
HTG63 1085 189487801
HTG64 1064 189415560
HTG65 1169 188798107
HTG66 1179 187545797
HTG67 1282 184397923
HTG68 94 12194080
HTG69 1221 185314622
HTG7 1275 185326125
HTG70 1239 184674446
HTG71 1244 184625496
HTG72 1183 187688486
HTG73 1018 169945682
HTG74 1118 188293510
HTG75 1103 190775743
HTG76 1135 190789237
HTG77 1182 190871034
HTG78 1096 185997580
HTG79 1171 190202119
HTG8 1459 184462575
HTG80 1115 190063261
HTG81 1213 189874691
HTG82 1120 189645029
HTG83 959 164682536
HTG84 1229 188409093
HTG85 1250 187741728
HTG86 1141 189879061
HTG87 1144 189686641
HTG88 978 167870813
HTG89 1182 189961005
HTG9 1200 186951993
HTG90 1104 190233697
HTG91 1146 190217975
HTG92 1109 190471215
HTG93 961 159222190
HTG94 1056 190781637
HTG95 1160 191011164
HTG96 1031 189156227
HTG97 1071 189497493
HTG98 684 127508859
HTG99 1018 189681069
INV1 93718 48145914
INV10 53270 89031889
INV11 82560 65315976
INV12 64481 51032995
INV13 84598 65948939
INV14 80793 66802942
INV15 78751 66651259
INV16 48023 45752870
INV17 29245 114161578
INV18 7763 143238387
INV19 43007 111504386
INV2 29677 141621787
INV20 77290 56405909
INV21 73093 62487278
INV22 2571 1677637
INV23 21327 126140978
INV24 6 133712559
INV25 53784 99244075
INV26 77903 53373542
INV27 34591 25433501
INV28 79284 57062884
INV29 77023 59408664
INV3 1742 180280066
INV30 75316 57955331
INV31 73549 48855513
INV32 74507 66735317
INV33 9300 48040817
INV4 3854 133939858
INV5 78653 73290109
INV6 55911 95037108
INV7 47535 92725482
INV8 13002 12571168
INV9 80295 71523221
MAM1 16670 160724211
MAM2 18786 159012805
MAM3 60011 81051627
MAM4 6608 186142828
MAM5 79411 74760230
MAM6 48998 125601178
MAM7 73623 63645843
MAM8 26643 24821872
PAT1 222550 70114048
PAT10 124404 102499219
PAT100 178185 3385515
PAT101 132610 2848492
PAT102 342935 8573375
PAT103 188806 88519660
PAT104 111348 132068608
PAT105 3850 194703659
PAT106 131292 110979300
PAT107 158599 54826034
PAT108 224685 34110629
PAT109 250080 15844309
PAT11 98821 64201126
PAT110 180713 63634396
PAT111 51660 26091791
PAT112 114176 110461877
PAT113 137686 83271160
PAT114 164185 99289604
PAT115 158793 103369255
PAT116 137503 115011287
PAT117 42311 27994848
PAT118 193712 81686401
PAT119 150217 108404022
PAT12 142051 62828492
PAT120 356051 11379688
PAT121 257211 57607099
PAT122 138161 48226925
PAT123 322021 22795469
PAT124 155639 102753887
PAT125 132727 110696284
PAT126 128341 121313309
PAT127 21664 184390005
PAT128 144888 112900567
PAT129 171997 96403773
PAT13 105886 59872737
PAT130 44618 171217879
PAT131 9167 47581637
PAT132 33645 178334734
PAT133 153558 109675196
PAT134 178705 90913377
PAT135 136049 115324159
PAT136 120392 123342367
PAT137 8527 8992390
PAT138 155429 101473147
PAT139 184764 88815933
PAT14 103628 50159075
PAT140 182409 85292093
PAT141 174403 93928365
PAT142 125174 122942590
PAT143 182298 88614700
PAT144 41364 15069879
PAT145 203548 47703399
PAT146 277769 9657474
PAT147 220402 46464960
PAT148 106899 2885642
PAT149 270386 21672571
PAT15 121136 53308570
PAT150 186721 61210289
PAT151 109756 106071273
PAT152 47591 9565494
PAT153 87295 88236566
PAT154 78442 95560935
PAT155 145092 77731778
PAT156 167543 71348439
PAT157 121442 92957208
PAT158 103017 85291066
PAT159 165641 46132006
PAT16 113125 61261780
PAT160 270022 5130418
PAT161 269978 5129582
PAT162 269978 5129582
PAT163 237888 4519872
PAT164 269396 5118524
