Release Notes For GenBank Release 239
GBREL.TXT Genetic Sequence Data Bank
August 15 2020
NCBI-GenBank Flat File Release 239.0
Distribution Release Notes
218642238 sequences, 654057069549 bases, for traditional GenBank records
1901329611 sequences, 9236443421310 bases, for set-based (WGS/TSA/TLS) records
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 239.0
1.2 Cutoff Date
1.3 Important Changes in Release 239.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 239.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for GenBank's web-based submission tool (BankIt) :
http://www.ncbi.nlm.nih.gov/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 239.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:
ftp://ftp.ncbi.nih.gov/genbank/wgs
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/tsa
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tls
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
See the README files in those areas for more information.
Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:
ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.
1.2 Cutoff Date
This full release, 239.0, incorporates data processed by the INSDC databases
as of Saturday August 15 2020 at approximately 12:54PM EDT. For more recent data,
users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotide' database (see Section 6.4 of this document).
1.3 Important Changes in Release 239.0
1.3.1 Organizational changes
The total number of sequence data files increased by 425 with this release:
- the BCT division is now composed of 490 files (+37)
- the ENV division is now composed of 62 files (+2)
- the INV division is now composed of 95 files (+9)
- the MAM division is now composed of 76 files (+5)
- the PAT division is now composed of 212 files (+7)
- the PLN division is now composed of 547 files (+321)
- the PRI division is now composed of 35 files (+1)
- the ROD division is now composed of 41 files (+7)
- the VRL division is now composed of 39 files (+1)
- the VRT division is now composed of 182 files (+35)
Note: The unusually large increase in the number of PLN-division files
is due to an influx of multiple sets of near-gigabase-scale chromosomal
records for wheat (Triticum aestivum) and barley (Hordeum vulgare subsp. vulgare).
1.4 Upcoming Changes
No changes to the GenBank flatfile format are expected in the next
four months.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the ENA and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the ENA and DDBJ databases.
BankIt may be used with any modern web browser. You can access BankIt
from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] .
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.
2.2 Files
This GenBank flat file release consists of 3131 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct395.seq - Bacterial sequence entries, part 395.
330. gbbct396.seq - Bacterial sequence entries, part 396.
331. gbbct397.seq - Bacterial sequence entries, part 397.
332. gbbct398.seq - Bacterial sequence entries, part 398.
333. gbbct399.seq - Bacterial sequence entries, part 399.
334. gbbct4.seq - Bacterial sequence entries, part 4.
335. gbbct40.seq - Bacterial sequence entries, part 40.
336. gbbct400.seq - Bacterial sequence entries, part 400.
337. gbbct401.seq - Bacterial sequence entries, part 401.
338. gbbct402.seq - Bacterial sequence entries, part 402.
339. gbbct403.seq - Bacterial sequence entries, part 403.
340. gbbct404.seq - Bacterial sequence entries, part 404.
341. gbbct405.seq - Bacterial sequence entries, part 405.
342. gbbct406.seq - Bacterial sequence entries, part 406.
343. gbbct407.seq - Bacterial sequence entries, part 407.
344. gbbct408.seq - Bacterial sequence entries, part 408.
345. gbbct409.seq - Bacterial sequence entries, part 409.
346. gbbct41.seq - Bacterial sequence entries, part 41.
347. gbbct410.seq - Bacterial sequence entries, part 410.
348. gbbct411.seq - Bacterial sequence entries, part 411.
349. gbbct412.seq - Bacterial sequence entries, part 412.
350. gbbct413.seq - Bacterial sequence entries, part 413.
351. gbbct414.seq - Bacterial sequence entries, part 414.
352. gbbct415.seq - Bacterial sequence entries, part 415.
353. gbbct416.seq - Bacterial sequence entries, part 416.
354. gbbct417.seq - Bacterial sequence entries, part 417.
355. gbbct418.seq - Bacterial sequence entries, part 418.
356. gbbct419.seq - Bacterial sequence entries, part 419.
357. gbbct42.seq - Bacterial sequence entries, part 42.
358. gbbct420.seq - Bacterial sequence entries, part 420.
359. gbbct421.seq - Bacterial sequence entries, part 421.
360. gbbct422.seq - Bacterial sequence entries, part 422.
361. gbbct423.seq - Bacterial sequence entries, part 423.
362. gbbct424.seq - Bacterial sequence entries, part 424.
363. gbbct425.seq - Bacterial sequence entries, part 425.
364. gbbct426.seq - Bacterial sequence entries, part 426.
365. gbbct427.seq - Bacterial sequence entries, part 427.
366. gbbct428.seq - Bacterial sequence entries, part 428.
367. gbbct429.seq - Bacterial sequence entries, part 429.
368. gbbct43.seq - Bacterial sequence entries, part 43.
369. gbbct430.seq - Bacterial sequence entries, part 430.
370. gbbct431.seq - Bacterial sequence entries, part 431.
371. gbbct432.seq - Bacterial sequence entries, part 432.
372. gbbct433.seq - Bacterial sequence entries, part 433.
373. gbbct434.seq - Bacterial sequence entries, part 434.
374. gbbct435.seq - Bacterial sequence entries, part 435.
375. gbbct436.seq - Bacterial sequence entries, part 436.
376. gbbct437.seq - Bacterial sequence entries, part 437.
377. gbbct438.seq - Bacterial sequence entries, part 438.
378. gbbct439.seq - Bacterial sequence entries, part 439.
379. gbbct44.seq - Bacterial sequence entries, part 44.
380. gbbct440.seq - Bacterial sequence entries, part 440.
381. gbbct441.seq - Bacterial sequence entries, part 441.
382. gbbct442.seq - Bacterial sequence entries, part 442.
383. gbbct443.seq - Bacterial sequence entries, part 443.
384. gbbct444.seq - Bacterial sequence entries, part 444.
385. gbbct445.seq - Bacterial sequence entries, part 445.
386. gbbct446.seq - Bacterial sequence entries, part 446.
387. gbbct447.seq - Bacterial sequence entries, part 447.
388. gbbct448.seq - Bacterial sequence entries, part 448.
389. gbbct449.seq - Bacterial sequence entries, part 449.
390. gbbct45.seq - Bacterial sequence entries, part 45.
391. gbbct450.seq - Bacterial sequence entries, part 450.
392. gbbct451.seq - Bacterial sequence entries, part 451.
393. gbbct452.seq - Bacterial sequence entries, part 452.
394. gbbct453.seq - Bacterial sequence entries, part 453.
395. gbbct454.seq - Bacterial sequence entries, part 454.
396. gbbct455.seq - Bacterial sequence entries, part 455.
397. gbbct456.seq - Bacterial sequence entries, part 456.
398. gbbct457.seq - Bacterial sequence entries, part 457.
399. gbbct458.seq - Bacterial sequence entries, part 458.
400. gbbct459.seq - Bacterial sequence entries, part 459.
401. gbbct46.seq - Bacterial sequence entries, part 46.
402. gbbct460.seq - Bacterial sequence entries, part 460.
403. gbbct461.seq - Bacterial sequence entries, part 461.
404. gbbct462.seq - Bacterial sequence entries, part 462.
405. gbbct463.seq - Bacterial sequence entries, part 463.
406. gbbct464.seq - Bacterial sequence entries, part 464.
407. gbbct465.seq - Bacterial sequence entries, part 465.
408. gbbct466.seq - Bacterial sequence entries, part 466.
409. gbbct467.seq - Bacterial sequence entries, part 467.
410. gbbct468.seq - Bacterial sequence entries, part 468.
411. gbbct469.seq - Bacterial sequence entries, part 469.
412. gbbct47.seq - Bacterial sequence entries, part 47.
413. gbbct470.seq - Bacterial sequence entries, part 470.
414. gbbct471.seq - Bacterial sequence entries, part 471.
415. gbbct472.seq - Bacterial sequence entries, part 472.
416. gbbct473.seq - Bacterial sequence entries, part 473.
417. gbbct474.seq - Bacterial sequence entries, part 474.
418. gbbct475.seq - Bacterial sequence entries, part 475.
419. gbbct476.seq - Bacterial sequence entries, part 476.
420. gbbct477.seq - Bacterial sequence entries, part 477.
421. gbbct478.seq - Bacterial sequence entries, part 478.
422. gbbct479.seq - Bacterial sequence entries, part 479.
423. gbbct48.seq - Bacterial sequence entries, part 48.
424. gbbct480.seq - Bacterial sequence entries, part 480.
425. gbbct481.seq - Bacterial sequence entries, part 481.
426. gbbct482.seq - Bacterial sequence entries, part 482.
427. gbbct483.seq - Bacterial sequence entries, part 483.
428. gbbct484.seq - Bacterial sequence entries, part 484.
429. gbbct485.seq - Bacterial sequence entries, part 485.
430. gbbct486.seq - Bacterial sequence entries, part 486.
431. gbbct487.seq - Bacterial sequence entries, part 487.
432. gbbct488.seq - Bacterial sequence entries, part 488.
433. gbbct489.seq - Bacterial sequence entries, part 489.
434. gbbct49.seq - Bacterial sequence entries, part 49.
435. gbbct490.seq - Bacterial sequence entries, part 490.
436. gbbct5.seq - Bacterial sequence entries, part 5.
437. gbbct50.seq - Bacterial sequence entries, part 50.
438. gbbct51.seq - Bacterial sequence entries, part 51.
439. gbbct52.seq - Bacterial sequence entries, part 52.
440. gbbct53.seq - Bacterial sequence entries, part 53.
441. gbbct54.seq - Bacterial sequence entries, part 54.
442. gbbct55.seq - Bacterial sequence entries, part 55.
443. gbbct56.seq - Bacterial sequence entries, part 56.
444. gbbct57.seq - Bacterial sequence entries, part 57.
445. gbbct58.seq - Bacterial sequence entries, part 58.
446. gbbct59.seq - Bacterial sequence entries, part 59.
447. gbbct6.seq - Bacterial sequence entries, part 6.
448. gbbct60.seq - Bacterial sequence entries, part 60.
449. gbbct61.seq - Bacterial sequence entries, part 61.
450. gbbct62.seq - Bacterial sequence entries, part 62.
451. gbbct63.seq - Bacterial sequence entries, part 63.
452. gbbct64.seq - Bacterial sequence entries, part 64.
453. gbbct65.seq - Bacterial sequence entries, part 65.
454. gbbct66.seq - Bacterial sequence entries, part 66.
455. gbbct67.seq - Bacterial sequence entries, part 67.
456. gbbct68.seq - Bacterial sequence entries, part 68.
457. gbbct69.seq - Bacterial sequence entries, part 69.
458. gbbct7.seq - Bacterial sequence entries, part 7.
459. gbbct70.seq - Bacterial sequence entries, part 70.
460. gbbct71.seq - Bacterial sequence entries, part 71.
461. gbbct72.seq - Bacterial sequence entries, part 72.
462. gbbct73.seq - Bacterial sequence entries, part 73.
463. gbbct74.seq - Bacterial sequence entries, part 74.
464. gbbct75.seq - Bacterial sequence entries, part 75.
465. gbbct76.seq - Bacterial sequence entries, part 76.
466. gbbct77.seq - Bacterial sequence entries, part 77.
467. gbbct78.seq - Bacterial sequence entries, part 78.
468. gbbct79.seq - Bacterial sequence entries, part 79.
469. gbbct8.seq - Bacterial sequence entries, part 8.
470. gbbct80.seq - Bacterial sequence entries, part 80.
471. gbbct81.seq - Bacterial sequence entries, part 81.
472. gbbct82.seq - Bacterial sequence entries, part 82.
473. gbbct83.seq - Bacterial sequence entries, part 83.
474. gbbct84.seq - Bacterial sequence entries, part 84.
475. gbbct85.seq - Bacterial sequence entries, part 85.
476. gbbct86.seq - Bacterial sequence entries, part 86.
477. gbbct87.seq - Bacterial sequence entries, part 87.
478. gbbct88.seq - Bacterial sequence entries, part 88.
479. gbbct89.seq - Bacterial sequence entries, part 89.
480. gbbct9.seq - Bacterial sequence entries, part 9.
481. gbbct90.seq - Bacterial sequence entries, part 90.
482. gbbct91.seq - Bacterial sequence entries, part 91.
483. gbbct92.seq - Bacterial sequence entries, part 92.
484. gbbct93.seq - Bacterial sequence entries, part 93.
485. gbbct94.seq - Bacterial sequence entries, part 94.
486. gbbct95.seq - Bacterial sequence entries, part 95.
487. gbbct96.seq - Bacterial sequence entries, part 96.
488. gbbct97.seq - Bacterial sequence entries, part 97.
489. gbbct98.seq - Bacterial sequence entries, part 98.
490. gbbct99.seq - Bacterial sequence entries, part 99.
491. gbchg.txt - Accession numbers of entries updated since the previous release.
492. gbcon1.seq - Constructed sequence entries, part 1.
493. gbcon10.seq - Constructed sequence entries, part 10.
494. gbcon100.seq - Constructed sequence entries, part 100.
495. gbcon101.seq - Constructed sequence entries, part 101.
496. gbcon102.seq - Constructed sequence entries, part 102.
497. gbcon103.seq - Constructed sequence entries, part 103.
498. gbcon104.seq - Constructed sequence entries, part 104.
499. gbcon105.seq - Constructed sequence entries, part 105.
500. gbcon106.seq - Constructed sequence entries, part 106.
501. gbcon107.seq - Constructed sequence entries, part 107.
502. gbcon108.seq - Constructed sequence entries, part 108.
503. gbcon109.seq - Constructed sequence entries, part 109.
504. gbcon11.seq - Constructed sequence entries, part 11.
505. gbcon110.seq - Constructed sequence entries, part 110.
506. gbcon111.seq - Constructed sequence entries, part 111.
507. gbcon112.seq - Constructed sequence entries, part 112.
508. gbcon113.seq - Constructed sequence entries, part 113.
509. gbcon114.seq - Constructed sequence entries, part 114.
510. gbcon115.seq - Constructed sequence entries, part 115.
511. gbcon116.seq - Constructed sequence entries, part 116.
512. gbcon117.seq - Constructed sequence entries, part 117.
513. gbcon118.seq - Constructed sequence entries, part 118.
514. gbcon119.seq - Constructed sequence entries, part 119.
515. gbcon12.seq - Constructed sequence entries, part 12.
516. gbcon120.seq - Constructed sequence entries, part 120.
517. gbcon121.seq - Constructed sequence entries, part 121.
518. gbcon122.seq - Constructed sequence entries, part 122.
519. gbcon123.seq - Constructed sequence entries, part 123.
520. gbcon124.seq - Constructed sequence entries, part 124.
521. gbcon125.seq - Constructed sequence entries, part 125.
522. gbcon126.seq - Constructed sequence entries, part 126.
523. gbcon127.seq - Constructed sequence entries, part 127.
524. gbcon128.seq - Constructed sequence entries, part 128.
525. gbcon129.seq - Constructed sequence entries, part 129.
526. gbcon13.seq - Constructed sequence entries, part 13.
527. gbcon130.seq - Constructed sequence entries, part 130.
528. gbcon131.seq - Constructed sequence entries, part 131.
529. gbcon132.seq - Constructed sequence entries, part 132.
530. gbcon133.seq - Constructed sequence entries, part 133.
531. gbcon134.seq - Constructed sequence entries, part 134.
532. gbcon135.seq - Constructed sequence entries, part 135.
533. gbcon136.seq - Constructed sequence entries, part 136.
534. gbcon137.seq - Constructed sequence entries, part 137.
535. gbcon138.seq - Constructed sequence entries, part 138.
536. gbcon139.seq - Constructed sequence entries, part 139.
537. gbcon14.seq - Constructed sequence entries, part 14.
538. gbcon140.seq - Constructed sequence entries, part 140.
539. gbcon141.seq - Constructed sequence entries, part 141.
540. gbcon142.seq - Constructed sequence entries, part 142.
541. gbcon143.seq - Constructed sequence entries, part 143.
542. gbcon144.seq - Constructed sequence entries, part 144.
543. gbcon145.seq - Constructed sequence entries, part 145.
544. gbcon146.seq - Constructed sequence entries, part 146.
545. gbcon147.seq - Constructed sequence entries, part 147.
546. gbcon148.seq - Constructed sequence entries, part 148.
547. gbcon149.seq - Constructed sequence entries, part 149.
548. gbcon15.seq - Constructed sequence entries, part 15.
549. gbcon150.seq - Constructed sequence entries, part 150.
550. gbcon151.seq - Constructed sequence entries, part 151.
551. gbcon152.seq - Constructed sequence entries, part 152.
552. gbcon153.seq - Constructed sequence entries, part 153.
553. gbcon154.seq - Constructed sequence entries, part 154.
554. gbcon155.seq - Constructed sequence entries, part 155.
555. gbcon156.seq - Constructed sequence entries, part 156.
556. gbcon157.seq - Constructed sequence entries, part 157.
557. gbcon158.seq - Constructed sequence entries, part 158.
558. gbcon159.seq - Constructed sequence entries, part 159.
559. gbcon16.seq - Constructed sequence entries, part 16.
560. gbcon160.seq - Constructed sequence entries, part 160.
561. gbcon161.seq - Constructed sequence entries, part 161.
562. gbcon162.seq - Constructed sequence entries, part 162.
563. gbcon163.seq - Constructed sequence entries, part 163.
564. gbcon164.seq - Constructed sequence entries, part 164.
565. gbcon165.seq - Constructed sequence entries, part 165.
566. gbcon166.seq - Constructed sequence entries, part 166.
567. gbcon167.seq - Constructed sequence entries, part 167.
568. gbcon168.seq - Constructed sequence entries, part 168.
569. gbcon169.seq - Constructed sequence entries, part 169.
570. gbcon17.seq - Constructed sequence entries, part 17.
571. gbcon170.seq - Constructed sequence entries, part 170.
572. gbcon171.seq - Constructed sequence entries, part 171.
573. gbcon172.seq - Constructed sequence entries, part 172.
574. gbcon173.seq - Constructed sequence entries, part 173.
575. gbcon174.seq - Constructed sequence entries, part 174.
576. gbcon175.seq - Constructed sequence entries, part 175.
577. gbcon176.seq - Constructed sequence entries, part 176.
578. gbcon177.seq - Constructed sequence entries, part 177.
579. gbcon178.seq - Constructed sequence entries, part 178.
580. gbcon179.seq - Constructed sequence entries, part 179.
581. gbcon18.seq - Constructed sequence entries, part 18.
582. gbcon180.seq - Constructed sequence entries, part 180.
583. gbcon181.seq - Constructed sequence entries, part 181.
584. gbcon182.seq - Constructed sequence entries, part 182.
585. gbcon183.seq - Constructed sequence entries, part 183.
586. gbcon184.seq - Constructed sequence entries, part 184.
587. gbcon185.seq - Constructed sequence entries, part 185.
588. gbcon186.seq - Constructed sequence entries, part 186.
589. gbcon187.seq - Constructed sequence entries, part 187.
590. gbcon188.seq - Constructed sequence entries, part 188.
591. gbcon189.seq - Constructed sequence entries, part 189.
592. gbcon19.seq - Constructed sequence entries, part 19.
593. gbcon190.seq - Constructed sequence entries, part 190.
594. gbcon191.seq - Constructed sequence entries, part 191.
595. gbcon192.seq - Constructed sequence entries, part 192.
596. gbcon193.seq - Constructed sequence entries, part 193.
597. gbcon194.seq - Constructed sequence entries, part 194.
598. gbcon195.seq - Constructed sequence entries, part 195.
599. gbcon196.seq - Constructed sequence entries, part 196.
600. gbcon197.seq - Constructed sequence entries, part 197.
601. gbcon198.seq - Constructed sequence entries, part 198.
602. gbcon199.seq - Constructed sequence entries, part 199.
603. gbcon2.seq - Constructed sequence entries, part 2.
604. gbcon20.seq - Constructed sequence entries, part 20.
605. gbcon200.seq - Constructed sequence entries, part 200.
606. gbcon201.seq - Constructed sequence entries, part 201.
607. gbcon202.seq - Constructed sequence entries, part 202.
608. gbcon203.seq - Constructed sequence entries, part 203.
609. gbcon204.seq - Constructed sequence entries, part 204.
610. gbcon205.seq - Constructed sequence entries, part 205.
611. gbcon206.seq - Constructed sequence entries, part 206.
612. gbcon207.seq - Constructed sequence entries, part 207.
613. gbcon208.seq - Constructed sequence entries, part 208.
614. gbcon209.seq - Constructed sequence entries, part 209.
615. gbcon21.seq - Constructed sequence entries, part 21.
616. gbcon210.seq - Constructed sequence entries, part 210.
617. gbcon211.seq - Constructed sequence entries, part 211.
618. gbcon212.seq - Constructed sequence entries, part 212.
619. gbcon213.seq - Constructed sequence entries, part 213.
620. gbcon214.seq - Constructed sequence entries, part 214.
621. gbcon215.seq - Constructed sequence entries, part 215.
622. gbcon216.seq - Constructed sequence entries, part 216.
623. gbcon217.seq - Constructed sequence entries, part 217.
624. gbcon22.seq - Constructed sequence entries, part 22.
625. gbcon23.seq - Constructed sequence entries, part 23.
626. gbcon24.seq - Constructed sequence entries, part 24.
627. gbcon25.seq - Constructed sequence entries, part 25.
628. gbcon26.seq - Constructed sequence entries, part 26.
629. gbcon27.seq - Constructed sequence entries, part 27.
630. gbcon28.seq - Constructed sequence entries, part 28.
631. gbcon29.seq - Constructed sequence entries, part 29.
632. gbcon3.seq - Constructed sequence entries, part 3.
633. gbcon30.seq - Constructed sequence entries, part 30.
634. gbcon31.seq - Constructed sequence entries, part 31.
635. gbcon32.seq - Constructed sequence entries, part 32.
636. gbcon33.seq - Constructed sequence entries, part 33.
637. gbcon34.seq - Constructed sequence entries, part 34.
638. gbcon35.seq - Constructed sequence entries, part 35.
639. gbcon36.seq - Constructed sequence entries, part 36.
640. gbcon37.seq - Constructed sequence entries, part 37.
641. gbcon38.seq - Constructed sequence entries, part 38.
642. gbcon39.seq - Constructed sequence entries, part 39.
643. gbcon4.seq - Constructed sequence entries, part 4.
644. gbcon40.seq - Constructed sequence entries, part 40.
645. gbcon41.seq - Constructed sequence entries, part 41.
646. gbcon42.seq - Constructed sequence entries, part 42.
647. gbcon43.seq - Constructed sequence entries, part 43.
648. gbcon44.seq - Constructed sequence entries, part 44.
649. gbcon45.seq - Constructed sequence entries, part 45.
650. gbcon46.seq - Constructed sequence entries, part 46.
651. gbcon47.seq - Constructed sequence entries, part 47.
652. gbcon48.seq - Constructed sequence entries, part 48.
653. gbcon49.seq - Constructed sequence entries, part 49.
654. gbcon5.seq - Constructed sequence entries, part 5.
655. gbcon50.seq - Constructed sequence entries, part 50.
656. gbcon51.seq - Constructed sequence entries, part 51.
657. gbcon52.seq - Constructed sequence entries, part 52.
658. gbcon53.seq - Constructed sequence entries, part 53.
659. gbcon54.seq - Constructed sequence entries, part 54.
660. gbcon55.seq - Constructed sequence entries, part 55.
661. gbcon56.seq - Constructed sequence entries, part 56.
662. gbcon57.seq - Constructed sequence entries, part 57.
663. gbcon58.seq - Constructed sequence entries, part 58.
664. gbcon59.seq - Constructed sequence entries, part 59.
665. gbcon6.seq - Constructed sequence entries, part 6.
666. gbcon60.seq - Constructed sequence entries, part 60.
667. gbcon61.seq - Constructed sequence entries, part 61.
668. gbcon62.seq - Constructed sequence entries, part 62.
669. gbcon63.seq - Constructed sequence entries, part 63.
670. gbcon64.seq - Constructed sequence entries, part 64.
671. gbcon65.seq - Constructed sequence entries, part 65.
672. gbcon66.seq - Constructed sequence entries, part 66.
673. gbcon67.seq - Constructed sequence entries, part 67.
674. gbcon68.seq - Constructed sequence entries, part 68.
675. gbcon69.seq - Constructed sequence entries, part 69.
676. gbcon7.seq - Constructed sequence entries, part 7.
677. gbcon70.seq - Constructed sequence entries, part 70.
678. gbcon71.seq - Constructed sequence entries, part 71.
679. gbcon72.seq - Constructed sequence entries, part 72.
680. gbcon73.seq - Constructed sequence entries, part 73.
681. gbcon74.seq - Constructed sequence entries, part 74.
682. gbcon75.seq - Constructed sequence entries, part 75.
683. gbcon76.seq - Constructed sequence entries, part 76.
684. gbcon77.seq - Constructed sequence entries, part 77.
685. gbcon78.seq - Constructed sequence entries, part 78.
686. gbcon79.seq - Constructed sequence entries, part 79.
687. gbcon8.seq - Constructed sequence entries, part 8.
688. gbcon80.seq - Constructed sequence entries, part 80.
689. gbcon81.seq - Constructed sequence entries, part 81.
690. gbcon82.seq - Constructed sequence entries, part 82.
691. gbcon83.seq - Constructed sequence entries, part 83.
692. gbcon84.seq - Constructed sequence entries, part 84.
693. gbcon85.seq - Constructed sequence entries, part 85.
694. gbcon86.seq - Constructed sequence entries, part 86.
695. gbcon87.seq - Constructed sequence entries, part 87.
696. gbcon88.seq - Constructed sequence entries, part 88.
697. gbcon89.seq - Constructed sequence entries, part 89.
698. gbcon9.seq - Constructed sequence entries, part 9.
699. gbcon90.seq - Constructed sequence entries, part 90.
700. gbcon91.seq - Constructed sequence entries, part 91.
701. gbcon92.seq - Constructed sequence entries, part 92.
702. gbcon93.seq - Constructed sequence entries, part 93.
703. gbcon94.seq - Constructed sequence entries, part 94.
704. gbcon95.seq - Constructed sequence entries, part 95.
705. gbcon96.seq - Constructed sequence entries, part 96.
706. gbcon97.seq - Constructed sequence entries, part 97.
707. gbcon98.seq - Constructed sequence entries, part 98.
708. gbcon99.seq - Constructed sequence entries, part 99.
709. gbdel.txt - Accession numbers of entries deleted since the previous release.
710. gbenv1.seq - Environmental sampling sequence entries, part 1.
711. gbenv10.seq - Environmental sampling sequence entries, part 10.
712. gbenv11.seq - Environmental sampling sequence entries, part 11.
713. gbenv12.seq - Environmental sampling sequence entries, part 12.
714. gbenv13.seq - Environmental sampling sequence entries, part 13.
715. gbenv14.seq - Environmental sampling sequence entries, part 14.
716. gbenv15.seq - Environmental sampling sequence entries, part 15.
717. gbenv16.seq - Environmental sampling sequence entries, part 16.
718. gbenv17.seq - Environmental sampling sequence entries, part 17.
719. gbenv18.seq - Environmental sampling sequence entries, part 18.
720. gbenv19.seq - Environmental sampling sequence entries, part 19.
721. gbenv2.seq - Environmental sampling sequence entries, part 2.
722. gbenv20.seq - Environmental sampling sequence entries, part 20.
723. gbenv21.seq - Environmental sampling sequence entries, part 21.
724. gbenv22.seq - Environmental sampling sequence entries, part 22.
725. gbenv23.seq - Environmental sampling sequence entries, part 23.
726. gbenv24.seq - Environmental sampling sequence entries, part 24.
727. gbenv25.seq - Environmental sampling sequence entries, part 25.
728. gbenv26.seq - Environmental sampling sequence entries, part 26.
729. gbenv27.seq - Environmental sampling sequence entries, part 27.
730. gbenv28.seq - Environmental sampling sequence entries, part 28.
731. gbenv29.seq - Environmental sampling sequence entries, part 29.
732. gbenv3.seq - Environmental sampling sequence entries, part 3.
733. gbenv30.seq - Environmental sampling sequence entries, part 30.
734. gbenv31.seq - Environmental sampling sequence entries, part 31.
735. gbenv32.seq - Environmental sampling sequence entries, part 32.
736. gbenv33.seq - Environmental sampling sequence entries, part 33.
737. gbenv34.seq - Environmental sampling sequence entries, part 34.
738. gbenv35.seq - Environmental sampling sequence entries, part 35.
739. gbenv36.seq - Environmental sampling sequence entries, part 36.
740. gbenv37.seq - Environmental sampling sequence entries, part 37.
741. gbenv38.seq - Environmental sampling sequence entries, part 38.
742. gbenv39.seq - Environmental sampling sequence entries, part 39.
743. gbenv4.seq - Environmental sampling sequence entries, part 4.
744. gbenv40.seq - Environmental sampling sequence entries, part 40.
745. gbenv41.seq - Environmental sampling sequence entries, part 41.
746. gbenv42.seq - Environmental sampling sequence entries, part 42.
747. gbenv43.seq - Environmental sampling sequence entries, part 43.
748. gbenv44.seq - Environmental sampling sequence entries, part 44.
749. gbenv45.seq - Environmental sampling sequence entries, part 45.
750. gbenv46.seq - Environmental sampling sequence entries, part 46.
751. gbenv47.seq - Environmental sampling sequence entries, part 47.
752. gbenv48.seq - Environmental sampling sequence entries, part 48.
753. gbenv49.seq - Environmental sampling sequence entries, part 49.
754. gbenv5.seq - Environmental sampling sequence entries, part 5.
755. gbenv50.seq - Environmental sampling sequence entries, part 50.
756. gbenv51.seq - Environmental sampling sequence entries, part 51.
757. gbenv52.seq - Environmental sampling sequence entries, part 52.
758. gbenv53.seq - Environmental sampling sequence entries, part 53.
759. gbenv54.seq - Environmental sampling sequence entries, part 54.
760. gbenv55.seq - Environmental sampling sequence entries, part 55.
761. gbenv56.seq - Environmental sampling sequence entries, part 56.
762. gbenv57.seq - Environmental sampling sequence entries, part 57.
763. gbenv58.seq - Environmental sampling sequence entries, part 58.
764. gbenv59.seq - Environmental sampling sequence entries, part 59.
765. gbenv6.seq - Environmental sampling sequence entries, part 6.
766. gbenv60.seq - Environmental sampling sequence entries, part 60.
767. gbenv61.seq - Environmental sampling sequence entries, part 61.
768. gbenv62.seq - Environmental sampling sequence entries, part 62.
769. gbenv7.seq - Environmental sampling sequence entries, part 7.
770. gbenv8.seq - Environmental sampling sequence entries, part 8.
771. gbenv9.seq - Environmental sampling sequence entries, part 9.
772. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
773. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
774. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
775. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
776. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
777. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
778. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
779. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
780. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
781. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
782. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
783. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
784. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
785. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
786. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
787. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
788. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
789. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
790. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
791. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
792. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
793. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
794. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
795. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
796. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
797. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
798. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
799. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
800. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
801. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
802. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
803. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
804. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
805. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
806. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
807. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
808. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
809. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
810. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
811. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
812. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
813. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
814. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
815. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
816. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
817. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
818. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
819. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
820. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
821. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
822. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
823. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
824. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
825. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
826. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
827. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
828. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
829. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
830. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
831. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
832. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
833. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
834. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
835. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
836. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
837. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
838. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
839. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
840. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
841. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
842. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
843. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
844. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
845. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
846. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
847. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
848. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
849. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
850. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
851. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
852. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
853. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
854. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
855. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
856. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
857. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
858. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
859. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
860. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
861. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
862. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
863. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
864. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
865. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
866. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
867. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
868. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
869. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
870. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
871. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
872. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
873. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
874. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
875. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
876. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
877. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
878. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
879. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
880. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
881. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
882. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
883. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
884. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
885. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
886. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
887. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
888. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
889. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
890. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
891. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
892. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
893. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
894. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
895. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
896. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
897. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
898. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
899. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
900. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
901. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
902. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
903. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
904. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
905. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
906. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
907. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
908. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
909. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
910. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
911. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
912. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
913. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
914. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
915. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
916. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
917. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
918. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
919. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
920. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
921. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
922. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
923. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
924. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
925. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
926. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
927. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
928. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
929. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
930. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
931. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
932. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
933. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
934. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
935. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
936. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
937. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
938. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
939. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
940. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
941. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
942. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
943. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
944. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
945. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
946. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
947. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
948. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
949. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
950. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
951. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
952. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
953. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
954. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
955. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
956. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
957. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
958. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
959. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
960. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
961. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
962. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
963. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
964. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
965. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
966. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
967. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
968. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
969. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
970. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
971. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
972. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
973. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
974. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
975. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
976. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
977. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
978. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
979. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
980. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
981. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
982. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
983. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
984. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
985. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
986. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
987. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
988. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
989. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
990. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
991. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
992. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
993. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
994. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
995. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
996. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
997. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
998. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
999. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1000. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1001. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1002. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1003. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1004. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1005. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1006. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1007. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1008. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1009. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1010. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1011. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1012. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1013. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1014. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1015. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1016. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1017. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1018. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1019. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1020. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1021. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1022. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1023. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1024. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1025. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1026. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1027. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1028. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1029. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1030. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1031. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1032. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1033. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1034. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1035. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1036. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1037. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1038. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1039. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1040. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1041. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1042. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1043. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1044. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1045. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1046. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1047. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1048. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1049. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1050. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1051. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1052. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1053. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1054. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1055. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1056. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1057. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1058. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1059. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1060. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1061. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1062. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1063. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1064. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1065. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1066. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1067. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1068. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1069. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1070. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1071. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1072. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1073. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1074. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1075. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1076. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1077. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1078. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1079. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1080. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1081. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1082. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1083. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1084. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1085. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1086. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1087. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1088. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1089. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1090. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1091. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1092. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1093. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1094. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1095. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1096. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1097. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1098. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1099. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1100. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1101. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1102. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1103. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1104. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1105. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1106. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1107. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1108. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1109. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1110. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1111. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1112. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1113. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1114. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1115. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1116. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1117. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1118. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1119. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1120. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1121. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1122. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1123. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1124. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1125. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1126. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1127. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1128. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1129. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1130. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1131. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1132. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1133. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1134. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1135. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1136. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1137. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1138. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1139. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1140. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1141. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1142. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1143. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1144. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1145. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1146. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1147. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1148. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1149. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1150. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1151. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1152. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1153. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1154. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1155. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1156. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1157. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1158. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1159. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1160. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1161. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1162. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1163. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1164. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1165. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1166. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1167. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1168. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1169. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1170. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1171. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1172. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1173. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1174. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1175. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1176. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1177. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1178. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1179. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1180. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1181. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1182. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1183. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1184. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1185. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1186. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1187. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1188. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1189. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1190. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1191. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1192. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1193. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1194. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1195. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1196. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1197. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1198. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1199. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
1200. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
1201. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
1202. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
1203. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
1204. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
1205. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1206. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
1207. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
1208. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
1209. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
1210. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
1211. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
1212. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
1213. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
1214. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
1215. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
1216. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1217. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1218. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
1219. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
1220. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
1221. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
1222. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
1223. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
1224. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
1225. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
1226. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
1227. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
1228. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1229. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
1230. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
1231. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
1232. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
1233. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
1234. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
1235. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
1236. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
1237. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
1238. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
1239. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1240. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
1241. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
1242. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
1243. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
1244. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
1245. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
1246. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
1247. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
1248. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
1249. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
1250. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1251. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
1252. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
1253. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
1254. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
1255. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
1256. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
1257. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
1258. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
1259. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
1260. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
1261. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1262. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
1263. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
1264. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
1265. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
1266. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
1267. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
1268. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
1269. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
1270. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
1271. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
1272. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1273. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
1274. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
1275. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
1276. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
1277. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
1278. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
1279. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
1280. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
1281. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
1282. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
1283. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1284. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
1285. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
1286. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
1287. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
1288. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
1289. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
1290. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
1291. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
1292. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
1293. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
1294. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1295. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
1296. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
1297. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
1298. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
1299. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
1300. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1301. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1302. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1303. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1304. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1305. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1306. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1307. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1308. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1309. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1310. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1311. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1312. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1313. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1314. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1315. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1316. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1317. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1318. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1319. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1320. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1321. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1322. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1323. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1324. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1325. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1326. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1327. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1328. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1329. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1330. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1331. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1332. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1333. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1334. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1335. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1336. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1337. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1338. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1339. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1340. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1341. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1342. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1343. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1344. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1345. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1346. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1347. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1348. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1349. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1350. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1351. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1352. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1353. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1354. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1355. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1356. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1357. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1358. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1359. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1360. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1361. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1362. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1363. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1364. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1365. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1366. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1367. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1368. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1369. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1370. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1371. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1372. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1373. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1374. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1375. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1376. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1377. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1378. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1379. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1380. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1381. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1382. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1383. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1384. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1385. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1386. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1387. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1388. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1389. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1390. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1391. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1392. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1393. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1394. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1395. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1396. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1397. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1398. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1399. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1400. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1401. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1402. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1403. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1404. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1405. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1406. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1407. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1408. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1409. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1410. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1411. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1412. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1413. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1414. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1415. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1416. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1417. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1418. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1419. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1420. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1421. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1422. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1423. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1424. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1425. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1426. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1427. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1428. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1429. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1430. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1431. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1432. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1433. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1434. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1435. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1436. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1437. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1438. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1439. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1440. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1441. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1442. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1443. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1444. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1445. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1446. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1447. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1448. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1449. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1450. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1451. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1452. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1453. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1454. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1455. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1456. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1457. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1458. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1459. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1460. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1461. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1462. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1463. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1464. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1465. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1466. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1467. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1468. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1469. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1470. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1471. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1472. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1473. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1474. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1475. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1476. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1477. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1478. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1479. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1480. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1481. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1482. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1483. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1484. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1485. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1486. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1487. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1488. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1489. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1490. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1491. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1492. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1493. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1494. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1495. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1496. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1497. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1498. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1499. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1500. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1501. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1502. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1503. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1504. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1505. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1506. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1507. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1508. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1509. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1510. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1511. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1512. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1513. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1514. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1515. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1516. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1517. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1518. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1519. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1520. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1521. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1522. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1523. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1524. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1525. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1526. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1527. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1528. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1529. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1530. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1531. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1532. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1533. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1534. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1535. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1536. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1537. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1538. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1539. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1540. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1541. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1542. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1543. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1544. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1545. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1546. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1547. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1548. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1549. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1550. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1551. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1552. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1553. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1554. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1555. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1556. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1557. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1558. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1559. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1560. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1561. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1562. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1563. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1564. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1565. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1566. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1567. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1568. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1569. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1570. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1571. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1572. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1573. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1574. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1575. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1576. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1577. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1578. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1579. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1580. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1581. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1582. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1583. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1584. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1585. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1586. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1587. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1588. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1589. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1590. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1591. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1592. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1593. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1594. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1595. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1596. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1597. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1598. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1599. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1600. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1601. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1602. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1603. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1604. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1605. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1606. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1607. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1608. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1609. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1610. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1611. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1612. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1613. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1614. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1615. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1616. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1617. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1618. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1619. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1620. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1621. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1622. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1623. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1624. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1625. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1626. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1627. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1628. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1629. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1630. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1631. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1632. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1633. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1634. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1635. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1636. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1637. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1638. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1639. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1640. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1641. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1642. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1643. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1644. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1645. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1646. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1647. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1648. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1649. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1650. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1651. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1652. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1653. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1654. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1655. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1656. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1657. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1658. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1659. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1660. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1661. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1662. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1663. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1664. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1665. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1666. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1667. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1668. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1669. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1670. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1671. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1672. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1673. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1674. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1675. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1676. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1677. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1678. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1679. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1680. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1681. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1682. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1683. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1684. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1685. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1686. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1687. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1688. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1689. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1690. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1691. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1692. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1693. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1694. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1695. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1696. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1697. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1698. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1699. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1700. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1701. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1702. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1703. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1704. gbinv1.seq - Invertebrate sequence entries, part 1.
1705. gbinv10.seq - Invertebrate sequence entries, part 10.
1706. gbinv11.seq - Invertebrate sequence entries, part 11.
1707. gbinv12.seq - Invertebrate sequence entries, part 12.
1708. gbinv13.seq - Invertebrate sequence entries, part 13.
1709. gbinv14.seq - Invertebrate sequence entries, part 14.
1710. gbinv15.seq - Invertebrate sequence entries, part 15.
1711. gbinv16.seq - Invertebrate sequence entries, part 16.
1712. gbinv17.seq - Invertebrate sequence entries, part 17.
1713. gbinv18.seq - Invertebrate sequence entries, part 18.
1714. gbinv19.seq - Invertebrate sequence entries, part 19.
1715. gbinv2.seq - Invertebrate sequence entries, part 2.
1716. gbinv20.seq - Invertebrate sequence entries, part 20.
1717. gbinv21.seq - Invertebrate sequence entries, part 21.
1718. gbinv22.seq - Invertebrate sequence entries, part 22.
1719. gbinv23.seq - Invertebrate sequence entries, part 23.
1720. gbinv24.seq - Invertebrate sequence entries, part 24.
1721. gbinv25.seq - Invertebrate sequence entries, part 25.
1722. gbinv26.seq - Invertebrate sequence entries, part 26.
1723. gbinv27.seq - Invertebrate sequence entries, part 27.
1724. gbinv28.seq - Invertebrate sequence entries, part 28.
1725. gbinv29.seq - Invertebrate sequence entries, part 29.
1726. gbinv3.seq - Invertebrate sequence entries, part 3.
1727. gbinv30.seq - Invertebrate sequence entries, part 30.
1728. gbinv31.seq - Invertebrate sequence entries, part 31.
1729. gbinv32.seq - Invertebrate sequence entries, part 32.
1730. gbinv33.seq - Invertebrate sequence entries, part 33.
1731. gbinv34.seq - Invertebrate sequence entries, part 34.
1732. gbinv35.seq - Invertebrate sequence entries, part 35.
1733. gbinv36.seq - Invertebrate sequence entries, part 36.
1734. gbinv37.seq - Invertebrate sequence entries, part 37.
1735. gbinv38.seq - Invertebrate sequence entries, part 38.
1736. gbinv39.seq - Invertebrate sequence entries, part 39.
1737. gbinv4.seq - Invertebrate sequence entries, part 4.
1738. gbinv40.seq - Invertebrate sequence entries, part 40.
1739. gbinv41.seq - Invertebrate sequence entries, part 41.
1740. gbinv42.seq - Invertebrate sequence entries, part 42.
1741. gbinv43.seq - Invertebrate sequence entries, part 43.
1742. gbinv44.seq - Invertebrate sequence entries, part 44.
1743. gbinv45.seq - Invertebrate sequence entries, part 45.
1744. gbinv46.seq - Invertebrate sequence entries, part 46.
1745. gbinv47.seq - Invertebrate sequence entries, part 47.
1746. gbinv48.seq - Invertebrate sequence entries, part 48.
1747. gbinv49.seq - Invertebrate sequence entries, part 49.
1748. gbinv5.seq - Invertebrate sequence entries, part 5.
1749. gbinv50.seq - Invertebrate sequence entries, part 50.
1750. gbinv51.seq - Invertebrate sequence entries, part 51.
1751. gbinv52.seq - Invertebrate sequence entries, part 52.
1752. gbinv53.seq - Invertebrate sequence entries, part 53.
1753. gbinv54.seq - Invertebrate sequence entries, part 54.
1754. gbinv55.seq - Invertebrate sequence entries, part 55.