PAT165 235463 25562633
PAT166 203694 47164947
PAT167 12090 424512
PAT168 165317 74871979
PAT169 91686 126656173
PAT17 39213 16260533
PAT170 172579 71662612
PAT171 137840 72222574
PAT172 9563 14020838
PAT173 93072 87231074
PAT174 91701 79809653
PAT175 83202 91468951
PAT176 109162 53700097
PAT177 119713 63794176
PAT178 156326 19195674
PAT179 69259 107707799
PAT18 146771 52594264
PAT180 34473 152515713
PAT181 132075 59055243
PAT182 43465 10474806
PAT183 86793 129976593
PAT184 158990 78755511
PAT185 212079 48101150
PAT186 132354 49630983
PAT19 153705 78039102
PAT2 194513 84657431
PAT20 104712 118084998
PAT21 133773 95343235
PAT22 84658 79569499
PAT23 123501 103385014
PAT24 119476 105510133
PAT25 145201 86779298
PAT26 175033 64346032
PAT27 71789 1794725
PAT28 102171 77387698
PAT29 93927 87636086
PAT3 171982 95896546
PAT30 119950 61672162
PAT31 96630 78963333
PAT32 128375 55027972
PAT33 92257 51135583
PAT34 111294 78149757
PAT35 138095 29120857
PAT36 158488 24072511
PAT37 114656 49027815
PAT38 44915 54581173
PAT39 95722 83166454
PAT4 153750 106056419
PAT40 100233 70850169
PAT41 136071 39459525
PAT42 143783 35448185
PAT43 123826 64575883
PAT44 104398 81176714
PAT45 93299 74375876
PAT46 113234 66602624
PAT47 65388 54850684
PAT48 135192 108000182
PAT49 167081 97031566
PAT5 57142 23925643
PAT50 116396 127556602
PAT51 196341 76723288
PAT52 80306 127991232
PAT53 27631 180872621
PAT54 185408 93066629
PAT55 274259 6856475
PAT56 129447 31627433
PAT57 161320 77719729
PAT58 92800 89389068
PAT59 106501 74791321
PAT6 170642 91909261
PAT60 122362 64031281
PAT61 67452 30303025
PAT62 70750 109767817
PAT63 87947 82758966
PAT64 92971 78937516
PAT65 93166 72441718
PAT66 93384 75085880
PAT67 115774 60531158
PAT68 102737 9941808
PAT69 175930 10547617
PAT7 154751 88221096
PAT70 171510 10872561
PAT71 171496 10866737
PAT72 99862 86225235
PAT73 99 196466297
PAT74 67 192869889
PAT75 103 195600591
PAT76 1137 196318757
PAT77 97599 5772236
PAT78 151009 9636510
PAT79 151022 9621259
PAT8 131230 96894200
PAT80 151024 9622125
PAT81 151021 9620837
PAT82 94632 88056898
PAT83 93651 93460909
PAT84 34111 33988458
PAT85 83459 93185861
PAT86 15568 180450145
PAT87 164892 19209768
PAT88 178944 3399936
PAT89 177434 3371246
PAT9 129237 101146974
PAT90 175305 3330795
PAT91 101399 1926581
PAT92 169171 12412246
PAT93 178699 3395281
PAT94 178691 3395129
PAT95 178677 3394863
PAT96 140780 2674820
PAT97 178683 3394977
PAT98 178342 3388498
PAT99 178198 3385762
PHG1 6940 95278575
PLN1 59873 93478281
PLN10 73050 75858774
PLN11 37378 49291893
PLN12 40286 65708893
PLN13 22492 123983004
PLN14 21103 99490667
PLN15 17566 144768265
PLN16 17622 146203357
PLN17 17550 146317118
PLN18 24673 128747914
PLN19 5999 149130224
PLN2 49321 104454287
PLN20 1268 170558125
PLN21 13938 156108362
PLN22 7326 8521642
PLN23 67245 69725654
PLN24 29383 31608736
PLN25 76927 76342811
PLN26 64743 80332399
PLN27 61759 100536265
PLN28 76 95744252
PLN29 3 61743175
PLN3 1377 173836187
PLN30 55 125319454
PLN31 13939 137855186
PLN32 15875 135262972
PLN33 76907 74965940
PLN34 82781 71610080
PLN35 62185 33035447
PLN36 80347 71633333
PLN37 77824 75854475
PLN38 80079 70421547
PLN39 82077 75426944
PLN4 1771 184803989
PLN40 58236 32055650
PLN41 98690 55020430
PLN42 82353 68519350
PLN43 45347 98969668
PLN44 16453 128355635
PLN45 31535 128564337
PLN46 65219 73100228