1755. gbinv56.seq - Invertebrate sequence entries, part 56.
1756. gbinv57.seq - Invertebrate sequence entries, part 57.
1757. gbinv58.seq - Invertebrate sequence entries, part 58.
1758. gbinv59.seq - Invertebrate sequence entries, part 59.
1759. gbinv6.seq - Invertebrate sequence entries, part 6.
1760. gbinv60.seq - Invertebrate sequence entries, part 60.
1761. gbinv61.seq - Invertebrate sequence entries, part 61.
1762. gbinv62.seq - Invertebrate sequence entries, part 62.
1763. gbinv63.seq - Invertebrate sequence entries, part 63.
1764. gbinv64.seq - Invertebrate sequence entries, part 64.
1765. gbinv65.seq - Invertebrate sequence entries, part 65.
1766. gbinv66.seq - Invertebrate sequence entries, part 66.
1767. gbinv67.seq - Invertebrate sequence entries, part 67.
1768. gbinv68.seq - Invertebrate sequence entries, part 68.
1769. gbinv69.seq - Invertebrate sequence entries, part 69.
1770. gbinv7.seq - Invertebrate sequence entries, part 7.
1771. gbinv70.seq - Invertebrate sequence entries, part 70.
1772. gbinv71.seq - Invertebrate sequence entries, part 71.
1773. gbinv72.seq - Invertebrate sequence entries, part 72.
1774. gbinv73.seq - Invertebrate sequence entries, part 73.
1775. gbinv74.seq - Invertebrate sequence entries, part 74.
1776. gbinv75.seq - Invertebrate sequence entries, part 75.
1777. gbinv76.seq - Invertebrate sequence entries, part 76.
1778. gbinv77.seq - Invertebrate sequence entries, part 77.
1779. gbinv78.seq - Invertebrate sequence entries, part 78.
1780. gbinv79.seq - Invertebrate sequence entries, part 79.
1781. gbinv8.seq - Invertebrate sequence entries, part 8.
1782. gbinv80.seq - Invertebrate sequence entries, part 80.
1783. gbinv81.seq - Invertebrate sequence entries, part 81.
1784. gbinv82.seq - Invertebrate sequence entries, part 82.
1785. gbinv83.seq - Invertebrate sequence entries, part 83.
1786. gbinv84.seq - Invertebrate sequence entries, part 84.
1787. gbinv85.seq - Invertebrate sequence entries, part 85.
1788. gbinv86.seq - Invertebrate sequence entries, part 86.
1789. gbinv87.seq - Invertebrate sequence entries, part 87.
1790. gbinv88.seq - Invertebrate sequence entries, part 88.
1791. gbinv89.seq - Invertebrate sequence entries, part 89.
1792. gbinv9.seq - Invertebrate sequence entries, part 9.
1793. gbinv90.seq - Invertebrate sequence entries, part 90.
1794. gbinv91.seq - Invertebrate sequence entries, part 91.
1795. gbinv92.seq - Invertebrate sequence entries, part 92.
1796. gbinv93.seq - Invertebrate sequence entries, part 93.
1797. gbinv94.seq - Invertebrate sequence entries, part 94.
1798. gbinv95.seq - Invertebrate sequence entries, part 95.
1799. gbmam1.seq - Other mammalian sequence entries, part 1.
1800. gbmam10.seq - Other mammalian sequence entries, part 10.
1801. gbmam11.seq - Other mammalian sequence entries, part 11.
1802. gbmam12.seq - Other mammalian sequence entries, part 12.
1803. gbmam13.seq - Other mammalian sequence entries, part 13.
1804. gbmam14.seq - Other mammalian sequence entries, part 14.
1805. gbmam15.seq - Other mammalian sequence entries, part 15.
1806. gbmam16.seq - Other mammalian sequence entries, part 16.
1807. gbmam17.seq - Other mammalian sequence entries, part 17.
1808. gbmam18.seq - Other mammalian sequence entries, part 18.
1809. gbmam19.seq - Other mammalian sequence entries, part 19.
1810. gbmam2.seq - Other mammalian sequence entries, part 2.
1811. gbmam20.seq - Other mammalian sequence entries, part 20.
1812. gbmam21.seq - Other mammalian sequence entries, part 21.
1813. gbmam22.seq - Other mammalian sequence entries, part 22.
1814. gbmam23.seq - Other mammalian sequence entries, part 23.
1815. gbmam24.seq - Other mammalian sequence entries, part 24.
1816. gbmam25.seq - Other mammalian sequence entries, part 25.
1817. gbmam26.seq - Other mammalian sequence entries, part 26.
1818. gbmam27.seq - Other mammalian sequence entries, part 27.
1819. gbmam28.seq - Other mammalian sequence entries, part 28.
1820. gbmam29.seq - Other mammalian sequence entries, part 29.
1821. gbmam3.seq - Other mammalian sequence entries, part 3.
1822. gbmam30.seq - Other mammalian sequence entries, part 30.
1823. gbmam31.seq - Other mammalian sequence entries, part 31.
1824. gbmam32.seq - Other mammalian sequence entries, part 32.
1825. gbmam33.seq - Other mammalian sequence entries, part 33.
1826. gbmam34.seq - Other mammalian sequence entries, part 34.
1827. gbmam35.seq - Other mammalian sequence entries, part 35.
1828. gbmam36.seq - Other mammalian sequence entries, part 36.
1829. gbmam37.seq - Other mammalian sequence entries, part 37.
1830. gbmam38.seq - Other mammalian sequence entries, part 38.
1831. gbmam39.seq - Other mammalian sequence entries, part 39.
1832. gbmam4.seq - Other mammalian sequence entries, part 4.
1833. gbmam40.seq - Other mammalian sequence entries, part 40.
1834. gbmam41.seq - Other mammalian sequence entries, part 41.
1835. gbmam42.seq - Other mammalian sequence entries, part 42.
1836. gbmam43.seq - Other mammalian sequence entries, part 43.
1837. gbmam44.seq - Other mammalian sequence entries, part 44.
1838. gbmam45.seq - Other mammalian sequence entries, part 45.
1839. gbmam46.seq - Other mammalian sequence entries, part 46.
1840. gbmam47.seq - Other mammalian sequence entries, part 47.
1841. gbmam48.seq - Other mammalian sequence entries, part 48.
1842. gbmam49.seq - Other mammalian sequence entries, part 49.
1843. gbmam5.seq - Other mammalian sequence entries, part 5.
1844. gbmam50.seq - Other mammalian sequence entries, part 50.
1845. gbmam51.seq - Other mammalian sequence entries, part 51.
1846. gbmam52.seq - Other mammalian sequence entries, part 52.
1847. gbmam53.seq - Other mammalian sequence entries, part 53.
1848. gbmam54.seq - Other mammalian sequence entries, part 54.
1849. gbmam55.seq - Other mammalian sequence entries, part 55.
1850. gbmam56.seq - Other mammalian sequence entries, part 56.
1851. gbmam57.seq - Other mammalian sequence entries, part 57.
1852. gbmam58.seq - Other mammalian sequence entries, part 58.
1853. gbmam59.seq - Other mammalian sequence entries, part 59.
1854. gbmam6.seq - Other mammalian sequence entries, part 6.
1855. gbmam60.seq - Other mammalian sequence entries, part 60.
1856. gbmam61.seq - Other mammalian sequence entries, part 61.
1857. gbmam62.seq - Other mammalian sequence entries, part 62.
1858. gbmam63.seq - Other mammalian sequence entries, part 63.
1859. gbmam64.seq - Other mammalian sequence entries, part 64.
1860. gbmam65.seq - Other mammalian sequence entries, part 65.
1861. gbmam66.seq - Other mammalian sequence entries, part 66.
1862. gbmam67.seq - Other mammalian sequence entries, part 67.
1863. gbmam68.seq - Other mammalian sequence entries, part 68.
1864. gbmam69.seq - Other mammalian sequence entries, part 69.
1865. gbmam7.seq - Other mammalian sequence entries, part 7.
1866. gbmam70.seq - Other mammalian sequence entries, part 70.
1867. gbmam71.seq - Other mammalian sequence entries, part 71.
1868. gbmam72.seq - Other mammalian sequence entries, part 72.
1869. gbmam73.seq - Other mammalian sequence entries, part 73.
1870. gbmam74.seq - Other mammalian sequence entries, part 74.
1871. gbmam75.seq - Other mammalian sequence entries, part 75.
1872. gbmam76.seq - Other mammalian sequence entries, part 76.
1873. gbmam8.seq - Other mammalian sequence entries, part 8.
1874. gbmam9.seq - Other mammalian sequence entries, part 9.
1875. gbnew.txt - Accession numbers of entries new since the previous release.
1876. gbpat1.seq - Patent sequence entries, part 1.
1877. gbpat10.seq - Patent sequence entries, part 10.
1878. gbpat100.seq - Patent sequence entries, part 100.
1879. gbpat101.seq - Patent sequence entries, part 101.
1880. gbpat102.seq - Patent sequence entries, part 102.
1881. gbpat103.seq - Patent sequence entries, part 103.
1882. gbpat104.seq - Patent sequence entries, part 104.
1883. gbpat105.seq - Patent sequence entries, part 105.
1884. gbpat106.seq - Patent sequence entries, part 106.
1885. gbpat107.seq - Patent sequence entries, part 107.
1886. gbpat108.seq - Patent sequence entries, part 108.
1887. gbpat109.seq - Patent sequence entries, part 109.
1888. gbpat11.seq - Patent sequence entries, part 11.
1889. gbpat110.seq - Patent sequence entries, part 110.
1890. gbpat111.seq - Patent sequence entries, part 111.
1891. gbpat112.seq - Patent sequence entries, part 112.
1892. gbpat113.seq - Patent sequence entries, part 113.
1893. gbpat114.seq - Patent sequence entries, part 114.
1894. gbpat115.seq - Patent sequence entries, part 115.
1895. gbpat116.seq - Patent sequence entries, part 116.
1896. gbpat117.seq - Patent sequence entries, part 117.
1897. gbpat118.seq - Patent sequence entries, part 118.
1898. gbpat119.seq - Patent sequence entries, part 119.
1899. gbpat12.seq - Patent sequence entries, part 12.
1900. gbpat120.seq - Patent sequence entries, part 120.
1901. gbpat121.seq - Patent sequence entries, part 121.
1902. gbpat122.seq - Patent sequence entries, part 122.
1903. gbpat123.seq - Patent sequence entries, part 123.
1904. gbpat124.seq - Patent sequence entries, part 124.
1905. gbpat125.seq - Patent sequence entries, part 125.
1906. gbpat126.seq - Patent sequence entries, part 126.
1907. gbpat127.seq - Patent sequence entries, part 127.
1908. gbpat128.seq - Patent sequence entries, part 128.
1909. gbpat129.seq - Patent sequence entries, part 129.
1910. gbpat13.seq - Patent sequence entries, part 13.
1911. gbpat130.seq - Patent sequence entries, part 130.
1912. gbpat131.seq - Patent sequence entries, part 131.
1913. gbpat132.seq - Patent sequence entries, part 132.
1914. gbpat133.seq - Patent sequence entries, part 133.
1915. gbpat134.seq - Patent sequence entries, part 134.
1916. gbpat135.seq - Patent sequence entries, part 135.
1917. gbpat136.seq - Patent sequence entries, part 136.
1918. gbpat137.seq - Patent sequence entries, part 137.
1919. gbpat138.seq - Patent sequence entries, part 138.
1920. gbpat139.seq - Patent sequence entries, part 139.
1921. gbpat14.seq - Patent sequence entries, part 14.
1922. gbpat140.seq - Patent sequence entries, part 140.
1923. gbpat141.seq - Patent sequence entries, part 141.
1924. gbpat142.seq - Patent sequence entries, part 142.
1925. gbpat143.seq - Patent sequence entries, part 143.
1926. gbpat144.seq - Patent sequence entries, part 144.
1927. gbpat145.seq - Patent sequence entries, part 145.
1928. gbpat146.seq - Patent sequence entries, part 146.
1929. gbpat147.seq - Patent sequence entries, part 147.
1930. gbpat148.seq - Patent sequence entries, part 148.
1931. gbpat149.seq - Patent sequence entries, part 149.
1932. gbpat15.seq - Patent sequence entries, part 15.
1933. gbpat150.seq - Patent sequence entries, part 150.
1934. gbpat151.seq - Patent sequence entries, part 151.
1935. gbpat152.seq - Patent sequence entries, part 152.
1936. gbpat153.seq - Patent sequence entries, part 153.
1937. gbpat154.seq - Patent sequence entries, part 154.
1938. gbpat155.seq - Patent sequence entries, part 155.
1939. gbpat156.seq - Patent sequence entries, part 156.
1940. gbpat157.seq - Patent sequence entries, part 157.
1941. gbpat158.seq - Patent sequence entries, part 158.
1942. gbpat159.seq - Patent sequence entries, part 159.
1943. gbpat16.seq - Patent sequence entries, part 16.
1944. gbpat160.seq - Patent sequence entries, part 160.
1945. gbpat161.seq - Patent sequence entries, part 161.
1946. gbpat162.seq - Patent sequence entries, part 162.
1947. gbpat163.seq - Patent sequence entries, part 163.
1948. gbpat164.seq - Patent sequence entries, part 164.
1949. gbpat165.seq - Patent sequence entries, part 165.
1950. gbpat166.seq - Patent sequence entries, part 166.
1951. gbpat167.seq - Patent sequence entries, part 167.
1952. gbpat168.seq - Patent sequence entries, part 168.
1953. gbpat169.seq - Patent sequence entries, part 169.
1954. gbpat17.seq - Patent sequence entries, part 17.
1955. gbpat170.seq - Patent sequence entries, part 170.
1956. gbpat171.seq - Patent sequence entries, part 171.
1957. gbpat172.seq - Patent sequence entries, part 172.
1958. gbpat173.seq - Patent sequence entries, part 173.
1959. gbpat174.seq - Patent sequence entries, part 174.
1960. gbpat175.seq - Patent sequence entries, part 175.
1961. gbpat176.seq - Patent sequence entries, part 176.
1962. gbpat177.seq - Patent sequence entries, part 177.
1963. gbpat178.seq - Patent sequence entries, part 178.
1964. gbpat179.seq - Patent sequence entries, part 179.
1965. gbpat18.seq - Patent sequence entries, part 18.
1966. gbpat180.seq - Patent sequence entries, part 180.
1967. gbpat181.seq - Patent sequence entries, part 181.
1968. gbpat182.seq - Patent sequence entries, part 182.
1969. gbpat183.seq - Patent sequence entries, part 183.
1970. gbpat184.seq - Patent sequence entries, part 184.
1971. gbpat185.seq - Patent sequence entries, part 185.
1972. gbpat186.seq - Patent sequence entries, part 186.
1973. gbpat187.seq - Patent sequence entries, part 187.
1974. gbpat188.seq - Patent sequence entries, part 188.
1975. gbpat189.seq - Patent sequence entries, part 189.
1976. gbpat19.seq - Patent sequence entries, part 19.
1977. gbpat190.seq - Patent sequence entries, part 190.
1978. gbpat191.seq - Patent sequence entries, part 191.
1979. gbpat192.seq - Patent sequence entries, part 192.
1980. gbpat193.seq - Patent sequence entries, part 193.
1981. gbpat194.seq - Patent sequence entries, part 194.
1982. gbpat195.seq - Patent sequence entries, part 195.
1983. gbpat196.seq - Patent sequence entries, part 196.
1984. gbpat197.seq - Patent sequence entries, part 197.
1985. gbpat198.seq - Patent sequence entries, part 198.
1986. gbpat199.seq - Patent sequence entries, part 199.
1987. gbpat2.seq - Patent sequence entries, part 2.
1988. gbpat20.seq - Patent sequence entries, part 20.
1989. gbpat200.seq - Patent sequence entries, part 200.
1990. gbpat201.seq - Patent sequence entries, part 201.
1991. gbpat202.seq - Patent sequence entries, part 202.
1992. gbpat203.seq - Patent sequence entries, part 203.
1993. gbpat204.seq - Patent sequence entries, part 204.
1994. gbpat205.seq - Patent sequence entries, part 205.
1995. gbpat206.seq - Patent sequence entries, part 206.
1996. gbpat207.seq - Patent sequence entries, part 207.
1997. gbpat208.seq - Patent sequence entries, part 208.
1998. gbpat209.seq - Patent sequence entries, part 209.
1999. gbpat21.seq - Patent sequence entries, part 21.
2000. gbpat210.seq - Patent sequence entries, part 210.
2001. gbpat211.seq - Patent sequence entries, part 211.
2002. gbpat212.seq - Patent sequence entries, part 212.
2003. gbpat22.seq - Patent sequence entries, part 22.
2004. gbpat23.seq - Patent sequence entries, part 23.
2005. gbpat24.seq - Patent sequence entries, part 24.
2006. gbpat25.seq - Patent sequence entries, part 25.
2007. gbpat26.seq - Patent sequence entries, part 26.
2008. gbpat27.seq - Patent sequence entries, part 27.
2009. gbpat28.seq - Patent sequence entries, part 28.
2010. gbpat29.seq - Patent sequence entries, part 29.
2011. gbpat3.seq - Patent sequence entries, part 3.
2012. gbpat30.seq - Patent sequence entries, part 30.
2013. gbpat31.seq - Patent sequence entries, part 31.
2014. gbpat32.seq - Patent sequence entries, part 32.
2015. gbpat33.seq - Patent sequence entries, part 33.
2016. gbpat34.seq - Patent sequence entries, part 34.
2017. gbpat35.seq - Patent sequence entries, part 35.
2018. gbpat36.seq - Patent sequence entries, part 36.
2019. gbpat37.seq - Patent sequence entries, part 37.
2020. gbpat38.seq - Patent sequence entries, part 38.
2021. gbpat39.seq - Patent sequence entries, part 39.
2022. gbpat4.seq - Patent sequence entries, part 4.
2023. gbpat40.seq - Patent sequence entries, part 40.
2024. gbpat41.seq - Patent sequence entries, part 41.
2025. gbpat42.seq - Patent sequence entries, part 42.
2026. gbpat43.seq - Patent sequence entries, part 43.
2027. gbpat44.seq - Patent sequence entries, part 44.
2028. gbpat45.seq - Patent sequence entries, part 45.
2029. gbpat46.seq - Patent sequence entries, part 46.
2030. gbpat47.seq - Patent sequence entries, part 47.
2031. gbpat48.seq - Patent sequence entries, part 48.
2032. gbpat49.seq - Patent sequence entries, part 49.
2033. gbpat5.seq - Patent sequence entries, part 5.
2034. gbpat50.seq - Patent sequence entries, part 50.
2035. gbpat51.seq - Patent sequence entries, part 51.
2036. gbpat52.seq - Patent sequence entries, part 52.
2037. gbpat53.seq - Patent sequence entries, part 53.
2038. gbpat54.seq - Patent sequence entries, part 54.
2039. gbpat55.seq - Patent sequence entries, part 55.
2040. gbpat56.seq - Patent sequence entries, part 56.
2041. gbpat57.seq - Patent sequence entries, part 57.
2042. gbpat58.seq - Patent sequence entries, part 58.
2043. gbpat59.seq - Patent sequence entries, part 59.
2044. gbpat6.seq - Patent sequence entries, part 6.
2045. gbpat60.seq - Patent sequence entries, part 60.
2046. gbpat61.seq - Patent sequence entries, part 61.
2047. gbpat62.seq - Patent sequence entries, part 62.
2048. gbpat63.seq - Patent sequence entries, part 63.
2049. gbpat64.seq - Patent sequence entries, part 64.
2050. gbpat65.seq - Patent sequence entries, part 65.
2051. gbpat66.seq - Patent sequence entries, part 66.
2052. gbpat67.seq - Patent sequence entries, part 67.
2053. gbpat68.seq - Patent sequence entries, part 68.
2054. gbpat69.seq - Patent sequence entries, part 69.
2055. gbpat7.seq - Patent sequence entries, part 7.
2056. gbpat70.seq - Patent sequence entries, part 70.
2057. gbpat71.seq - Patent sequence entries, part 71.
2058. gbpat72.seq - Patent sequence entries, part 72.
2059. gbpat73.seq - Patent sequence entries, part 73.
2060. gbpat74.seq - Patent sequence entries, part 74.
2061. gbpat75.seq - Patent sequence entries, part 75.
2062. gbpat76.seq - Patent sequence entries, part 76.
2063. gbpat77.seq - Patent sequence entries, part 77.
2064. gbpat78.seq - Patent sequence entries, part 78.
2065. gbpat79.seq - Patent sequence entries, part 79.
2066. gbpat8.seq - Patent sequence entries, part 8.
2067. gbpat80.seq - Patent sequence entries, part 80.
2068. gbpat81.seq - Patent sequence entries, part 81.
2069. gbpat82.seq - Patent sequence entries, part 82.
2070. gbpat83.seq - Patent sequence entries, part 83.
2071. gbpat84.seq - Patent sequence entries, part 84.
2072. gbpat85.seq - Patent sequence entries, part 85.
2073. gbpat86.seq - Patent sequence entries, part 86.
2074. gbpat87.seq - Patent sequence entries, part 87.
2075. gbpat88.seq - Patent sequence entries, part 88.
2076. gbpat89.seq - Patent sequence entries, part 89.
2077. gbpat9.seq - Patent sequence entries, part 9.
2078. gbpat90.seq - Patent sequence entries, part 90.
2079. gbpat91.seq - Patent sequence entries, part 91.
2080. gbpat92.seq - Patent sequence entries, part 92.
2081. gbpat93.seq - Patent sequence entries, part 93.
2082. gbpat94.seq - Patent sequence entries, part 94.
2083. gbpat95.seq - Patent sequence entries, part 95.
2084. gbpat96.seq - Patent sequence entries, part 96.
2085. gbpat97.seq - Patent sequence entries, part 97.
2086. gbpat98.seq - Patent sequence entries, part 98.
2087. gbpat99.seq - Patent sequence entries, part 99.
2088. gbphg1.seq - Phage sequence entries, part 1.
2089. gbphg2.seq - Phage sequence entries, part 2.
2090. gbphg3.seq - Phage sequence entries, part 3.
2091. gbphg4.seq - Phage sequence entries, part 4.
2092. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2093. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2094. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2095. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2096. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2097. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2098. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2099. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2100. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2101. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2102. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2103. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2104. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2105. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2106. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2107. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2108. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2109. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2110. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2111. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2112. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2113. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2114. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2115. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2116. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2117. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2118. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2119. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2120. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2121. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2122. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2123. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2124. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2125. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2126. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2127. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2128. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2129. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2130. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2131. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2132. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2133. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2134. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2135. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2136. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2137. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2138. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2139. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2140. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2141. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2142. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2143. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2144. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
2145. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
2146. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
2147. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
2148. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2149. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
2150. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
2151. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
2152. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
2153. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
2154. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
2155. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
2156. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
2157. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
2158. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
2159. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2160. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
2161. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
2162. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
2163. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
2164. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
2165. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
2166. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
2167. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
2168. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
2169. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
2170. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2171. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
2172. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
2173. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
2174. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
2175. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
2176. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
2177. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
2178. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
2179. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
2180. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
2181. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2182. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
2183. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
2184. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
2185. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
2186. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
2187. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
2188. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
2189. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
2190. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
2191. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
2192. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2193. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
2194. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
2195. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
2196. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
2197. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
2198. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
2199. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
2200. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
2201. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
2202. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
2203. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2204. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2205. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
2206. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
2207. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
2208. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
2209. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
2210. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
2211. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
2212. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
2213. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
2214. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
2215. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
2216. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
2217. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
2218. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
2219. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
2220. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
2221. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
2222. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
2223. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
2224. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
2225. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
2226. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
2227. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
2228. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
2229. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
2230. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
2231. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
2232. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
2233. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
2234. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
2235. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
2236. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
2237. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
2238. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
2239. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
2240. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
2241. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
2242. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
2243. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
2244. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
2245. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
2246. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
2247. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
2248. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
2249. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
2250. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
2251. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
2252. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
2253. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
2254. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
2255. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
2256. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
2257. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
2258. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
2259. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
2260. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
2261. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
2262. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
2263. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
2264. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
2265. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
2266. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
2267. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
2268. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
2269. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
2270. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
2271. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
2272. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
2273. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
2274. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
2275. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
2276. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
2277. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
2278. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
2279. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
2280. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
2281. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
2282. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
2283. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
2284. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
2285. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
2286. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
2287. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
2288. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
2289. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
2290. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
2291. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
2292. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
2293. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
2294. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
2295. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
2296. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
2297. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
2298. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
2299. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
2300. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
2301. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
2302. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
2303. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
2304. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
2305. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
2306. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
2307. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
2308. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
2309. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
2310. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
2311. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
2312. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
2313. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
2314. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
2315. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
2316. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
2317. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
2318. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
2319. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
2320. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
2321. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
2322. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
2323. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
2324. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
2325. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
2326. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
2327. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
2328. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
2329. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
2330. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
2331. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
2332. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
2333. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
2334. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
2335. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
2336. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
2337. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
2338. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
2339. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
2340. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
2341. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
2342. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
2343. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
2344. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
2345. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
2346. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
2347. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
2348. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
2349. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
2350. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
2351. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
2352. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
2353. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
2354. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
2355. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
2356. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
2357. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
2358. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
2359. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
2360. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
2361. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
2362. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
2363. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
2364. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
2365. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
2366. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
2367. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
2368. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
2369. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
2370. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
2371. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
2372. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
2373. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
2374. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
2375. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
2376. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
2377. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
2378. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
2379. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
2380. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
2381. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
2382. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
2383. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
2384. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
2385. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
2386. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
2387. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
2388. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
2389. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
2390. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
2391. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
2392. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
2393. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
2394. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
2395. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
2396. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
2397. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
2398. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
2399. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
2400. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
2401. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
2402. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
2403. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
2404. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
2405. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
2406. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
2407. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
2408. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
2409. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
2410. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
2411. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
2412. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
2413. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
2414. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
2415. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
2416. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
2417. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
2418. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
2419. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
2420. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
2421. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
2422. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
2423. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
2424. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
2425. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
2426. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
2427. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
2428. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
2429. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
2430. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
2431. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
2432. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
2433. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
2434. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
2435. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
2436. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
2437. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
2438. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
2439. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
2440. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
2441. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
2442. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
2443. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
2444. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
2445. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
2446. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
2447. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
2448. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
2449. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
2450. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
2451. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
2452. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
2453. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
2454. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
2455. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
2456. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
2457. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
2458. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
2459. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
2460. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
2461. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
2462. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
2463. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
2464. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
2465. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
2466. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
2467. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
2468. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
2469. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
2470. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
2471. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
2472. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
2473. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
2474. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
2475. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
2476. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
2477. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
2478. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
2479. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
2480. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
2481. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
2482. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
2483. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
2484. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
2485. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
2486. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
2487. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
2488. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
2489. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
2490. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
2491. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
2492. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
2493. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
2494. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
2495. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
2496. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
2497. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
2498. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
2499. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
2500. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
2501. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
2502. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
2503. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
2504. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
2505. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
2506. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
2507. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
2508. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
2509. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
2510. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
2511. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
2512. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
2513. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
2514. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
2515. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
2516. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
2517. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
2518. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
2519. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
2520. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
2521. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
2522. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
2523. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
2524. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
2525. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
2526. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
2527. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
2528. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
2529. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
2530. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
2531. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
2532. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
2533. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
2534. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
2535. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
2536. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
2537. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
2538. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
2539. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
2540. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
2541. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
2542. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
2543. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
2544. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
2545. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
2546. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
2547. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
2548. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
2549. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
2550. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
2551. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
2552. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
2553. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
2554. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
2555. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
2556. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
2557. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
2558. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
2559. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
2560. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
2561. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
2562. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
2563. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
2564. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
2565. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
2566. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
2567. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
2568. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
2569. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
2570. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
2571. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
2572. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
2573. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
2574. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
2575. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
2576. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
2577. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
2578. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
2579. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
2580. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
2581. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
2582. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
2583. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
2584. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
2585. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
2586. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
2587. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
2588. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
2589. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
2590. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
2591. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
2592. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
2593. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
2594. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
2595. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
2596. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
2597. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
2598. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
2599. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
2600. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
2601. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
2602. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
2603. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
2604. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
2605. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
2606. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
2607. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
2608. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
2609. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
2610. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
2611. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
2612. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
2613. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
2614. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
2615. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
2616. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
2617. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
2618. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
2619. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
2620. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
2621. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
2622. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
2623. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
2624. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
2625. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
2626. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
2627. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
2628. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
2629. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
2630. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
2631. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
2632. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
2633. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
2634. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
2635. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
2636. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
2637. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
2638. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
2639. gbpri1.seq - Primate sequence entries, part 1.
2640. gbpri10.seq - Primate sequence entries, part 10.
2641. gbpri11.seq - Primate sequence entries, part 11.
2642. gbpri12.seq - Primate sequence entries, part 12.
2643. gbpri13.seq - Primate sequence entries, part 13.
2644. gbpri14.seq - Primate sequence entries, part 14.
2645. gbpri15.seq - Primate sequence entries, part 15.
2646. gbpri16.seq - Primate sequence entries, part 16.
2647. gbpri17.seq - Primate sequence entries, part 17.
2648. gbpri18.seq - Primate sequence entries, part 18.
2649. gbpri19.seq - Primate sequence entries, part 19.
2650. gbpri2.seq - Primate sequence entries, part 2.
2651. gbpri20.seq - Primate sequence entries, part 20.
2652. gbpri21.seq - Primate sequence entries, part 21.
2653. gbpri22.seq - Primate sequence entries, part 22.
2654. gbpri23.seq - Primate sequence entries, part 23.
2655. gbpri24.seq - Primate sequence entries, part 24.
2656. gbpri25.seq - Primate sequence entries, part 25.
2657. gbpri26.seq - Primate sequence entries, part 26.
2658. gbpri27.seq - Primate sequence entries, part 27.
2659. gbpri28.seq - Primate sequence entries, part 28.
2660. gbpri29.seq - Primate sequence entries, part 29.
2661. gbpri3.seq - Primate sequence entries, part 3.
2662. gbpri30.seq - Primate sequence entries, part 30.
2663. gbpri31.seq - Primate sequence entries, part 31.
2664. gbpri32.seq - Primate sequence entries, part 32.
2665. gbpri33.seq - Primate sequence entries, part 33.
2666. gbpri34.seq - Primate sequence entries, part 34.
2667. gbpri35.seq - Primate sequence entries, part 35.
2668. gbpri4.seq - Primate sequence entries, part 4.
2669. gbpri5.seq - Primate sequence entries, part 5.
2670. gbpri6.seq - Primate sequence entries, part 6.
2671. gbpri7.seq - Primate sequence entries, part 7.
2672. gbpri8.seq - Primate sequence entries, part 8.
2673. gbpri9.seq - Primate sequence entries, part 9.
2674. gbrel.txt - Release notes (this document).
2675. gbrod1.seq - Rodent sequence entries, part 1.
2676. gbrod10.seq - Rodent sequence entries, part 10.
2677. gbrod11.seq - Rodent sequence entries, part 11.
2678. gbrod12.seq - Rodent sequence entries, part 12.
2679. gbrod13.seq - Rodent sequence entries, part 13.
2680. gbrod14.seq - Rodent sequence entries, part 14.
2681. gbrod15.seq - Rodent sequence entries, part 15.
2682. gbrod16.seq - Rodent sequence entries, part 16.
2683. gbrod17.seq - Rodent sequence entries, part 17.
2684. gbrod18.seq - Rodent sequence entries, part 18.
2685. gbrod19.seq - Rodent sequence entries, part 19.
2686. gbrod2.seq - Rodent sequence entries, part 2.
2687. gbrod20.seq - Rodent sequence entries, part 20.
2688. gbrod21.seq - Rodent sequence entries, part 21.
2689. gbrod22.seq - Rodent sequence entries, part 22.
2690. gbrod23.seq - Rodent sequence entries, part 23.
2691. gbrod24.seq - Rodent sequence entries, part 24.
2692. gbrod25.seq - Rodent sequence entries, part 25.
2693. gbrod26.seq - Rodent sequence entries, part 26.
2694. gbrod27.seq - Rodent sequence entries, part 27.
2695. gbrod28.seq - Rodent sequence entries, part 28.
2696. gbrod29.seq - Rodent sequence entries, part 29.
2697. gbrod3.seq - Rodent sequence entries, part 3.
2698. gbrod30.seq - Rodent sequence entries, part 30.
2699. gbrod31.seq - Rodent sequence entries, part 31.
2700. gbrod32.seq - Rodent sequence entries, part 32.
2701. gbrod33.seq - Rodent sequence entries, part 33.
2702. gbrod34.seq - Rodent sequence entries, part 34.
2703. gbrod35.seq - Rodent sequence entries, part 35.
2704. gbrod36.seq - Rodent sequence entries, part 36.
2705. gbrod37.seq - Rodent sequence entries, part 37.
2706. gbrod38.seq - Rodent sequence entries, part 38.
2707. gbrod39.seq - Rodent sequence entries, part 39.
2708. gbrod4.seq - Rodent sequence entries, part 4.
2709. gbrod40.seq - Rodent sequence entries, part 40.
2710. gbrod41.seq - Rodent sequence entries, part 41.
2711. gbrod5.seq - Rodent sequence entries, part 5.
2712. gbrod6.seq - Rodent sequence entries, part 6.
2713. gbrod7.seq - Rodent sequence entries, part 7.
2714. gbrod8.seq - Rodent sequence entries, part 8.
2715. gbrod9.seq - Rodent sequence entries, part 9.
2716. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
2717. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
2718. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
2719. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
2720. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
2721. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
2722. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
2723. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
2724. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
2725. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
2726. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
2727. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
2728. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
2729. gbsyn11.seq - Synthetic and chimeric sequence entries, part 11.
2730. gbsyn12.seq - Synthetic and chimeric sequence entries, part 12.
2731. gbsyn13.seq - Synthetic and chimeric sequence entries, part 13.
2732. gbsyn14.seq - Synthetic and chimeric sequence entries, part 14.
2733. gbsyn15.seq - Synthetic and chimeric sequence entries, part 15.
2734. gbsyn16.seq - Synthetic and chimeric sequence entries, part 16.
2735. gbsyn17.seq - Synthetic and chimeric sequence entries, part 17.
2736. gbsyn18.seq - Synthetic and chimeric sequence entries, part 18.
2737. gbsyn19.seq - Synthetic and chimeric sequence entries, part 19.
2738. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
2739. gbsyn20.seq - Synthetic and chimeric sequence entries, part 20.
2740. gbsyn21.seq - Synthetic and chimeric sequence entries, part 21.
2741. gbsyn22.seq - Synthetic and chimeric sequence entries, part 22.
2742. gbsyn23.seq - Synthetic and chimeric sequence entries, part 23.
2743. gbsyn24.seq - Synthetic and chimeric sequence entries, part 24.
2744. gbsyn25.seq - Synthetic and chimeric sequence entries, part 25.
2745. gbsyn26.seq - Synthetic and chimeric sequence entries, part 26.
2746. gbsyn27.seq - Synthetic and chimeric sequence entries, part 27.
2747. gbsyn28.seq - Synthetic and chimeric sequence entries, part 28.
2748. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
2749. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
2750. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
2751. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
2752. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
2753. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
2754. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
2755. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
2756. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
2757. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
2758. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
2759. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
2760. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
2761. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
2762. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
2763. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
2764. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
2765. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
2766. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
2767. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
2768. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
2769. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
2770. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
2771. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
2772. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
2773. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
2774. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
2775. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
2776. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
2777. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
2778. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
2779. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
2780. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
2781. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
2782. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
2783. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
2784. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
2785. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
2786. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
2787. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
2788. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
2789. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
2790. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
2791. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
2792. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
2793. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
2794. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
2795. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
2796. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
2797. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
2798. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
2799. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
2800. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
2801. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
2802. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
2803. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
2804. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
2805. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
2806. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
2807. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
2808. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
2809. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
2810. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
2811. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
2812. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
2813. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
2814. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
2815. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
2816. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
2817. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
2818. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
2819. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
2820. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
2821. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
2822. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
2823. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
2824. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
2825. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
2826. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
2827. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
2828. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
2829. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
2830. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
2831. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
2832. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
2833. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
2834. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
2835. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
2836. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
2837. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
2838. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
2839. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
2840. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
2841. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
2842. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
2843. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
2844. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
2845. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
2846. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
2847. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
2848. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
2849. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
2850. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
2851. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
2852. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
2853. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
2854. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
2855. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
2856. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
2857. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
2858. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
2859. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
2860. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
2861. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
2862. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
2863. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
2864. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
2865. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
2866. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
2867. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
2868. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
2869. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
2870. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
2871. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
2872. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
2873. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
2874. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
2875. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
2876. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
2877. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
2878. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
2879. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
2880. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
2881. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
2882. gbuna1.seq - Unannotated sequence entries, part 1.
2883. gbvrl1.seq - Viral sequence entries, part 1.
2884. gbvrl10.seq - Viral sequence entries, part 10.
2885. gbvrl11.seq - Viral sequence entries, part 11.
2886. gbvrl12.seq - Viral sequence entries, part 12.
2887. gbvrl13.seq - Viral sequence entries, part 13.
2888. gbvrl14.seq - Viral sequence entries, part 14.
2889. gbvrl15.seq - Viral sequence entries, part 15.
2890. gbvrl16.seq - Viral sequence entries, part 16.
2891. gbvrl17.seq - Viral sequence entries, part 17.
2892. gbvrl18.seq - Viral sequence entries, part 18.
2893. gbvrl19.seq - Viral sequence entries, part 19.
2894. gbvrl2.seq - Viral sequence entries, part 2.
2895. gbvrl20.seq - Viral sequence entries, part 20.
2896. gbvrl21.seq - Viral sequence entries, part 21.
2897. gbvrl22.seq - Viral sequence entries, part 22.
2898. gbvrl23.seq - Viral sequence entries, part 23.
2899. gbvrl24.seq - Viral sequence entries, part 24.
2900. gbvrl25.seq - Viral sequence entries, part 25.
2901. gbvrl26.seq - Viral sequence entries, part 26.
2902. gbvrl27.seq - Viral sequence entries, part 27.
2903. gbvrl28.seq - Viral sequence entries, part 28.
2904. gbvrl29.seq - Viral sequence entries, part 29.
2905. gbvrl3.seq - Viral sequence entries, part 3.
2906. gbvrl30.seq - Viral sequence entries, part 30.
2907. gbvrl31.seq - Viral sequence entries, part 31.
2908. gbvrl32.seq - Viral sequence entries, part 32.
2909. gbvrl33.seq - Viral sequence entries, part 33.
2910. gbvrl34.seq - Viral sequence entries, part 34.
2911. gbvrl35.seq - Viral sequence entries, part 35.
2912. gbvrl36.seq - Viral sequence entries, part 36.
2913. gbvrl37.seq - Viral sequence entries, part 37.
2914. gbvrl38.seq - Viral sequence entries, part 38.
2915. gbvrl39.seq - Viral sequence entries, part 39.
2916. gbvrl4.seq - Viral sequence entries, part 4.
2917. gbvrl5.seq - Viral sequence entries, part 5.
2918. gbvrl6.seq - Viral sequence entries, part 6.
2919. gbvrl7.seq - Viral sequence entries, part 7.
2920. gbvrl8.seq - Viral sequence entries, part 8.
2921. gbvrl9.seq - Viral sequence entries, part 9.
2922. gbvrt1.seq - Other vertebrate sequence entries, part 1.
2923. gbvrt10.seq - Other vertebrate sequence entries, part 10.
2924. gbvrt100.seq - Other vertebrate sequence entries, part 100.
2925. gbvrt101.seq - Other vertebrate sequence entries, part 101.
2926. gbvrt102.seq - Other vertebrate sequence entries, part 102.
2927. gbvrt103.seq - Other vertebrate sequence entries, part 103.
2928. gbvrt104.seq - Other vertebrate sequence entries, part 104.
2929. gbvrt105.seq - Other vertebrate sequence entries, part 105.
2930. gbvrt106.seq - Other vertebrate sequence entries, part 106.
2931. gbvrt107.seq - Other vertebrate sequence entries, part 107.
2932. gbvrt108.seq - Other vertebrate sequence entries, part 108.
2933. gbvrt109.seq - Other vertebrate sequence entries, part 109.
2934. gbvrt11.seq - Other vertebrate sequence entries, part 11.
2935. gbvrt110.seq - Other vertebrate sequence entries, part 110.
2936. gbvrt111.seq - Other vertebrate sequence entries, part 111.
2937. gbvrt112.seq - Other vertebrate sequence entries, part 112.
2938. gbvrt113.seq - Other vertebrate sequence entries, part 113.
2939. gbvrt114.seq - Other vertebrate sequence entries, part 114.
2940. gbvrt115.seq - Other vertebrate sequence entries, part 115.
2941. gbvrt116.seq - Other vertebrate sequence entries, part 116.
2942. gbvrt117.seq - Other vertebrate sequence entries, part 117.
2943. gbvrt118.seq - Other vertebrate sequence entries, part 118.
2944. gbvrt119.seq - Other vertebrate sequence entries, part 119.
2945. gbvrt12.seq - Other vertebrate sequence entries, part 12.
2946. gbvrt120.seq - Other vertebrate sequence entries, part 120.
2947. gbvrt121.seq - Other vertebrate sequence entries, part 121.
2948. gbvrt122.seq - Other vertebrate sequence entries, part 122.
2949. gbvrt123.seq - Other vertebrate sequence entries, part 123.
2950. gbvrt124.seq - Other vertebrate sequence entries, part 124.
2951. gbvrt125.seq - Other vertebrate sequence entries, part 125.
2952. gbvrt126.seq - Other vertebrate sequence entries, part 126.
2953. gbvrt127.seq - Other vertebrate sequence entries, part 127.
2954. gbvrt128.seq - Other vertebrate sequence entries, part 128.
2955. gbvrt129.seq - Other vertebrate sequence entries, part 129.
2956. gbvrt13.seq - Other vertebrate sequence entries, part 13.
2957. gbvrt130.seq - Other vertebrate sequence entries, part 130.
2958. gbvrt131.seq - Other vertebrate sequence entries, part 131.
2959. gbvrt132.seq - Other vertebrate sequence entries, part 132.
2960. gbvrt133.seq - Other vertebrate sequence entries, part 133.
2961. gbvrt134.seq - Other vertebrate sequence entries, part 134.
2962. gbvrt135.seq - Other vertebrate sequence entries, part 135.
2963. gbvrt136.seq - Other vertebrate sequence entries, part 136.
2964. gbvrt137.seq - Other vertebrate sequence entries, part 137.
2965. gbvrt138.seq - Other vertebrate sequence entries, part 138.
2966. gbvrt139.seq - Other vertebrate sequence entries, part 139.
2967. gbvrt14.seq - Other vertebrate sequence entries, part 14.
2968. gbvrt140.seq - Other vertebrate sequence entries, part 140.
2969. gbvrt141.seq - Other vertebrate sequence entries, part 141.
2970. gbvrt142.seq - Other vertebrate sequence entries, part 142.
2971. gbvrt143.seq - Other vertebrate sequence entries, part 143.
2972. gbvrt144.seq - Other vertebrate sequence entries, part 144.
2973. gbvrt145.seq - Other vertebrate sequence entries, part 145.
2974. gbvrt146.seq - Other vertebrate sequence entries, part 146.
2975. gbvrt147.seq - Other vertebrate sequence entries, part 147.
2976. gbvrt148.seq - Other vertebrate sequence entries, part 148.