PLN47 81337 72312744
PLN48 63926 81692374
PLN49 27712 111419580
PLN5 1887 193564109
PLN50 81624 66207205
PLN51 95123 58335162
PLN52 11254 8303706
PLN53 76961 72308447
PLN54 70746 83829696
PLN55 76541 68538391
PLN56 73020 73721273
PLN57 79082 63626014
PLN58 77498 67927799
PLN59 67063 77666134
PLN6 1647 194490881
PLN60 13242 28856431
PLN7 1863 193791506
PLN8 54253 97664862
PLN9 44366 43518541
PRI1 23019 59656550
PRI10 1272 179307568
PRI11 786 95666505
PRI12 1278 179183454
PRI13 1451 177770436
PRI14 1589 180081042
PRI15 1591 181937113
PRI16 1285 191720215
PRI17 1137 193666240
PRI18 1099 194310776
PRI19 1166 193657185
PRI2 18890 148464301
PRI20 1737 191818169
PRI21 2646 189814959
PRI22 9556 177691776
PRI23 11451 26579980
PRI24 31572 84615224
PRI25 61951 78208013
PRI26 31350 70628098
PRI27 8521 161801360
PRI28 2251 180645625
PRI29 1618 181509288
PRI3 1433 175090795
PRI30 2006 181686643
PRI31 1950 180790690
PRI32 13184 156506323
PRI33 1323 183609171
PRI34 41227 106650597
PRI35 23491 34165793
PRI36 32189 63608729
PRI37 20175 117764826
PRI38 18539 147354358
PRI39 66720 86908454
PRI4 1282 185567482
PRI40 49609 89353706
PRI41 40678 75169420
PRI42 45450 95559622
PRI43 18272 107694478
PRI44 65950 84504178
PRI45 18924 46414227
PRI5 1326 184379798
PRI6 1180 179825196
PRI7 1241 180884761
PRI8 1217 178560631
PRI9 1366 174679454
ROD1 33240 139306327
ROD10 989 181396986
ROD11 242 45989832
ROD12 1034 185475616
ROD13 940 182703335
ROD14 1040 189324025
ROD15 950 180306408
ROD16 967 182057152
ROD17 991 185811349
ROD18 1190 190645603
ROD19 16301 157837122
ROD2 916 175550421
ROD20 497 871886
ROD21 20351 148601681
ROD22 1134 182247715
ROD23 1075 167777386
ROD24 12240 164895245
ROD25 39630 69427569
ROD26 22367 102345594
ROD27 1533 187671189
ROD28 131992 39944307
ROD29 85452 70124497
ROD3 905 173319794
ROD30 65835 69173888
ROD4 901 173734752
ROD5 920 174315578
ROD6 966 178083568
ROD7 970 179738957
ROD8 979 181207870
ROD9 992 181787712
STS1 85257 36750501
STS10 57907 44420267
STS11 48910 37503235
STS12 57924 43637361
STS13 64283 42850336
STS14 93614 34186498
STS15 104286 26517058
STS16 10109 2739230
STS17 103611 27476228
STS18 86926 34447437
STS19 99725 33367017
STS2 84327 49855709
STS20 55000 21032797
STS3 66836 26359108
STS4 77030 36944377
STS5 8484 4973721
STS6 54259 31650966
STS7 54162 31838227
STS8 54316 31957697
STS9 55716 37767321
SYN1 42703 77370227
SYN2 49460 67924740
SYN3 11407 159335471
SYN4 4599 176566932
SYN5 4596 176480242
SYN6 4600 176570237
SYN7 6500 95919964
TSA1 119977 38112352
TSA10 19782 21876029
TSA100 72178 75577942
TSA101 57296 120579109
TSA102 591 349598
TSA103 106689 67779914
TSA104 93410 83369889
TSA105 98615 76609458
TSA106 88033 68056906
TSA107 85150 59495350
TSA108 81105 64406935
TSA109 76976 83725303
TSA11 104981 27321556
TSA110 106061 45726037
TSA111 94550 41551446
TSA112 70647 62329159
TSA113 23218 20772752
TSA114 64087 65481741
TSA115 62776 67314514
TSA116 62796 68082050
TSA117 83597 81259826
TSA118 77368 53642425
TSA119 52890 45157231
TSA12 63093 36049176
TSA120 78372 34800123
TSA121 74786 67822110
TSA122 81274 78630897
TSA123 74923 64502889
TSA124 78937 67364640
TSA125 41761 47213055
TSA126 78521 63109283
TSA127 84011 65716958
TSA128 84070 79175139
TSA129 85532 73548993
TSA13 78048 76369363
TSA130 80320 72726982
TSA131 77019 75417771
TSA132 81568 75956174