2977. gbvrt149.seq - Other vertebrate sequence entries, part 149.
2978. gbvrt15.seq - Other vertebrate sequence entries, part 15.
2979. gbvrt150.seq - Other vertebrate sequence entries, part 150.
2980. gbvrt151.seq - Other vertebrate sequence entries, part 151.
2981. gbvrt152.seq - Other vertebrate sequence entries, part 152.
2982. gbvrt153.seq - Other vertebrate sequence entries, part 153.
2983. gbvrt154.seq - Other vertebrate sequence entries, part 154.
2984. gbvrt155.seq - Other vertebrate sequence entries, part 155.
2985. gbvrt156.seq - Other vertebrate sequence entries, part 156.
2986. gbvrt157.seq - Other vertebrate sequence entries, part 157.
2987. gbvrt158.seq - Other vertebrate sequence entries, part 158.
2988. gbvrt159.seq - Other vertebrate sequence entries, part 159.
2989. gbvrt16.seq - Other vertebrate sequence entries, part 16.
2990. gbvrt160.seq - Other vertebrate sequence entries, part 160.
2991. gbvrt161.seq - Other vertebrate sequence entries, part 161.
2992. gbvrt162.seq - Other vertebrate sequence entries, part 162.
2993. gbvrt163.seq - Other vertebrate sequence entries, part 163.
2994. gbvrt164.seq - Other vertebrate sequence entries, part 164.
2995. gbvrt165.seq - Other vertebrate sequence entries, part 165.
2996. gbvrt166.seq - Other vertebrate sequence entries, part 166.
2997. gbvrt167.seq - Other vertebrate sequence entries, part 167.
2998. gbvrt168.seq - Other vertebrate sequence entries, part 168.
2999. gbvrt169.seq - Other vertebrate sequence entries, part 169.
3000. gbvrt17.seq - Other vertebrate sequence entries, part 17.
3001. gbvrt170.seq - Other vertebrate sequence entries, part 170.
3002. gbvrt171.seq - Other vertebrate sequence entries, part 171.
3003. gbvrt172.seq - Other vertebrate sequence entries, part 172.
3004. gbvrt173.seq - Other vertebrate sequence entries, part 173.
3005. gbvrt174.seq - Other vertebrate sequence entries, part 174.
3006. gbvrt175.seq - Other vertebrate sequence entries, part 175.
3007. gbvrt176.seq - Other vertebrate sequence entries, part 176.
3008. gbvrt177.seq - Other vertebrate sequence entries, part 177.
3009. gbvrt178.seq - Other vertebrate sequence entries, part 178.
3010. gbvrt179.seq - Other vertebrate sequence entries, part 179.
3011. gbvrt18.seq - Other vertebrate sequence entries, part 18.
3012. gbvrt180.seq - Other vertebrate sequence entries, part 180.
3013. gbvrt181.seq - Other vertebrate sequence entries, part 181.
3014. gbvrt182.seq - Other vertebrate sequence entries, part 182.
3015. gbvrt183.seq - Other vertebrate sequence entries, part 183.
3016. gbvrt184.seq - Other vertebrate sequence entries, part 184.
3017. gbvrt185.seq - Other vertebrate sequence entries, part 185.
3018. gbvrt186.seq - Other vertebrate sequence entries, part 186.
3019. gbvrt187.seq - Other vertebrate sequence entries, part 187.
3020. gbvrt188.seq - Other vertebrate sequence entries, part 188.
3021. gbvrt189.seq - Other vertebrate sequence entries, part 189.
3022. gbvrt19.seq - Other vertebrate sequence entries, part 19.
3023. gbvrt190.seq - Other vertebrate sequence entries, part 190.
3024. gbvrt191.seq - Other vertebrate sequence entries, part 191.
3025. gbvrt192.seq - Other vertebrate sequence entries, part 192.
3026. gbvrt193.seq - Other vertebrate sequence entries, part 193.
3027. gbvrt194.seq - Other vertebrate sequence entries, part 194.
3028. gbvrt195.seq - Other vertebrate sequence entries, part 195.
3029. gbvrt196.seq - Other vertebrate sequence entries, part 196.
3030. gbvrt197.seq - Other vertebrate sequence entries, part 197.
3031. gbvrt198.seq - Other vertebrate sequence entries, part 198.
3032. gbvrt199.seq - Other vertebrate sequence entries, part 199.
3033. gbvrt2.seq - Other vertebrate sequence entries, part 2.
3034. gbvrt20.seq - Other vertebrate sequence entries, part 20.
3035. gbvrt200.seq - Other vertebrate sequence entries, part 200.
3036. gbvrt201.seq - Other vertebrate sequence entries, part 201.
3037. gbvrt202.seq - Other vertebrate sequence entries, part 202.
3038. gbvrt203.seq - Other vertebrate sequence entries, part 203.
3039. gbvrt204.seq - Other vertebrate sequence entries, part 204.
3040. gbvrt205.seq - Other vertebrate sequence entries, part 205.
3041. gbvrt206.seq - Other vertebrate sequence entries, part 206.
3042. gbvrt207.seq - Other vertebrate sequence entries, part 207.
3043. gbvrt208.seq - Other vertebrate sequence entries, part 208.
3044. gbvrt209.seq - Other vertebrate sequence entries, part 209.
3045. gbvrt21.seq - Other vertebrate sequence entries, part 21.
3046. gbvrt210.seq - Other vertebrate sequence entries, part 210.
3047. gbvrt22.seq - Other vertebrate sequence entries, part 22.
3048. gbvrt23.seq - Other vertebrate sequence entries, part 23.
3049. gbvrt24.seq - Other vertebrate sequence entries, part 24.
3050. gbvrt25.seq - Other vertebrate sequence entries, part 25.
3051. gbvrt26.seq - Other vertebrate sequence entries, part 26.
3052. gbvrt27.seq - Other vertebrate sequence entries, part 27.
3053. gbvrt28.seq - Other vertebrate sequence entries, part 28.
3054. gbvrt29.seq - Other vertebrate sequence entries, part 29.
3055. gbvrt3.seq - Other vertebrate sequence entries, part 3.
3056. gbvrt30.seq - Other vertebrate sequence entries, part 30.
3057. gbvrt31.seq - Other vertebrate sequence entries, part 31.
3058. gbvrt32.seq - Other vertebrate sequence entries, part 32.
3059. gbvrt33.seq - Other vertebrate sequence entries, part 33.
3060. gbvrt34.seq - Other vertebrate sequence entries, part 34.
3061. gbvrt35.seq - Other vertebrate sequence entries, part 35.
3062. gbvrt36.seq - Other vertebrate sequence entries, part 36.
3063. gbvrt37.seq - Other vertebrate sequence entries, part 37.
3064. gbvrt38.seq - Other vertebrate sequence entries, part 38.
3065. gbvrt39.seq - Other vertebrate sequence entries, part 39.
3066. gbvrt4.seq - Other vertebrate sequence entries, part 4.
3067. gbvrt40.seq - Other vertebrate sequence entries, part 40.
3068. gbvrt41.seq - Other vertebrate sequence entries, part 41.
3069. gbvrt42.seq - Other vertebrate sequence entries, part 42.
3070. gbvrt43.seq - Other vertebrate sequence entries, part 43.
3071. gbvrt44.seq - Other vertebrate sequence entries, part 44.
3072. gbvrt45.seq - Other vertebrate sequence entries, part 45.
3073. gbvrt46.seq - Other vertebrate sequence entries, part 46.
3074. gbvrt47.seq - Other vertebrate sequence entries, part 47.
3075. gbvrt48.seq - Other vertebrate sequence entries, part 48.
3076. gbvrt49.seq - Other vertebrate sequence entries, part 49.
3077. gbvrt5.seq - Other vertebrate sequence entries, part 5.
3078. gbvrt50.seq - Other vertebrate sequence entries, part 50.
3079. gbvrt51.seq - Other vertebrate sequence entries, part 51.
3080. gbvrt52.seq - Other vertebrate sequence entries, part 52.
3081. gbvrt53.seq - Other vertebrate sequence entries, part 53.
3082. gbvrt54.seq - Other vertebrate sequence entries, part 54.
3083. gbvrt55.seq - Other vertebrate sequence entries, part 55.
3084. gbvrt56.seq - Other vertebrate sequence entries, part 56.
3085. gbvrt57.seq - Other vertebrate sequence entries, part 57.
3086. gbvrt58.seq - Other vertebrate sequence entries, part 58.
3087. gbvrt59.seq - Other vertebrate sequence entries, part 59.
3088. gbvrt6.seq - Other vertebrate sequence entries, part 6.
3089. gbvrt60.seq - Other vertebrate sequence entries, part 60.
3090. gbvrt61.seq - Other vertebrate sequence entries, part 61.
3091. gbvrt62.seq - Other vertebrate sequence entries, part 62.
3092. gbvrt63.seq - Other vertebrate sequence entries, part 63.
3093. gbvrt64.seq - Other vertebrate sequence entries, part 64.
3094. gbvrt65.seq - Other vertebrate sequence entries, part 65.
3095. gbvrt66.seq - Other vertebrate sequence entries, part 66.
3096. gbvrt67.seq - Other vertebrate sequence entries, part 67.
3097. gbvrt68.seq - Other vertebrate sequence entries, part 68.
3098. gbvrt69.seq - Other vertebrate sequence entries, part 69.
3099. gbvrt7.seq - Other vertebrate sequence entries, part 7.
3100. gbvrt70.seq - Other vertebrate sequence entries, part 70.
3101. gbvrt71.seq - Other vertebrate sequence entries, part 71.
3102. gbvrt72.seq - Other vertebrate sequence entries, part 72.
3103. gbvrt73.seq - Other vertebrate sequence entries, part 73.
3104. gbvrt74.seq - Other vertebrate sequence entries, part 74.
3105. gbvrt75.seq - Other vertebrate sequence entries, part 75.
3106. gbvrt76.seq - Other vertebrate sequence entries, part 76.
3107. gbvrt77.seq - Other vertebrate sequence entries, part 77.
3108. gbvrt78.seq - Other vertebrate sequence entries, part 78.
3109. gbvrt79.seq - Other vertebrate sequence entries, part 79.
3110. gbvrt8.seq - Other vertebrate sequence entries, part 8.
3111. gbvrt80.seq - Other vertebrate sequence entries, part 80.
3112. gbvrt81.seq - Other vertebrate sequence entries, part 81.
3113. gbvrt82.seq - Other vertebrate sequence entries, part 82.
3114. gbvrt83.seq - Other vertebrate sequence entries, part 83.
3115. gbvrt84.seq - Other vertebrate sequence entries, part 84.
3116. gbvrt85.seq - Other vertebrate sequence entries, part 85.
3117. gbvrt86.seq - Other vertebrate sequence entries, part 86.
3118. gbvrt87.seq - Other vertebrate sequence entries, part 87.
3119. gbvrt88.seq - Other vertebrate sequence entries, part 88.
3120. gbvrt89.seq - Other vertebrate sequence entries, part 89.
3121. gbvrt9.seq - Other vertebrate sequence entries, part 9.
3122. gbvrt90.seq - Other vertebrate sequence entries, part 90.
3123. gbvrt91.seq - Other vertebrate sequence entries, part 91.
3124. gbvrt92.seq - Other vertebrate sequence entries, part 92.
3125. gbvrt93.seq - Other vertebrate sequence entries, part 93.
3126. gbvrt94.seq - Other vertebrate sequence entries, part 94.
3127. gbvrt95.seq - Other vertebrate sequence entries, part 95.
3128. gbvrt96.seq - Other vertebrate sequence entries, part 96.
3129. gbvrt97.seq - Other vertebrate sequence entries, part 97.
3130. gbvrt98.seq - Other vertebrate sequence entries, part 98.
3131. gbvrt99.seq - Other vertebrate sequence entries, part 99.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 239.0 flatfiles require roughly 1461 GB, including the sequence files and the *.txt files.
The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
498949443 gbbct1.seq
487478174 gbbct10.seq
491068996 gbbct100.seq
195549944 gbbct101.seq
494137426 gbbct102.seq
492528796 gbbct103.seq
493221786 gbbct104.seq
496768213 gbbct105.seq
99480351 gbbct106.seq
499009965 gbbct107.seq
494100520 gbbct108.seq
498830034 gbbct109.seq
499351621 gbbct11.seq
333064193 gbbct110.seq
499522594 gbbct111.seq
493011295 gbbct112.seq
496289356 gbbct113.seq
426871432 gbbct114.seq
491212948 gbbct115.seq
492365944 gbbct116.seq
487517363 gbbct117.seq
496457156 gbbct118.seq
497685816 gbbct119.seq
488016927 gbbct12.seq
497784109 gbbct120.seq
379148263 gbbct121.seq
498287206 gbbct122.seq
489447997 gbbct123.seq
499733988 gbbct124.seq
461301794 gbbct125.seq
495776214 gbbct126.seq
493829149 gbbct127.seq
491368404 gbbct128.seq
498684861 gbbct129.seq
499887127 gbbct13.seq
499805912 gbbct130.seq
147978654 gbbct131.seq
496895924 gbbct132.seq
497684582 gbbct133.seq
499142466 gbbct134.seq
497972016 gbbct135.seq
352908246 gbbct136.seq
489367146 gbbct137.seq
490446543 gbbct138.seq
498394290 gbbct139.seq
499212865 gbbct14.seq
497203431 gbbct140.seq
492635253 gbbct141.seq
341075271 gbbct142.seq
497655665 gbbct143.seq
494966385 gbbct144.seq
496738569 gbbct145.seq
489042425 gbbct146.seq
493286625 gbbct147.seq
496050609 gbbct148.seq
159717867 gbbct149.seq
496469503 gbbct15.seq
494733626 gbbct150.seq
491514689 gbbct151.seq
495159360 gbbct152.seq
463876007 gbbct153.seq
497456114 gbbct154.seq
493139085 gbbct155.seq
492197394 gbbct156.seq
490869904 gbbct157.seq
490321255 gbbct158.seq
497884161 gbbct159.seq
376884494 gbbct16.seq
498282277 gbbct160.seq
492406351 gbbct161.seq
148663232 gbbct162.seq
494475784 gbbct163.seq
492902112 gbbct164.seq
499251741 gbbct165.seq
260566716 gbbct166.seq
495003668 gbbct167.seq
495931464 gbbct168.seq
489789374 gbbct169.seq
499746227 gbbct17.seq
303707273 gbbct170.seq
499224696 gbbct171.seq
489058156 gbbct172.seq
490004787 gbbct173.seq
496107126 gbbct174.seq
22289657 gbbct175.seq
498035324 gbbct176.seq
499409844 gbbct177.seq
492694598 gbbct178.seq
499905118 gbbct179.seq
494194399 gbbct18.seq
498721047 gbbct180.seq
180648099 gbbct181.seq
497820665 gbbct182.seq
496360795 gbbct183.seq
494749437 gbbct184.seq
499579670 gbbct185.seq
265632471 gbbct186.seq
499905831 gbbct187.seq
492390539 gbbct188.seq
499395248 gbbct189.seq
495386303 gbbct19.seq
490188833 gbbct190.seq
176738759 gbbct191.seq
489278103 gbbct192.seq
499568079 gbbct193.seq
499217693 gbbct194.seq
498329750 gbbct195.seq
379026306 gbbct196.seq
499899946 gbbct197.seq
496011230 gbbct198.seq
481292016 gbbct199.seq
496416169 gbbct2.seq
498712165 gbbct20.seq
496168462 gbbct200.seq
495261898 gbbct201.seq
499945625 gbbct202.seq
304211470 gbbct203.seq
496984804 gbbct204.seq
497245516 gbbct205.seq
489436409 gbbct206.seq
372443863 gbbct207.seq
484832177 gbbct208.seq
495645837 gbbct209.seq
495685576 gbbct21.seq
499614783 gbbct210.seq
498653455 gbbct211.seq
213706266 gbbct212.seq
493985626 gbbct213.seq
488857651 gbbct214.seq
489146308 gbbct215.seq
152936779 gbbct216.seq
493892096 gbbct217.seq
487708561 gbbct218.seq
498455372 gbbct219.seq
498176736 gbbct22.seq
496216347 gbbct220.seq
103775238 gbbct221.seq
494063240 gbbct222.seq
488280349 gbbct223.seq
499476642 gbbct224.seq
498178231 gbbct225.seq
96504269 gbbct226.seq
495740206 gbbct227.seq
491776345 gbbct228.seq
490482966 gbbct229.seq
491910885 gbbct23.seq
446055641 gbbct230.seq
492193681 gbbct231.seq
487559300 gbbct232.seq
492443394 gbbct233.seq
457216214 gbbct234.seq
499744106 gbbct235.seq
495907353 gbbct236.seq
492786242 gbbct237.seq
496300835 gbbct238.seq
499288941 gbbct239.seq
246939662 gbbct24.seq
14132066 gbbct240.seq
491982516 gbbct241.seq
486847254 gbbct242.seq
499561815 gbbct243.seq
404659693 gbbct244.seq
499502354 gbbct245.seq
499032642 gbbct246.seq
494132592 gbbct247.seq
424329524 gbbct248.seq
495808325 gbbct249.seq
21408193 gbbct25.seq
498958389 gbbct250.seq
497112543 gbbct251.seq
495439395 gbbct252.seq
482619875 gbbct253.seq
495617724 gbbct254.seq
16593817 gbbct255.seq
493493368 gbbct256.seq
498145182 gbbct257.seq
491623813 gbbct258.seq
491594683 gbbct259.seq
38649525 gbbct26.seq
499234504 gbbct260.seq
498013709 gbbct261.seq
499217709 gbbct262.seq
58859485 gbbct263.seq
497354916 gbbct264.seq
497226920 gbbct265.seq
493674802 gbbct266.seq
494448498 gbbct267.seq
499108392 gbbct268.seq
498098226 gbbct269.seq
499390065 gbbct27.seq
499126867 gbbct270.seq
123256983 gbbct271.seq
499727860 gbbct272.seq
493267703 gbbct273.seq
490343471 gbbct274.seq
492901598 gbbct275.seq
495067963 gbbct276.seq
488621837 gbbct277.seq
66832613 gbbct278.seq
486705522 gbbct279.seq
498625874 gbbct28.seq
497279950 gbbct280.seq
498742856 gbbct281.seq
495426278 gbbct282.seq
264258205 gbbct283.seq
498731908 gbbct284.seq
495863632 gbbct285.seq
496227091 gbbct286.seq
496935580 gbbct287.seq
387627374 gbbct288.seq
494855490 gbbct289.seq
493047306 gbbct29.seq
494740502 gbbct290.seq
499982432 gbbct291.seq
489768381 gbbct292.seq
413162427 gbbct293.seq
494879987 gbbct294.seq
491528958 gbbct295.seq
492752781 gbbct296.seq
491650013 gbbct297.seq
336767213 gbbct298.seq
491214825 gbbct299.seq
301364789 gbbct3.seq
498804260 gbbct30.seq
497114770 gbbct300.seq
497051312 gbbct301.seq
493791630 gbbct302.seq
424901308 gbbct303.seq
494829568 gbbct304.seq
491495122 gbbct305.seq
485518815 gbbct306.seq
495592396 gbbct307.seq
495460349 gbbct308.seq
498462541 gbbct309.seq
140148095 gbbct31.seq
496181745 gbbct310.seq
78411705 gbbct311.seq
490874319 gbbct312.seq
499740524 gbbct313.seq
496454686 gbbct314.seq
492019128 gbbct315.seq
499392031 gbbct316.seq
495303413 gbbct317.seq
496879304 gbbct318.seq
143908946 gbbct319.seq
495707202 gbbct32.seq
488779373 gbbct320.seq
494979232 gbbct321.seq
489005120 gbbct322.seq
499380134 gbbct323.seq
494013007 gbbct324.seq
498398828 gbbct325.seq
81501633 gbbct326.seq
493899719 gbbct327.seq
496565059 gbbct328.seq
494560328 gbbct329.seq
495625627 gbbct33.seq
495073137 gbbct330.seq
282613581 gbbct331.seq
492044163 gbbct332.seq
496057328 gbbct333.seq
499884457 gbbct334.seq
498197120 gbbct335.seq
463450477 gbbct336.seq
493680175 gbbct337.seq
494940242 gbbct338.seq
492553994 gbbct339.seq
493145663 gbbct34.seq
489586783 gbbct340.seq
498298775 gbbct341.seq
499134836 gbbct342.seq
498578458 gbbct343.seq
300806462 gbbct344.seq
495611618 gbbct345.seq
495153474 gbbct346.seq
497859952 gbbct347.seq
495859228 gbbct348.seq
491405097 gbbct349.seq
488228624 gbbct35.seq
50754912 gbbct350.seq
494895397 gbbct351.seq
495161436 gbbct352.seq
486869169 gbbct353.seq
498812165 gbbct354.seq
495032120 gbbct355.seq
318418799 gbbct356.seq
498785490 gbbct357.seq
494743391 gbbct358.seq
492786620 gbbct359.seq
498591594 gbbct36.seq
490756568 gbbct360.seq
332022177 gbbct361.seq
489859458 gbbct362.seq
496879607 gbbct363.seq
496551783 gbbct364.seq
498616413 gbbct365.seq
471839926 gbbct366.seq
498140628 gbbct367.seq
497295502 gbbct368.seq
498077632 gbbct369.seq
498295805 gbbct37.seq
499167551 gbbct370.seq
490419839 gbbct371.seq
50927915 gbbct372.seq
497854228 gbbct373.seq
497513512 gbbct374.seq
495161980 gbbct375.seq
499997906 gbbct376.seq
492100675 gbbct377.seq
238916601 gbbct378.seq
484394876 gbbct379.seq
102627464 gbbct38.seq
496320070 gbbct380.seq
498874502 gbbct381.seq
491774763 gbbct382.seq
495783963 gbbct383.seq
499668135 gbbct384.seq
477809566 gbbct385.seq
495578501 gbbct386.seq
490707518 gbbct387.seq
493403128 gbbct388.seq
489137335 gbbct389.seq
498942355 gbbct39.seq
435090014 gbbct390.seq
493426836 gbbct391.seq
489698714 gbbct392.seq
494164933 gbbct393.seq
499178077 gbbct394.seq
230182971 gbbct395.seq
498827274 gbbct396.seq
493656734 gbbct397.seq
491685311 gbbct398.seq
498202437 gbbct399.seq
394497147 gbbct4.seq
483799862 gbbct40.seq
147620415 gbbct400.seq
498406058 gbbct401.seq
499977312 gbbct402.seq
481335256 gbbct403.seq
488803428 gbbct404.seq
181857203 gbbct405.seq
494893466 gbbct406.seq
489261114 gbbct407.seq
495726841 gbbct408.seq
498587532 gbbct409.seq
492232330 gbbct41.seq
490644479 gbbct410.seq
494649401 gbbct411.seq
488323919 gbbct412.seq
497533445 gbbct413.seq
493548787 gbbct414.seq
499403246 gbbct415.seq
490775893 gbbct416.seq
457647469 gbbct417.seq
494298014 gbbct418.seq
493347926 gbbct419.seq
498378917 gbbct42.seq
495411922 gbbct420.seq
498312428 gbbct421.seq
492427472 gbbct422.seq
493237702 gbbct423.seq
492636263 gbbct424.seq
496653730 gbbct425.seq
275162438 gbbct426.seq
305794261 gbbct427.seq
6886746 gbbct428.seq
14159090 gbbct429.seq
495960835 gbbct43.seq
22776391 gbbct430.seq
44463765 gbbct431.seq
86548834 gbbct432.seq
168401312 gbbct433.seq
499998770 gbbct434.seq
492340412 gbbct435.seq
499469440 gbbct436.seq
499997951 gbbct437.seq
498771184 gbbct438.seq
499999221 gbbct439.seq
487879706 gbbct44.seq
492564182 gbbct440.seq
499998185 gbbct441.seq
476381373 gbbct442.seq
499997945 gbbct443.seq
289802652 gbbct444.seq
499998742 gbbct445.seq
84872049 gbbct446.seq
499689744 gbbct447.seq
124299558 gbbct448.seq
499999386 gbbct449.seq
497649566 gbbct45.seq
42811626 gbbct450.seq
145746248 gbbct451.seq
499416214 gbbct452.seq
451491773 gbbct453.seq
497084393 gbbct454.seq
489910522 gbbct455.seq
493642987 gbbct456.seq
496613467 gbbct457.seq
496664926 gbbct458.seq
491553811 gbbct459.seq
491269915 gbbct46.seq
291905631 gbbct460.seq
495496488 gbbct461.seq
498011253 gbbct462.seq
496221750 gbbct463.seq
163415399 gbbct464.seq
483003580 gbbct465.seq
497981383 gbbct466.seq
499759169 gbbct467.seq
498148265 gbbct468.seq
490919210 gbbct469.seq
495406523 gbbct47.seq
496057823 gbbct470.seq
13902612 gbbct471.seq
496306948 gbbct472.seq
497541934 gbbct473.seq
499014524 gbbct474.seq
243467607 gbbct475.seq
492621001 gbbct476.seq
496920774 gbbct477.seq
498725954 gbbct478.seq
498556226 gbbct479.seq
497177991 gbbct48.seq
105680564 gbbct480.seq
496365996 gbbct481.seq
489822962 gbbct482.seq
498841642 gbbct483.seq
448554608 gbbct484.seq
51155141 gbbct485.seq
107588054 gbbct486.seq
500000208 gbbct487.seq
499998482 gbbct488.seq
499866129 gbbct489.seq
499945930 gbbct49.seq
139690791 gbbct490.seq
459505412 gbbct5.seq
493025428 gbbct50.seq
218993378 gbbct51.seq
498095953 gbbct52.seq
499071223 gbbct53.seq
496563592 gbbct54.seq
497566393 gbbct55.seq
499752466 gbbct56.seq
490382215 gbbct57.seq
257412828 gbbct58.seq
499969240 gbbct59.seq
102226345 gbbct6.seq
495193534 gbbct60.seq
486286874 gbbct61.seq
493006700 gbbct62.seq
475857375 gbbct63.seq
490137947 gbbct64.seq
485837721 gbbct65.seq
497986020 gbbct66.seq
491275614 gbbct67.seq
306897153 gbbct68.seq
491474028 gbbct69.seq
282430356 gbbct7.seq
494313903 gbbct70.seq
495819854 gbbct71.seq
498720135 gbbct72.seq
499103370 gbbct73.seq
261686730 gbbct74.seq
498130877 gbbct75.seq
499517858 gbbct76.seq
498962272 gbbct77.seq
488107655 gbbct78.seq
397950576 gbbct79.seq
493056792 gbbct8.seq
498259014 gbbct80.seq
496895894 gbbct81.seq
497193254 gbbct82.seq
290985790 gbbct83.seq
499885449 gbbct84.seq
495464406 gbbct85.seq
496856504 gbbct86.seq
74937857 gbbct87.seq
489628390 gbbct88.seq
498992614 gbbct89.seq
497849166 gbbct9.seq
499931721 gbbct90.seq
389027426 gbbct91.seq
499874268 gbbct92.seq
498124187 gbbct93.seq
499291582 gbbct94.seq
491407782 gbbct95.seq
13752575 gbbct96.seq
493588275 gbbct97.seq
494745394 gbbct98.seq
495416151 gbbct99.seq
1257070 gbchg.txt
499855594 gbcon1.seq
498554356 gbcon10.seq
499971686 gbcon100.seq
499736073 gbcon101.seq
499841277 gbcon102.seq
499997197 gbcon103.seq
260691384 gbcon104.seq
499972783 gbcon105.seq
499998542 gbcon106.seq
429361467 gbcon107.seq
499998941 gbcon108.seq
499999754 gbcon109.seq
496554615 gbcon11.seq
165551990 gbcon110.seq
499998975 gbcon111.seq
499999873 gbcon112.seq
499962219 gbcon113.seq
293729666 gbcon114.seq
499999876 gbcon115.seq
499999395 gbcon116.seq
222253215 gbcon117.seq
45836617 gbcon118.seq
499942435 gbcon119.seq
497975708 gbcon12.seq
499999195 gbcon120.seq
447230850 gbcon121.seq
500000244 gbcon122.seq
499998377 gbcon123.seq
499998762 gbcon124.seq
196133977 gbcon125.seq
499995599 gbcon126.seq
499999259 gbcon127.seq
238748401 gbcon128.seq
499999467 gbcon129.seq
497481452 gbcon13.seq
466686969 gbcon130.seq
499998370 gbcon131.seq
499999524 gbcon132.seq
267110358 gbcon133.seq
499998231 gbcon134.seq
499905737 gbcon135.seq
499999907 gbcon136.seq
17660978 gbcon137.seq
499998880 gbcon138.seq
499999384 gbcon139.seq
496665494 gbcon14.seq
179138423 gbcon140.seq
499998502 gbcon141.seq
499999166 gbcon142.seq
22645865 gbcon143.seq
499889958 gbcon144.seq
500000058 gbcon145.seq
410613820 gbcon146.seq
499941939 gbcon147.seq
499998956 gbcon148.seq
376844480 gbcon149.seq
495945337 gbcon15.seq
499993470 gbcon150.seq
499947973 gbcon151.seq
367317241 gbcon152.seq
499998828 gbcon153.seq
499998064 gbcon154.seq
81972538 gbcon155.seq
499999960 gbcon156.seq
499952504 gbcon157.seq
499999989 gbcon158.seq
144765078 gbcon159.seq
302360169 gbcon16.seq
499830763 gbcon160.seq
499983832 gbcon161.seq
499968068 gbcon162.seq
336329563 gbcon163.seq
500000036 gbcon164.seq
499998358 gbcon165.seq
407477455 gbcon166.seq
499999531 gbcon167.seq
499999623 gbcon168.seq
499997872 gbcon169.seq
499999013 gbcon17.seq
271450839 gbcon170.seq
499999711 gbcon171.seq
500000152 gbcon172.seq
499495416 gbcon173.seq
499999086 gbcon174.seq
162053205 gbcon175.seq
499999509 gbcon176.seq
499999454 gbcon177.seq
134430053 gbcon178.seq
499993535 gbcon179.seq
499998852 gbcon18.seq
499998057 gbcon180.seq
499999367 gbcon181.seq
288356138 gbcon182.seq
499987697 gbcon183.seq
499993316 gbcon184.seq
454453261 gbcon185.seq
499999851 gbcon186.seq
499993782 gbcon187.seq
397670739 gbcon188.seq
499934613 gbcon189.seq
499999439 gbcon19.seq
499998788 gbcon190.seq
499997845 gbcon191.seq
168056267 gbcon192.seq
499998392 gbcon193.seq
499998932 gbcon194.seq
37638463 gbcon195.seq
499997011 gbcon196.seq
499999104 gbcon197.seq
499999869 gbcon198.seq
499999471 gbcon199.seq
499998695 gbcon2.seq
81389816 gbcon20.seq
500000036 gbcon200.seq
229548656 gbcon201.seq
499999559 gbcon202.seq
459353155 gbcon203.seq
499992671 gbcon204.seq
499997240 gbcon205.seq
478465833 gbcon206.seq
499998192 gbcon207.seq
499997814 gbcon208.seq
499998848 gbcon209.seq
499998430 gbcon21.seq
16784515 gbcon210.seq
499971876 gbcon211.seq
499973931 gbcon212.seq
499998286 gbcon213.seq
499891513 gbcon214.seq
498928741 gbcon215.seq
499908473 gbcon216.seq
333306682 gbcon217.seq
500000056 gbcon22.seq
499498079 gbcon23.seq
285557284 gbcon24.seq
499486394 gbcon25.seq
125746382 gbcon26.seq
126436397 gbcon27.seq
499924680 gbcon28.seq
499992465 gbcon29.seq
499997360 gbcon3.seq
26152220 gbcon30.seq
499999414 gbcon31.seq
499998297 gbcon32.seq
443983441 gbcon33.seq
499999057 gbcon34.seq
499998568 gbcon35.seq
499999100 gbcon36.seq
41918782 gbcon37.seq
500000081 gbcon38.seq
499998540 gbcon39.seq
106993415 gbcon4.seq
277009775 gbcon40.seq
499996336 gbcon41.seq
499998469 gbcon42.seq
270612827 gbcon43.seq
499996532 gbcon44.seq
499996905 gbcon45.seq
385374935 gbcon46.seq
499997390 gbcon47.seq
499999185 gbcon48.seq
176580283 gbcon49.seq
499901495 gbcon5.seq
499999848 gbcon50.seq
499997718 gbcon51.seq
238773972 gbcon52.seq
499997628 gbcon53.seq
499995125 gbcon54.seq
335698760 gbcon55.seq
499996299 gbcon56.seq
499999132 gbcon57.seq
298461041 gbcon58.seq
499995314 gbcon59.seq
494411620 gbcon6.seq
499999014 gbcon60.seq
259899669 gbcon61.seq
499996880 gbcon62.seq
499997062 gbcon63.seq
187377116 gbcon64.seq
499996720 gbcon65.seq
499999826 gbcon66.seq
364586197 gbcon67.seq
499993696 gbcon68.seq
499999904 gbcon69.seq
494413025 gbcon7.seq
386119955 gbcon70.seq
499993762 gbcon71.seq
472787618 gbcon72.seq
174082386 gbcon73.seq
499999629 gbcon74.seq
44558176 gbcon75.seq
499983342 gbcon76.seq
203666963 gbcon77.seq
199581356 gbcon78.seq
499482673 gbcon79.seq
499926814 gbcon8.seq
499994196 gbcon80.seq
337148674 gbcon81.seq
499527910 gbcon82.seq
495870137 gbcon83.seq
499840683 gbcon84.seq
337814172 gbcon85.seq
499904308 gbcon86.seq
499998915 gbcon87.seq
499878836 gbcon88.seq
167922692 gbcon89.seq
69828693 gbcon9.seq
499999253 gbcon90.seq
500000194 gbcon91.seq
132406181 gbcon92.seq
499996791 gbcon93.seq
499998450 gbcon94.seq
499999739 gbcon95.seq
264838814 gbcon96.seq
499996041 gbcon97.seq
499995430 gbcon98.seq
169917525 gbcon99.seq
50059 gbdel.txt
499998812 gbenv1.seq
499999514 gbenv10.seq
499999069 gbenv11.seq
495463383 gbenv12.seq
499998942 gbenv13.seq
499999757 gbenv14.seq
173623395 gbenv15.seq
499955312 gbenv16.seq
499999027 gbenv17.seq
499997706 gbenv18.seq
70830684 gbenv19.seq
499999831 gbenv2.seq
499998409 gbenv20.seq
500000227 gbenv21.seq
177805791 gbenv22.seq
499999700 gbenv23.seq
499999780 gbenv24.seq
499999284 gbenv25.seq
46299721 gbenv26.seq
499998505 gbenv27.seq
499999715 gbenv28.seq
192710343 gbenv29.seq
495069520 gbenv3.seq
499995906 gbenv30.seq
499999157 gbenv31.seq
333532092 gbenv32.seq
499999730 gbenv33.seq
499999278 gbenv34.seq
463469231 gbenv35.seq
499998162 gbenv36.seq
499999858 gbenv37.seq
337875170 gbenv38.seq
499998203 gbenv39.seq
499998616 gbenv4.seq
499998063 gbenv40.seq
394139396 gbenv41.seq
499998707 gbenv42.seq
499998985 gbenv43.seq
345160865 gbenv44.seq
500000096 gbenv45.seq
499997965 gbenv46.seq
237945469 gbenv47.seq
499999935 gbenv48.seq
499999030 gbenv49.seq
403780942 gbenv5.seq
381487901 gbenv50.seq
500000208 gbenv51.seq
499998714 gbenv52.seq
499997311 gbenv53.seq
14750459 gbenv54.seq
500000257 gbenv55.seq
499999527 gbenv56.seq
499998382 gbenv57.seq
8731595 gbenv58.seq
499998467 gbenv59.seq
499998742 gbenv6.seq
499997839 gbenv60.seq
499893494 gbenv61.seq
250921371 gbenv62.seq
499998411 gbenv7.seq
53781176 gbenv8.seq
500000091 gbenv9.seq
499997544 gbest1.seq
499997880 gbest10.seq
499999304 gbest100.seq
499999070 gbest101.seq
500000242 gbest102.seq
499998719 gbest103.seq
24979733 gbest104.seq
499997691 gbest105.seq
499999900 gbest106.seq
499997850 gbest107.seq
499999093 gbest108.seq
9359782 gbest109.seq
499998237 gbest11.seq
499998587 gbest110.seq
499997153 gbest111.seq
499998009 gbest112.seq
499999725 gbest113.seq
23587749 gbest114.seq
499998597 gbest115.seq
499998248 gbest116.seq
499998513 gbest117.seq
11662882 gbest118.seq
499997809 gbest119.seq
474178848 gbest12.seq
499997466 gbest120.seq
499997861 gbest121.seq
68177058 gbest122.seq
499994263 gbest123.seq
499997786 gbest124.seq
223701769 gbest125.seq
499997461 gbest126.seq
499998633 gbest127.seq
195307357 gbest128.seq
499997173 gbest129.seq
499999215 gbest13.seq
499998792 gbest130.seq
499995025 gbest131.seq
499996839 gbest132.seq
85321549 gbest133.seq
499999011 gbest134.seq
499996210 gbest135.seq
499999606 gbest136.seq
499999382 gbest137.seq
97914961 gbest138.seq
500000002 gbest139.seq
249649487 gbest14.seq
499997872 gbest140.seq
499998236 gbest141.seq
500000006 gbest142.seq
24940537 gbest143.seq
499997669 gbest144.seq
499995869 gbest145.seq
499998833 gbest146.seq
499998750 gbest147.seq
30266552 gbest148.seq
499999670 gbest149.seq
499998856 gbest15.seq
500000231 gbest150.seq
499998961 gbest151.seq
322213656 gbest152.seq
499996387 gbest153.seq
499998038 gbest154.seq
499995663 gbest155.seq
499999348 gbest156.seq
21637850 gbest157.seq
499999702 gbest158.seq
499999521 gbest159.seq
499999798 gbest16.seq
499996841 gbest160.seq
499998882 gbest161.seq
9723108 gbest162.seq
499999592 gbest163.seq
499997509 gbest164.seq
499997253 gbest165.seq
499997604 gbest166.seq
82249483 gbest167.seq
500000180 gbest168.seq
499996624 gbest169.seq
420834751 gbest17.seq
499997982 gbest170.seq
499996832 gbest171.seq
120388331 gbest172.seq
499998796 gbest173.seq
499999958 gbest174.seq
499997684 gbest175.seq
499999843 gbest176.seq
66106728 gbest177.seq
499999609 gbest178.seq
403619645 gbest179.seq
499998530 gbest18.seq
500000063 gbest180.seq
499997966 gbest181.seq
499997492 gbest182.seq
499996416 gbest183.seq
42364344 gbest184.seq
499998435 gbest185.seq
499998353 gbest186.seq
499997964 gbest187.seq
499998283 gbest188.seq
40931567 gbest189.seq
499997415 gbest19.seq
499998666 gbest190.seq
499999919 gbest191.seq
499998357 gbest192.seq
499998169 gbest193.seq
12548792 gbest194.seq
499997536 gbest195.seq
499998546 gbest196.seq
499997349 gbest197.seq
499999753 gbest198.seq
25567133 gbest199.seq
499998652 gbest2.seq
260119709 gbest20.seq
499999295 gbest200.seq
499998187 gbest201.seq
499999397 gbest202.seq
499999160 gbest203.seq
30895268 gbest204.seq
13610371 gbest205.seq
499998921 gbest206.seq
499998329 gbest207.seq
328283837 gbest208.seq
499997323 gbest209.seq
499995671 gbest21.seq
499995929 gbest210.seq
316764106 gbest211.seq
499998724 gbest212.seq
499997386 gbest213.seq
265240100 gbest214.seq
500000080 gbest215.seq
499997417 gbest216.seq
268148451 gbest217.seq
499996281 gbest218.seq
499999091 gbest219.seq
499999500 gbest22.seq
499999161 gbest220.seq
500000225 gbest221.seq
49187702 gbest222.seq
499997957 gbest223.seq
499997688 gbest224.seq
499998613 gbest225.seq
499996253 gbest226.seq
46528201 gbest227.seq
499997890 gbest228.seq
499998314 gbest229.seq
242267336 gbest23.seq
174944378 gbest230.seq
499998728 gbest231.seq
499999681 gbest232.seq
499999475 gbest233.seq
478347570 gbest234.seq
499997785 gbest235.seq
499999603 gbest236.seq
499997429 gbest237.seq
462328784 gbest238.seq
499999067 gbest239.seq
499998838 gbest24.seq
499999466 gbest240.seq
499997560 gbest241.seq
495413728 gbest242.seq
499998531 gbest243.seq
499998185 gbest244.seq
499999561 gbest245.seq
499998790 gbest246.seq
24180385 gbest247.seq
499998910 gbest248.seq
499999250 gbest249.seq
499997816 gbest25.seq
490624714 gbest250.seq
499995571 gbest251.seq
499998200 gbest252.seq
499999520 gbest253.seq
499997474 gbest254.seq
15354105 gbest255.seq
499998154 gbest256.seq
499998789 gbest257.seq
499994600 gbest258.seq
499999950 gbest259.seq
499999429 gbest26.seq
73119079 gbest260.seq
499996849 gbest261.seq
499999349 gbest262.seq
499997971 gbest263.seq
499998772 gbest264.seq
10894371 gbest265.seq
499996681 gbest266.seq
499999121 gbest267.seq
499996916 gbest268.seq
499998066 gbest269.seq
499998571 gbest27.seq
50796450 gbest270.seq
499999016 gbest271.seq
499998969 gbest272.seq
499998846 gbest273.seq
119014210 gbest274.seq
499997034 gbest275.seq
499998984 gbest276.seq
499998324 gbest277.seq
499997019 gbest278.seq
50954452 gbest279.seq
48265826 gbest28.seq
499999317 gbest280.seq
499997412 gbest281.seq
499999727 gbest282.seq
499997668 gbest283.seq
55646414 gbest284.seq
499998624 gbest285.seq
499999705 gbest286.seq
499995920 gbest287.seq
499996612 gbest288.seq
11304703 gbest289.seq
499999995 gbest29.seq
499997456 gbest290.seq