TSA133 23359 20050544
TSA14 108605 44529741
TSA15 105586 43529816
TSA16 38984 14574401
TSA17 85797 70106183
TSA18 120080 38852195
TSA19 135073 34045322
TSA2 113082 41399259
TSA20 61631 79372321
TSA21 41270 56085777
TSA22 70040 97061853
TSA23 99922 57201815
TSA24 109221 51855791
TSA25 103373 51392529
TSA26 101586 54001875
TSA27 101918 46130806
TSA28 14218 8879136
TSA29 66220 59270523
TSA3 109975 40913799
TSA30 92600 67995596
TSA31 93434 62332649
TSA32 79627 86202861
TSA33 100020 49370914
TSA34 113634 34138908
TSA35 94924 68289740
TSA36 12356 7399776
TSA37 94663 35557227
TSA38 78512 36262266
TSA39 109343 44672540
TSA4 110057 45514782
TSA40 116425 47112559
TSA41 22785 17058205
TSA42 105982 50234310
TSA43 100439 54422418
TSA44 94611 63066525
TSA45 83202 83698826
TSA46 63546 25630303
TSA47 90399 71322568
TSA48 97653 54564870
TSA49 62926 108046655
TSA5 45431 11645463
TSA50 85427 75863691
TSA51 86082 63090138
TSA52 86285 67563026
TSA53 77781 78842272
TSA54 47775 69856234
TSA55 90605 66610069
TSA56 75924 84434075
TSA57 75363 75755380
TSA58 70635 62157721
TSA59 86644 78135154
TSA6 111608 58989548
TSA60 83656 81544536
TSA61 64829 90463011
TSA62 87304 70844407
TSA63 85576 52138686
TSA64 98993 67650148
TSA65 97121 52568706
TSA66 74214 65948454
TSA67 106487 72206611
TSA68 15015 10240933
TSA69 89929 79960169
TSA7 87587 57991023
TSA70 90772 69540680
TSA71 78682 53867695
TSA72 79613 56793337
TSA73 102294 58606746
TSA74 11805 6588966
TSA75 89232 76965155
TSA76 98763 47382575
TSA77 89278 72221329
TSA78 72252 90754633
TSA79 94827 52203285
TSA8 103411 71945868
TSA80 94027 43229495
TSA81 87149 70626751
TSA82 62102 73081261
TSA83 19212 20432979
TSA84 62986 100755212
TSA85 84409 37986862
TSA86 85033 36985025
TSA87 78055 50125667
TSA88 57724 88322343
TSA89 72044 73414031
TSA9 108865 60366586
TSA90 58822 33347493
TSA91 74245 86358066
TSA92 80250 75631818
TSA93 85017 72291336
TSA94 115335 54770592
TSA95 95163 76859411
TSA96 49221 83305830
TSA97 109175 49378845
TSA98 67049 70014304
TSA99 80457 88837063
UNA1 244 127803
VRL1 66989 70243191
VRL10 67856 67754634
VRL11 55231 73495098
VRL12 1432 1735205
VRL13 62895 71025715
VRL14 57318 72830784
VRL15 63355 65017756
VRL16 56533 73506705
VRL17 39749 47172371
VRL18 54863 72351021
VRL19 59131 71026220
VRL2 73324 64087408
VRL20 56221 73246811
VRL21 55413 73864807
VRL22 49904 80066908
VRL23 63157 73771752
VRL24 163 89187
VRL3 70183 60246602
VRL4 69353 69426595
VRL5 54394 57534183
VRL6 48156 77513676
VRL7 47178 72750261
VRL8 58092 70382018
VRL9 61387 73006947
VRT1 49632 109830340
VRT10 1257 189553753
VRT11 8277 177965449
VRT12 3986 135696475
VRT13 13134 170836866
VRT14 5313 182920481
VRT15 3937 186234310
VRT16 37759 134309409
VRT17 79795 68437027
VRT18 78201 66361163
VRT19 30968 24984133
VRT2 1197 194109860
VRT20 71397 77054881
VRT21 46031 122552142
VRT22 77702 62980955
VRT23 78460 62383972
VRT24 80299 57664960
VRT25 103349 65794016
VRT26 83098 55963322
VRT27 85681 57809896
VRT28 29424 27022452
VRT3 69470 85105620
VRT4 8392 174745721
VRT5 34692 40042590
VRT6 73005 66730286
VRT7 31770 63580442
VRT8 30623 112228834
VRT9 1204 190264823
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 193.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:
Entries Bases Species
20129572 16610305845 Homo sapiens
9699548 9977331236 Mus musculus
2188840 6521977687 Rattus norvegicus