499999795 gbest291.seq
499999462 gbest292.seq
499999004 gbest293.seq
25192615 gbest294.seq
499998596 gbest295.seq
499999758 gbest296.seq
485611090 gbest297.seq
499997480 gbest298.seq
499999856 gbest299.seq
499999348 gbest3.seq
499998086 gbest30.seq
499999449 gbest300.seq
499999678 gbest301.seq
5382046 gbest302.seq
499999538 gbest303.seq
499999813 gbest304.seq
499998715 gbest305.seq
499997626 gbest306.seq
7751764 gbest307.seq
499998952 gbest308.seq
499998801 gbest309.seq
499999902 gbest31.seq
499997247 gbest310.seq
421290158 gbest311.seq
499999810 gbest312.seq
499999610 gbest313.seq
499997603 gbest314.seq
495919364 gbest315.seq
499997885 gbest316.seq
499997415 gbest317.seq
467912070 gbest318.seq
499999035 gbest319.seq
486427399 gbest32.seq
499999258 gbest320.seq
499999978 gbest321.seq
499999435 gbest322.seq
39514259 gbest323.seq
500000256 gbest324.seq
499998824 gbest325.seq
499998053 gbest326.seq
493104551 gbest327.seq
499998749 gbest328.seq
499997759 gbest329.seq
499995486 gbest33.seq
499999540 gbest330.seq
499997875 gbest331.seq
54900833 gbest332.seq
499999943 gbest333.seq
499999960 gbest334.seq
499998379 gbest335.seq
469183035 gbest336.seq
499998299 gbest337.seq
500000013 gbest338.seq
499999184 gbest339.seq
499998228 gbest34.seq
499996505 gbest340.seq
18186152 gbest341.seq
499999080 gbest342.seq
491105999 gbest343.seq
499998133 gbest344.seq
499999973 gbest345.seq
499997585 gbest346.seq
499998101 gbest347.seq
5414791 gbest348.seq
499996833 gbest349.seq
499999753 gbest35.seq
499998120 gbest350.seq
499998274 gbest351.seq
445223218 gbest352.seq
499998629 gbest353.seq
500000207 gbest354.seq
499999612 gbest355.seq
387609675 gbest356.seq
499998924 gbest357.seq
499998310 gbest358.seq
499997427 gbest359.seq
464638581 gbest36.seq
499998071 gbest360.seq
20572711 gbest361.seq
499998188 gbest362.seq
500000152 gbest363.seq
499997517 gbest364.seq
499999296 gbest365.seq
55347028 gbest366.seq
166258344 gbest367.seq
499998115 gbest368.seq
499999211 gbest369.seq
499998459 gbest37.seq
499998612 gbest370.seq
499999327 gbest371.seq
86045134 gbest372.seq
499997252 gbest373.seq
499998940 gbest374.seq
499998649 gbest375.seq
499999486 gbest376.seq
164833678 gbest377.seq
499996775 gbest378.seq
499996558 gbest379.seq
499998008 gbest38.seq
499998375 gbest380.seq
499998637 gbest381.seq
151580674 gbest382.seq
499997221 gbest383.seq
499999329 gbest384.seq
499997189 gbest385.seq
497166354 gbest386.seq
499997498 gbest387.seq
499998709 gbest388.seq
499998596 gbest389.seq
499997178 gbest39.seq
64052070 gbest390.seq
499998385 gbest391.seq
499998728 gbest392.seq
499996496 gbest393.seq
499997691 gbest394.seq
83414510 gbest395.seq
499996944 gbest396.seq
499997015 gbest397.seq
499998636 gbest398.seq
499997858 gbest399.seq
434600055 gbest4.seq
499997938 gbest40.seq
85809127 gbest400.seq
499997855 gbest401.seq
499998092 gbest402.seq
499999582 gbest403.seq
499998843 gbest404.seq
50565406 gbest405.seq
499998820 gbest406.seq
499997816 gbest407.seq
499999702 gbest408.seq
499997206 gbest409.seq
191357351 gbest41.seq
90214994 gbest410.seq
499998673 gbest411.seq
499998288 gbest412.seq
499996967 gbest413.seq
499996677 gbest414.seq
124589880 gbest415.seq
499998079 gbest416.seq
328943837 gbest417.seq
500000254 gbest418.seq
499998835 gbest419.seq
499997364 gbest42.seq
499999607 gbest420.seq
500000112 gbest421.seq
54509541 gbest422.seq
499999330 gbest423.seq
499999774 gbest424.seq
499996219 gbest425.seq
409977293 gbest426.seq
499997260 gbest427.seq
499999283 gbest428.seq
335979604 gbest429.seq
499997237 gbest43.seq
499999961 gbest430.seq
500000227 gbest431.seq
261230544 gbest432.seq
499999633 gbest433.seq
499998229 gbest434.seq
458266973 gbest435.seq
499998830 gbest436.seq
500000090 gbest437.seq
307334807 gbest438.seq
499997288 gbest439.seq
499997245 gbest44.seq
499999169 gbest440.seq
329772669 gbest441.seq
499997075 gbest442.seq
499998558 gbest443.seq
187654716 gbest444.seq
499999916 gbest445.seq
499997943 gbest446.seq
118594788 gbest447.seq
499998649 gbest448.seq
500000126 gbest449.seq
499996431 gbest45.seq
140963965 gbest450.seq
500000200 gbest451.seq
499999541 gbest452.seq
146594251 gbest453.seq
499998942 gbest454.seq
500000199 gbest455.seq
499997329 gbest456.seq
487788892 gbest457.seq
499999035 gbest458.seq
499997432 gbest459.seq
189558363 gbest46.seq
499999676 gbest460.seq
499999224 gbest461.seq
19780988 gbest462.seq
170019681 gbest463.seq
499998234 gbest464.seq
499997948 gbest465.seq
499996964 gbest466.seq
499998273 gbest467.seq
23774165 gbest468.seq
499999458 gbest469.seq
499999613 gbest47.seq
499999208 gbest470.seq
499999233 gbest471.seq
499999368 gbest472.seq
59933080 gbest473.seq
499997118 gbest474.seq
499996532 gbest475.seq
499997210 gbest476.seq
499997282 gbest477.seq
57556980 gbest478.seq
499999428 gbest479.seq
499997256 gbest48.seq
499998005 gbest480.seq
499999987 gbest481.seq
499999584 gbest482.seq
37400826 gbest483.seq
499997371 gbest484.seq
499998672 gbest485.seq
499999509 gbest486.seq
499999088 gbest487.seq
64962335 gbest488.seq
499997662 gbest489.seq
499999418 gbest49.seq
499999130 gbest490.seq
499999934 gbest491.seq
206715962 gbest492.seq
499996334 gbest493.seq
499998589 gbest494.seq
499998630 gbest495.seq
499999095 gbest496.seq
89176355 gbest497.seq
499998125 gbest498.seq
499998609 gbest499.seq
499998155 gbest5.seq
474488499 gbest50.seq
500000133 gbest500.seq
499999253 gbest501.seq
52957322 gbest502.seq
499998717 gbest503.seq
499997860 gbest504.seq
499999996 gbest505.seq
499999277 gbest506.seq
141956910 gbest507.seq
499999242 gbest508.seq
499996708 gbest509.seq
499998341 gbest51.seq
499998452 gbest510.seq
500000146 gbest511.seq
139192325 gbest512.seq
499997763 gbest513.seq
499997891 gbest514.seq
499999016 gbest515.seq
500000145 gbest516.seq
16904523 gbest517.seq
174254470 gbest518.seq
500000126 gbest519.seq
355703064 gbest52.seq
499998910 gbest520.seq
83090108 gbest521.seq
499997944 gbest522.seq
499998345 gbest523.seq
75363186 gbest524.seq
499999291 gbest525.seq
499999095 gbest526.seq
499998072 gbest527.seq
499996371 gbest528.seq
94416764 gbest529.seq
499997477 gbest53.seq
499999382 gbest530.seq
499998748 gbest531.seq
499998249 gbest532.seq
499999707 gbest533.seq
9311695 gbest534.seq
499999430 gbest535.seq
499998660 gbest536.seq
499998262 gbest537.seq
477035449 gbest538.seq
499998584 gbest539.seq
499999368 gbest54.seq
499998271 gbest540.seq
499997596 gbest541.seq
411964420 gbest542.seq
499998900 gbest543.seq
499999161 gbest544.seq
499999128 gbest545.seq
477320669 gbest546.seq
499998997 gbest547.seq
499998220 gbest548.seq
499998640 gbest549.seq
499996905 gbest55.seq
499997208 gbest550.seq
33772444 gbest551.seq
499997037 gbest552.seq
499997866 gbest553.seq
499996671 gbest554.seq
499999094 gbest555.seq
44005971 gbest556.seq
499996534 gbest557.seq
499999210 gbest558.seq
499997220 gbest559.seq
483256451 gbest56.seq
499998286 gbest560.seq
9393571 gbest561.seq
499998309 gbest562.seq
499998494 gbest563.seq
392782285 gbest564.seq
499998337 gbest565.seq
499998460 gbest566.seq
96194093 gbest567.seq
499998740 gbest568.seq
499998391 gbest569.seq
499998261 gbest57.seq
50311057 gbest570.seq
499999914 gbest571.seq
499998836 gbest572.seq
500000174 gbest573.seq
254441660 gbest574.seq
500000177 gbest58.seq
499998973 gbest59.seq
499998099 gbest6.seq
463542876 gbest60.seq
499998917 gbest61.seq
499998696 gbest62.seq
499998443 gbest63.seq
499999277 gbest64.seq
6669616 gbest65.seq
499999738 gbest66.seq
499998528 gbest67.seq
499998605 gbest68.seq
482591269 gbest69.seq
499997570 gbest7.seq
499997911 gbest70.seq
499999144 gbest71.seq
499998939 gbest72.seq
499998509 gbest73.seq
7314496 gbest74.seq
123216203 gbest75.seq
499999005 gbest76.seq
499998002 gbest77.seq
499998202 gbest78.seq
499999285 gbest79.seq
469256502 gbest8.seq
5123860 gbest80.seq
499998041 gbest81.seq
499995344 gbest82.seq
499996657 gbest83.seq
499999945 gbest84.seq
45616577 gbest85.seq
499999280 gbest86.seq
499998745 gbest87.seq
499999478 gbest88.seq
499998865 gbest89.seq
499997802 gbest9.seq
52673689 gbest90.seq
499999406 gbest91.seq
500000250 gbest92.seq
499998334 gbest93.seq
471729510 gbest94.seq
499999715 gbest95.seq
499999749 gbest96.seq
500000194 gbest97.seq
498418806 gbest98.seq
35234983 gbest99.seq
499999777 gbgss1.seq
55179126 gbgss10.seq
499997313 gbgss100.seq
499996830 gbgss101.seq
499999909 gbgss102.seq
468181084 gbgss103.seq
499997049 gbgss104.seq
499999629 gbgss105.seq
500000188 gbgss106.seq
499999848 gbgss107.seq
40292488 gbgss108.seq
499997736 gbgss109.seq
499999314 gbgss11.seq
500000122 gbgss110.seq
500000164 gbgss111.seq
316319608 gbgss112.seq
499998282 gbgss113.seq
499998924 gbgss114.seq
499998333 gbgss115.seq
499997840 gbgss116.seq
103720750 gbgss117.seq
499998525 gbgss118.seq
499998144 gbgss119.seq
500000242 gbgss12.seq
499998256 gbgss120.seq
499999634 gbgss121.seq
5770896 gbgss122.seq
499999867 gbgss123.seq
499999676 gbgss124.seq
499999794 gbgss125.seq
449066275 gbgss126.seq
499997882 gbgss127.seq
499997140 gbgss128.seq
499999220 gbgss129.seq
499999094 gbgss13.seq
499996616 gbgss130.seq
29590310 gbgss131.seq
499997877 gbgss132.seq
209679641 gbgss133.seq
500000110 gbgss134.seq
499999602 gbgss135.seq
499997969 gbgss136.seq
500000125 gbgss137.seq
14831686 gbgss138.seq
499996726 gbgss139.seq
498622083 gbgss14.seq
499997951 gbgss140.seq
499999528 gbgss141.seq
499997001 gbgss142.seq
16786266 gbgss143.seq
499997786 gbgss144.seq
499996974 gbgss145.seq
499999546 gbgss146.seq
499996547 gbgss147.seq
2045398 gbgss148.seq
499997382 gbgss149.seq
499997425 gbgss15.seq
499998165 gbgss150.seq
499998480 gbgss151.seq
499997367 gbgss152.seq
6835799 gbgss153.seq
373635168 gbgss154.seq
499999264 gbgss155.seq
499998740 gbgss156.seq
499999488 gbgss157.seq
450187084 gbgss158.seq
499999895 gbgss159.seq
499997738 gbgss16.seq
499997663 gbgss160.seq
499997684 gbgss161.seq
454199198 gbgss162.seq
499997998 gbgss163.seq
499999955 gbgss164.seq
499997965 gbgss165.seq
456856217 gbgss166.seq
499997324 gbgss167.seq
499998331 gbgss168.seq
499998722 gbgss169.seq
499999295 gbgss17.seq
362069154 gbgss170.seq
499999614 gbgss171.seq
499999108 gbgss172.seq
215505768 gbgss173.seq
499998125 gbgss174.seq
499998134 gbgss175.seq
67002892 gbgss176.seq
499999079 gbgss177.seq
499999336 gbgss178.seq
499998518 gbgss179.seq
480471944 gbgss18.seq
499999975 gbgss180.seq
49671428 gbgss181.seq
500000156 gbgss182.seq
499999211 gbgss183.seq
500000209 gbgss184.seq
499999501 gbgss185.seq
39656212 gbgss186.seq
499999015 gbgss187.seq
500000221 gbgss188.seq
23203602 gbgss189.seq
499999252 gbgss19.seq
499998791 gbgss190.seq
499996639 gbgss191.seq
499998774 gbgss192.seq
495024971 gbgss193.seq
499999000 gbgss194.seq
499999717 gbgss195.seq
499999860 gbgss196.seq
499999901 gbgss197.seq
53998378 gbgss198.seq
499998820 gbgss199.seq
499999702 gbgss2.seq
324867797 gbgss20.seq
499998733 gbgss200.seq
499997169 gbgss201.seq
479851147 gbgss202.seq
499997737 gbgss203.seq
499997752 gbgss204.seq
56421213 gbgss205.seq
499997703 gbgss206.seq
500000150 gbgss207.seq
499999163 gbgss208.seq
481445530 gbgss209.seq
499999364 gbgss21.seq
499999908 gbgss210.seq
499997933 gbgss211.seq
499998148 gbgss212.seq
488124681 gbgss213.seq
499999175 gbgss214.seq
499999239 gbgss215.seq
499999176 gbgss216.seq
467990953 gbgss217.seq
499999749 gbgss218.seq
499999749 gbgss219.seq
499997480 gbgss22.seq
499997938 gbgss220.seq
6989681 gbgss221.seq
499999723 gbgss222.seq
499999684 gbgss223.seq
499998774 gbgss224.seq
264582471 gbgss225.seq
499998308 gbgss226.seq
499997919 gbgss227.seq
499999010 gbgss228.seq
429128186 gbgss229.seq
499997001 gbgss23.seq
499998680 gbgss230.seq
499997412 gbgss231.seq
499999464 gbgss232.seq
468539336 gbgss233.seq
499999119 gbgss234.seq
499999511 gbgss235.seq
499996654 gbgss236.seq
418138488 gbgss237.seq
499998602 gbgss238.seq
499998785 gbgss239.seq
499999217 gbgss24.seq
499999907 gbgss240.seq
499997646 gbgss241.seq
16466381 gbgss242.seq
315572447 gbgss243.seq
499997744 gbgss244.seq
499999895 gbgss245.seq
499998432 gbgss246.seq
467293763 gbgss247.seq
499998755 gbgss248.seq
499999852 gbgss249.seq
47915040 gbgss25.seq
499999607 gbgss250.seq
499998339 gbgss251.seq
36094621 gbgss252.seq
499998608 gbgss253.seq
499997686 gbgss254.seq
499998198 gbgss255.seq
499999134 gbgss256.seq
19020583 gbgss257.seq
499999905 gbgss258.seq
499998046 gbgss259.seq
499998203 gbgss26.seq
500000045 gbgss260.seq
1404512 gbgss261.seq
500000216 gbgss262.seq
499999092 gbgss263.seq
499998857 gbgss264.seq
480378844 gbgss265.seq
499999638 gbgss266.seq
499998584 gbgss267.seq
449883145 gbgss268.seq
499999289 gbgss27.seq
499997752 gbgss28.seq
499998503 gbgss29.seq
500000154 gbgss3.seq
28371252 gbgss30.seq
499999620 gbgss31.seq
499999369 gbgss32.seq
499997936 gbgss33.seq
474348213 gbgss34.seq
499997672 gbgss35.seq
499999711 gbgss36.seq
499998458 gbgss37.seq
499998787 gbgss38.seq
10244239 gbgss39.seq
499997022 gbgss4.seq
499998043 gbgss40.seq
500000104 gbgss41.seq
168816398 gbgss42.seq
499998215 gbgss43.seq
499997776 gbgss44.seq
499997935 gbgss45.seq
487170352 gbgss46.seq
500000097 gbgss47.seq
499997504 gbgss48.seq
499999771 gbgss49.seq
37746558 gbgss5.seq
444022212 gbgss50.seq
499998446 gbgss51.seq
500000163 gbgss52.seq
499998853 gbgss53.seq
420972611 gbgss54.seq
499999264 gbgss55.seq
499999392 gbgss56.seq
499998883 gbgss57.seq
427742687 gbgss58.seq
67685650 gbgss59.seq
499999011 gbgss6.seq
500000215 gbgss60.seq
499997984 gbgss61.seq
500000021 gbgss62.seq
493796988 gbgss63.seq
499998150 gbgss64.seq
500000146 gbgss65.seq
500000101 gbgss66.seq
499520338 gbgss67.seq
499998492 gbgss68.seq
499999132 gbgss69.seq
499998902 gbgss7.seq
499999264 gbgss70.seq
419358340 gbgss71.seq
499999747 gbgss72.seq
499998402 gbgss73.seq
499998080 gbgss74.seq
33896316 gbgss75.seq
499997046 gbgss76.seq
499999706 gbgss77.seq
499999836 gbgss78.seq
490829495 gbgss79.seq
499997604 gbgss8.seq
499997550 gbgss80.seq
499997981 gbgss81.seq
499998952 gbgss82.seq
499999735 gbgss83.seq
6075051 gbgss84.seq
499999962 gbgss85.seq
500000077 gbgss86.seq
499997276 gbgss87.seq
499999314 gbgss88.seq
23821801 gbgss89.seq
499999203 gbgss9.seq
500000224 gbgss90.seq
499999829 gbgss91.seq
499999704 gbgss92.seq
462802247 gbgss93.seq
244248654 gbgss94.seq
499999492 gbgss95.seq
499998457 gbgss96.seq
500000176 gbgss97.seq
499997669 gbgss98.seq
45206073 gbgss99.seq
499991077 gbhtc1.seq
499994049 gbhtc2.seq
499986002 gbhtc3.seq
330777725 gbhtc4.seq
499999497 gbhtc5.seq
437685656 gbhtc6.seq
499998694 gbhtc7.seq
190862908 gbhtc8.seq
499943248 gbhtg1.seq
499980365 gbhtg10.seq
485099546 gbhtg11.seq
499977093 gbhtg12.seq
499847932 gbhtg13.seq
499963690 gbhtg14.seq
499701413 gbhtg15.seq
474637756 gbhtg16.seq
499709315 gbhtg17.seq
499810411 gbhtg18.seq
499965524 gbhtg19.seq
499844091 gbhtg2.seq
499990220 gbhtg20.seq
473197896 gbhtg21.seq
499917621 gbhtg22.seq
499967580 gbhtg23.seq
499096681 gbhtg24.seq
499958752 gbhtg25.seq
484455994 gbhtg26.seq
499961339 gbhtg27.seq
499870274 gbhtg28.seq
268060905 gbhtg29.seq
499869147 gbhtg3.seq
499926223 gbhtg30.seq
499802500 gbhtg31.seq
224936220 gbhtg32.seq
499948739 gbhtg33.seq
499915502 gbhtg34.seq
265459787 gbhtg35.seq
499837354 gbhtg36.seq
499950524 gbhtg37.seq
223150728 gbhtg38.seq
499802417 gbhtg39.seq
499846457 gbhtg4.seq
499973211 gbhtg40.seq
234952769 gbhtg41.seq
499824978 gbhtg42.seq
499885923 gbhtg43.seq
202125536 gbhtg44.seq
499784538 gbhtg45.seq
499925762 gbhtg46.seq
205797151 gbhtg47.seq
499975842 gbhtg48.seq
499928510 gbhtg49.seq
499934497 gbhtg5.seq
193864742 gbhtg50.seq
499926539 gbhtg51.seq
499937036 gbhtg52.seq
161358152 gbhtg53.seq
499996909 gbhtg54.seq
499996869 gbhtg55.seq
252726149 gbhtg56.seq
499940485 gbhtg57.seq
499966376 gbhtg58.seq
499997341 gbhtg59.seq
507366 gbhtg6.seq
167065947 gbhtg60.seq
499929457 gbhtg61.seq
499926029 gbhtg62.seq
499877216 gbhtg63.seq
468570824 gbhtg64.seq
499882387 gbhtg65.seq
499975194 gbhtg66.seq
499983596 gbhtg67.seq
499743038 gbhtg68.seq
499819592 gbhtg69.seq
499821285 gbhtg7.seq
400731273 gbhtg70.seq
499881361 gbhtg71.seq
499835760 gbhtg72.seq
385678143 gbhtg73.seq
499951671 gbhtg74.seq
499970875 gbhtg75.seq
383567862 gbhtg76.seq
499964642 gbhtg77.seq
499988260 gbhtg78.seq
499994475 gbhtg79.seq
499933798 gbhtg8.seq
499991153 gbhtg80.seq
499926087 gbhtg81.seq
266334876 gbhtg82.seq
499899409 gbhtg9.seq
499801469 gbinv1.seq
490451253 gbinv10.seq
491062219 gbinv11.seq
495976109 gbinv12.seq