2201565 5386779184 Bos taurus
3936029 5064773250 Zea mays
3287265 4888877999 Sus scrofa
1725818 3119828062 Danio rerio
1029328 1462968508 Hordeum vulgare subsp. vulgare
257584 1435236537 Strongylocentrotus purpuratus
453263 1256312885 Macaca mulatta
1348622 1255768599 Oryza sativa Japonica Group
1588284 1249961144 Xenopus (Silurana) tropicalis
1774495 1197531832 Nicotiana tabacum
2332033 1149006229 Arabidopsis thaliana
1779868 1134947066 Triticum aestivum
1255088 1121503858 Drosophila melanogaster
216849 1008556785 Pan troglodytes
766882 999056719 Vitis vinifera
1455917 951319633 Canis lupus familiaris
740300 918710860 Solanum lycopersicum
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
187 Dec 2011 135117731375 146413798
188 Feb 2012 137384889783 149819246
189 Apr 2012 139266481398 151824421
190 Jun 2012 141343240755 154130210
191 Aug 2012 143081765233 156424033
192 Oct 2012 145430961262 157889737
193 Dec 2012 148390863904 161140325
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
187 Dec 2011 239868309609 73729553
188 Feb 2012 261370512675 78656704
189 Apr 2012 272693351548 80905298
190 Jun 2012 287577367116 82076779
191 Aug 2012 308196411905 84020064
192 Oct 2012 333881846451 86480509
193 Dec 2012 356002922838 92767765
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
December 15 2012
NCBI-GenBank Flat File Release 193.0
Bacterial Sequences (Part 1)
51396 loci, 92682287 bases, from 51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
or 2010.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
June 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA).
Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS ANHA01000001 503 bp DNA linear BCT 23-NOV-2012
DEFINITION Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION ANHA01000001 ANHA01000000
VERSION ANHA01000001.1 GI:424935948
DBLINK BioProject: PRJNA177352
BioSample: SAMN01795900
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK BioProject:PRJNA174162,PRJNA999998,PRJNA999999
And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.
DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject database at the NCBI:
http://www.ncbi.nlm.nih.gov/bioproject
At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of Entrez's BioProject database:
http://www.ncbi.nlm.nih.gov/books/NBK54016/
As of December 2012, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", and "Trace Assembly Archive" .
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 193.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Jianli Dai, Michel Eschenbrenner, Irene Fang,
Michael Fetchko, Linda Frisse, Andrea Gocke, Brian Henson, Anjanette Johnston,
Mark Landree, Jason Lowry, Suzanne Mate, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Beverly Underwood,
Melissa Wright, and Linda Yankie
Data Management and Preparation
Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
Ilya Dondoshansky, J. Bradley Holmes, WonHee Jang, Jonathan Kans,
Leonid Khotomliansky, Michael Kimelman, Michael Kornbluh, Jim Ostell,
Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov
Database Administration
Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
Ben Slade, Constantin Vasilyev
User Support
Peter Cooper, Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris,
Steve Pechous, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