497930277 gbinv13.seq
435321419 gbinv14.seq
499999490 gbinv15.seq
399307613 gbinv16.seq
499999679 gbinv17.seq
404328367 gbinv18.seq
497205455 gbinv19.seq
455402651 gbinv2.seq
499997891 gbinv20.seq
321193556 gbinv21.seq
492343644 gbinv22.seq
499999384 gbinv23.seq
482998243 gbinv24.seq
499999660 gbinv25.seq
499999278 gbinv26.seq
393769071 gbinv27.seq
499997794 gbinv28.seq
499999988 gbinv29.seq
499999460 gbinv3.seq
174893422 gbinv30.seq
499999842 gbinv31.seq
499999098 gbinv32.seq
116586844 gbinv33.seq
499999524 gbinv34.seq
499998898 gbinv35.seq
147798511 gbinv36.seq
499999109 gbinv37.seq
499999945 gbinv38.seq
156114244 gbinv39.seq
499039576 gbinv4.seq
499997635 gbinv40.seq
499999541 gbinv41.seq
190796022 gbinv42.seq
499998960 gbinv43.seq
499998497 gbinv44.seq
244863335 gbinv45.seq
499999797 gbinv46.seq
499999882 gbinv47.seq
499999615 gbinv48.seq
447845723 gbinv49.seq
150895119 gbinv5.seq
499998874 gbinv50.seq
445991558 gbinv51.seq
288064994 gbinv52.seq
54947886 gbinv53.seq
52917686 gbinv54.seq
156789431 gbinv55.seq
499989559 gbinv56.seq
266436255 gbinv57.seq
499998556 gbinv58.seq
499997693 gbinv59.seq
496481370 gbinv6.seq
172341791 gbinv60.seq
499362201 gbinv61.seq
498125774 gbinv62.seq
499648429 gbinv63.seq
128966683 gbinv64.seq
495468987 gbinv65.seq
51960556 gbinv66.seq
466424060 gbinv67.seq
479577317 gbinv68.seq
450265331 gbinv69.seq
476450800 gbinv7.seq
482002954 gbinv70.seq
121049416 gbinv71.seq
494585019 gbinv72.seq
245507655 gbinv73.seq
683172135 gbinv74.seq
872662072 gbinv75.seq
815663158 gbinv76.seq
813528096 gbinv77.seq
780491773 gbinv78.seq
734904722 gbinv79.seq
422530809 gbinv8.seq
816941877 gbinv80.seq
499520396 gbinv81.seq
499932991 gbinv82.seq
499999545 gbinv83.seq
61967913 gbinv84.seq
499999875 gbinv85.seq
499997902 gbinv86.seq
259657093 gbinv87.seq
499998696 gbinv88.seq
499999139 gbinv89.seq
173964300 gbinv9.seq
184235022 gbinv90.seq
499998207 gbinv91.seq
500000001 gbinv92.seq
499997694 gbinv93.seq
499999510 gbinv94.seq
99858284 gbinv95.seq
499999371 gbmam1.seq
82810194 gbmam10.seq
71296598 gbmam11.seq
22570876 gbmam12.seq
1268606 gbmam13.seq
378312073 gbmam14.seq
338653931 gbmam15.seq
477859990 gbmam16.seq
445458574 gbmam17.seq
122412955 gbmam18.seq
451114203 gbmam19.seq
393441239 gbmam2.seq
418062948 gbmam20.seq
499818197 gbmam21.seq
462376363 gbmam22.seq
370510653 gbmam23.seq
446296425 gbmam24.seq
431104447 gbmam25.seq
480602957 gbmam26.seq
479109873 gbmam27.seq
483903297 gbmam28.seq
483307008 gbmam29.seq
400559326 gbmam3.seq
48405032 gbmam30.seq
363174382 gbmam31.seq
437246747 gbmam32.seq
470828962 gbmam33.seq
402408906 gbmam34.seq
304109928 gbmam35.seq
452443739 gbmam36.seq
451303958 gbmam37.seq
495648598 gbmam38.seq
405636626 gbmam39.seq
477148353 gbmam4.seq
410457734 gbmam40.seq
441553748 gbmam41.seq
367146984 gbmam42.seq
478421809 gbmam43.seq
317555084 gbmam44.seq
9943517 gbmam45.seq
43989127 gbmam46.seq
91322474 gbmam47.seq
88811460 gbmam48.seq
6364900 gbmam49.seq
374653134 gbmam5.seq
20917987 gbmam50.seq
449541436 gbmam51.seq
499997544 gbmam52.seq
499979214 gbmam53.seq
78113521 gbmam54.seq
907465328 gbmam55.seq
839494897 gbmam56.seq
774395849 gbmam57.seq
588873740 gbmam58.seq
364960392 gbmam59.seq
487713568 gbmam6.seq
428298067 gbmam60.seq
283039896 gbmam61.seq
266822121 gbmam62.seq
255007049 gbmam63.seq
250435254 gbmam64.seq
405637142 gbmam65.seq
372091504 gbmam66.seq
465555603 gbmam67.seq
444923782 gbmam68.seq
341578443 gbmam69.seq
401181424 gbmam7.seq
257946240 gbmam70.seq
485829704 gbmam71.seq
486026993 gbmam72.seq
483298905 gbmam73.seq
499998555 gbmam74.seq
499986632 gbmam75.seq
103710781 gbmam76.seq
435129139 gbmam8.seq
275779026 gbmam9.seq
24396147 gbnew.txt
500000092 gbpat1.seq
499999421 gbpat10.seq
499999036 gbpat100.seq
499999497 gbpat101.seq
499997525 gbpat102.seq
228719622 gbpat103.seq
500000251 gbpat104.seq
500000174 gbpat105.seq
499999692 gbpat106.seq
335320568 gbpat107.seq
499997604 gbpat108.seq
499998851 gbpat109.seq
499998437 gbpat11.seq
208318711 gbpat110.seq
499890409 gbpat111.seq
499995271 gbpat112.seq
174084208 gbpat113.seq
499999690 gbpat114.seq
499999999 gbpat115.seq
499995931 gbpat116.seq
8602764 gbpat117.seq
499705367 gbpat118.seq
382783204 gbpat119.seq
179117301 gbpat12.seq
499994920 gbpat120.seq
499992234 gbpat121.seq
499992660 gbpat122.seq
499999497 gbpat123.seq
56299930 gbpat124.seq
499968107 gbpat125.seq
499997958 gbpat126.seq
208432510 gbpat127.seq
500000067 gbpat128.seq
499999635 gbpat129.seq
499863643 gbpat13.seq
57362355 gbpat130.seq
499998514 gbpat131.seq
499998398 gbpat132.seq
487348580 gbpat133.seq
499994603 gbpat134.seq
500000259 gbpat135.seq
25912455 gbpat136.seq
499984154 gbpat137.seq
385133435 gbpat138.seq
499999527 gbpat139.seq
500000118 gbpat14.seq
500000185 gbpat140.seq
148486009 gbpat141.seq
499998050 gbpat142.seq
314453605 gbpat143.seq
499988381 gbpat144.seq
499980283 gbpat145.seq
409538104 gbpat146.seq
500000154 gbpat147.seq
499997598 gbpat148.seq
125941966 gbpat149.seq
62619957 gbpat15.seq
499989559 gbpat150.seq
499999596 gbpat151.seq
499998591 gbpat152.seq
500000091 gbpat153.seq
169803144 gbpat154.seq
499999307 gbpat155.seq
425309111 gbpat156.seq
500000126 gbpat157.seq
499999466 gbpat158.seq
499869890 gbpat159.seq
499998758 gbpat16.seq
353501131 gbpat160.seq
499996031 gbpat161.seq
499998996 gbpat162.seq
289575444 gbpat163.seq
499999055 gbpat164.seq
499999811 gbpat165.seq
499999687 gbpat166.seq
100308917 gbpat167.seq
499991629 gbpat168.seq
499997500 gbpat169.seq
500000076 gbpat17.seq
499998487 gbpat170.seq
499998725 gbpat171.seq
301680889 gbpat172.seq
499992166 gbpat173.seq
499997847 gbpat174.seq
499999999 gbpat175.seq
499998748 gbpat176.seq
499999003 gbpat177.seq
229519945 gbpat178.seq
497266419 gbpat179.seq
421855238 gbpat18.seq
499996971 gbpat180.seq
499996977 gbpat181.seq
86829414 gbpat182.seq
499920506 gbpat183.seq
499999973 gbpat184.seq
499995710 gbpat185.seq
39745949 gbpat186.seq
499252884 gbpat187.seq
500000003 gbpat188.seq
499998877 gbpat189.seq
499827586 gbpat19.seq
499999435 gbpat190.seq
96535132 gbpat191.seq
499878398 gbpat192.seq
499998095 gbpat193.seq
499999338 gbpat194.seq
500000078 gbpat195.seq
101409556 gbpat196.seq
500000054 gbpat197.seq
499999577 gbpat198.seq
321705067 gbpat199.seq
500000184 gbpat2.seq
500000083 gbpat20.seq
499991396 gbpat200.seq
499963719 gbpat201.seq
350635988 gbpat202.seq
497506292 gbpat203.seq
499869540 gbpat204.seq
421452571 gbpat205.seq
499425936 gbpat206.seq
499999361 gbpat207.seq
336263474 gbpat208.seq
499998549 gbpat209.seq
499986744 gbpat21.seq
500000171 gbpat210.seq
499267159 gbpat211.seq
213482936 gbpat212.seq
347550886 gbpat22.seq
499995489 gbpat23.seq
500000171 gbpat24.seq
499993571 gbpat25.seq
499979527 gbpat26.seq
165690248 gbpat27.seq
500000249 gbpat28.seq
499999901 gbpat29.seq
61191360 gbpat3.seq
213211253 gbpat30.seq
499999775 gbpat31.seq
405870707 gbpat32.seq
500000029 gbpat33.seq
499999023 gbpat34.seq
125406234 gbpat35.seq
499998965 gbpat36.seq
499999218 gbpat37.seq
499999520 gbpat38.seq
140141151 gbpat39.seq
499999952 gbpat4.seq
500000233 gbpat40.seq
493970301 gbpat41.seq
494766586 gbpat42.seq
499998800 gbpat43.seq
149226143 gbpat44.seq
499999126 gbpat45.seq
499999712 gbpat46.seq
500000061 gbpat47.seq
87767218 gbpat48.seq
499999673 gbpat49.seq
500000017 gbpat5.seq
499999964 gbpat50.seq
499999650 gbpat51.seq
130932243 gbpat52.seq
499999613 gbpat53.seq
499999084 gbpat54.seq
184981098 gbpat55.seq
499999726 gbpat56.seq
499999154 gbpat57.seq
137265710 gbpat58.seq
499998902 gbpat59.seq
418696760 gbpat6.seq
499638184 gbpat60.seq
429848972 gbpat61.seq
499999861 gbpat62.seq
320951655 gbpat63.seq
500000031 gbpat64.seq
499999438 gbpat65.seq
305984618 gbpat66.seq
499999595 gbpat67.seq
499997159 gbpat68.seq
144919043 gbpat69.seq
500000169 gbpat7.seq
499999495 gbpat70.seq
226235202 gbpat71.seq
499942763 gbpat72.seq
500000257 gbpat73.seq
309555677 gbpat74.seq
499990988 gbpat75.seq
499996904 gbpat76.seq
259606120 gbpat77.seq
499998418 gbpat78.seq
499997914 gbpat79.seq
499999599 gbpat8.seq
36785301 gbpat80.seq
500000256 gbpat81.seq
474123180 gbpat82.seq
499999508 gbpat83.seq
331586952 gbpat84.seq
499999395 gbpat85.seq
312101217 gbpat86.seq
499997607 gbpat87.seq
499999668 gbpat88.seq
499999896 gbpat89.seq
317054874 gbpat9.seq
203394255 gbpat90.seq
499999444 gbpat91.seq
455869832 gbpat92.seq
499983407 gbpat93.seq
252132619 gbpat94.seq
500000004 gbpat95.seq
499998751 gbpat96.seq
82014149 gbpat97.seq
499999689 gbpat98.seq
498236426 gbpat99.seq
499795569 gbphg1.seq
499940746 gbphg2.seq
499843432 gbphg3.seq
286825250 gbphg4.seq
499997011 gbpln1.seq
268695070 gbpln10.seq
84605 gbpln100.seq
354450 gbpln101.seq
164936594 gbpln102.seq
40081561 gbpln103.seq
74904960 gbpln104.seq
499999632 gbpln105.seq
356716601 gbpln106.seq
499999704 gbpln107.seq
499987022 gbpln108.seq
139836843 gbpln109.seq
499919186 gbpln11.seq
499883803 gbpln110.seq
499778017 gbpln111.seq
499997155 gbpln112.seq
284882927 gbpln113.seq
298300739 gbpln114.seq
211233470 gbpln115.seq
248438793 gbpln116.seq
185623689 gbpln117.seq
997331398 gbpln118.seq
56500758 gbpln119.seq
497777139 gbpln12.seq
487347148 gbpln120.seq
473525516 gbpln121.seq
473209377 gbpln122.seq
467870557 gbpln123.seq
357046131 gbpln124.seq
499999642 gbpln125.seq
63282606 gbpln126.seq
499999294 gbpln127.seq
499996940 gbpln128.seq
266994478 gbpln129.seq
469735020 gbpln13.seq
499627004 gbpln130.seq
499998645 gbpln131.seq
85103174 gbpln132.seq
499999312 gbpln133.seq
466500600 gbpln134.seq
499999201 gbpln135.seq
417427200 gbpln136.seq
499995262 gbpln137.seq
384549409 gbpln138.seq
499998887 gbpln139.seq
170594776 gbpln14.seq
499997283 gbpln140.seq
500000068 gbpln141.seq
63822239 gbpln142.seq
499997973 gbpln143.seq
499999503 gbpln144.seq
412255878 gbpln145.seq
499997355 gbpln146.seq
499847554 gbpln147.seq
499253647 gbpln148.seq
158199668 gbpln149.seq
496172088 gbpln15.seq
499792968 gbpln150.seq
491474877 gbpln151.seq
402785639 gbpln152.seq
445924319 gbpln153.seq
500000019 gbpln154.seq
3184755 gbpln155.seq
489479367 gbpln156.seq
226945063 gbpln157.seq
314212346 gbpln158.seq
665291577 gbpln159.seq
477892759 gbpln16.seq
860028189 gbpln160.seq
800605872 gbpln161.seq
794469115 gbpln162.seq
762933697 gbpln163.seq
729969959 gbpln164.seq
808217924 gbpln165.seq
482687484 gbpln166.seq
444250874 gbpln167.seq
462433947 gbpln168.seq
480005132 gbpln169.seq
335223965 gbpln17.seq
494737040 gbpln170.seq
446232653 gbpln171.seq
417743779 gbpln172.seq
250838119 gbpln173.seq
364689197 gbpln174.seq
339196729 gbpln175.seq
386320509 gbpln176.seq
311828079 gbpln177.seq
213907446 gbpln178.seq
547058897 gbpln179.seq
418823303 gbpln18.seq
116695421 gbpln180.seq
485280656 gbpln181.seq
153135114 gbpln182.seq
689933987 gbpln183.seq
887561680 gbpln184.seq
834970472 gbpln185.seq
826391913 gbpln186.seq
792513917 gbpln187.seq
743209872 gbpln188.seq
833073712 gbpln189.seq
350136904 gbpln19.seq
495424 gbpln190.seq
665291577 gbpln191.seq
860028189 gbpln192.seq
800605872 gbpln193.seq
794469115 gbpln194.seq
762933697 gbpln195.seq
729969959 gbpln196.seq
808217924 gbpln197.seq
202901149 gbpln198.seq
663098252 gbpln199.seq
499889632 gbpln2.seq
345708624 gbpln20.seq
855592604 gbpln200.seq
807031053 gbpln201.seq
793905039 gbpln202.seq
773303164 gbpln203.seq
718153248 gbpln204.seq
804870210 gbpln205.seq
661762125 gbpln206.seq
840180304 gbpln207.seq
796430245 gbpln208.seq
779180715 gbpln209.seq
384288958 gbpln21.seq
761224530 gbpln210.seq
725380245 gbpln211.seq
792983451 gbpln212.seq
652402241 gbpln213.seq
831209396 gbpln214.seq
783682955 gbpln215.seq
775938782 gbpln216.seq
741958804 gbpln217.seq
700440901 gbpln218.seq
788705159 gbpln219.seq
203983960 gbpln22.seq
665885380 gbpln220.seq
854365289 gbpln221.seq
802776370 gbpln222.seq
793295936 gbpln223.seq
769246264 gbpln224.seq
710912943 gbpln225.seq
799876839 gbpln226.seq
635039454 gbpln227.seq
824184474 gbpln228.seq
768070182 gbpln229.seq
84497167 gbpln23.seq
758956882 gbpln230.seq
732189331 gbpln231.seq
706311232 gbpln232.seq
766293442 gbpln233.seq
651415133 gbpln234.seq
830082304 gbpln235.seq
783385752 gbpln236.seq
770520351 gbpln237.seq
753421970 gbpln238.seq
699441547 gbpln239.seq
477735094 gbpln24.seq
784443196 gbpln240.seq
702337808 gbpln241.seq
906907390 gbpln242.seq
844110716 gbpln243.seq
841780855 gbpln244.seq
805270043 gbpln245.seq
764396863 gbpln246.seq
841492595 gbpln247.seq
714482811 gbpln248.seq
916127997 gbpln249.seq
499901688 gbpln25.seq
858459407 gbpln250.seq
848936990 gbpln251.seq
813129213 gbpln252.seq
765593150 gbpln253.seq
862731158 gbpln254.seq
629668050 gbpln255.seq
814320946 gbpln256.seq
759349720 gbpln257.seq
762512207 gbpln258.seq
724647884 gbpln259.seq
498817745 gbpln26.seq
679679449 gbpln260.seq
784312844 gbpln261.seq
684180819 gbpln262.seq
873292213 gbpln263.seq
827422505 gbpln264.seq
815925825 gbpln265.seq
779009585 gbpln266.seq
739747654 gbpln267.seq
834950434 gbpln268.seq
663096073 gbpln269.seq
323729344 gbpln27.seq
849628701 gbpln270.seq
803882830 gbpln271.seq
794420470 gbpln272.seq
760127459 gbpln273.seq
714663802 gbpln274.seq
801095950 gbpln275.seq
668869887 gbpln276.seq
854770002 gbpln277.seq
805931576 gbpln278.seq
798923954 gbpln279.seq
499081327 gbpln28.seq
766411223 gbpln280.seq
723133936 gbpln281.seq
803351408 gbpln282.seq
664176987 gbpln283.seq
854339916 gbpln284.seq
803900400 gbpln285.seq
791449620 gbpln286.seq
761145205 gbpln287.seq
715062603 gbpln288.seq
806379176 gbpln289.seq
497392106 gbpln29.seq
668964953 gbpln290.seq
870939392 gbpln291.seq
809408813 gbpln292.seq
801514137 gbpln293.seq
768794024 gbpln294.seq
723644689 gbpln295.seq
815153418 gbpln296.seq
661177159 gbpln297.seq
846934671 gbpln298.seq
794708793 gbpln299.seq
499929451 gbpln3.seq
499424594 gbpln30.seq
789781753 gbpln300.seq
764576068 gbpln301.seq
711115451 gbpln302.seq
797517245 gbpln303.seq
691953899 gbpln304.seq
888406351 gbpln305.seq
835271741 gbpln306.seq
823533989 gbpln307.seq
787819193 gbpln308.seq
748786657 gbpln309.seq
103293547 gbpln31.seq
838184652 gbpln310.seq
487544899 gbpln311.seq
439661491 gbpln312.seq
155704371 gbpln313.seq
758806100 gbpln314.seq
898446949 gbpln315.seq
628489896 gbpln316.seq
1024113089 gbpln317.seq
1032878661 gbpln318.seq
858694781 gbpln319.seq
496565850 gbpln32.seq
960391204 gbpln320.seq
1090094606 gbpln321.seq
781959143 gbpln322.seq
946995961 gbpln323.seq
857542781 gbpln324.seq
656405285 gbpln325.seq
907889097 gbpln326.seq
896386890 gbpln327.seq
726432335 gbpln328.seq
798296822 gbpln329.seq
498203430 gbpln33.seq
918393750 gbpln330.seq
584961784 gbpln331.seq
948865971 gbpln332.seq
954536271 gbpln333.seq
819735731 gbpln334.seq
756588093 gbpln335.seq
876067119 gbpln336.seq
625446321 gbpln337.seq
977801494 gbpln338.seq
854357980 gbpln339.seq
349197988 gbpln34.seq
807732556 gbpln340.seq
947696453 gbpln341.seq
1067629605 gbpln342.seq
822222048 gbpln343.seq
950272996 gbpln344.seq
845138843 gbpln345.seq
643846993 gbpln346.seq
894745096 gbpln347.seq
893352134 gbpln348.seq
722578984 gbpln349.seq
488667009 gbpln35.seq
776227316 gbpln350.seq
899750467 gbpln351.seq
592059964 gbpln352.seq
933986451 gbpln353.seq
939527664 gbpln354.seq
810117922 gbpln355.seq
765938558 gbpln356.seq
886537018 gbpln357.seq
623519964 gbpln358.seq
996940649 gbpln359.seq
497060599 gbpln36.seq
1030190034 gbpln360.seq
832828033 gbpln361.seq
956342979 gbpln362.seq
1134286144 gbpln363.seq
790513299 gbpln364.seq
944161893 gbpln365.seq
860035788 gbpln366.seq
647268685 gbpln367.seq
902239623 gbpln368.seq
611029440 gbpln369.seq
332336790 gbpln37.seq
734907577 gbpln370.seq
787834228 gbpln371.seq
910724363 gbpln372.seq
606016896 gbpln373.seq
961485234 gbpln374.seq
1242775191 gbpln375.seq
816670128 gbpln376.seq
636658925 gbpln377.seq
818591771 gbpln378.seq
766580884 gbpln379.seq
496457212 gbpln38.seq
752100829 gbpln380.seq
724519993 gbpln381.seq
690955648 gbpln382.seq
769738288 gbpln383.seq
750738544 gbpln384.seq
872184389 gbpln385.seq
624480879 gbpln386.seq
995069022 gbpln387.seq
1012956234 gbpln388.seq
827074347 gbpln389.seq
487441358 gbpln39.seq
940621783 gbpln390.seq
1079418810 gbpln391.seq
776922106 gbpln392.seq
938380968 gbpln393.seq
848757671 gbpln394.seq
643572913 gbpln395.seq
891714442 gbpln396.seq
878638403 gbpln397.seq
721632671 gbpln398.seq
779156122 gbpln399.seq
499894364 gbpln4.seq
477280628 gbpln40.seq
895553446 gbpln400.seq
604678568 gbpln401.seq
931006295 gbpln402.seq
933660027 gbpln403.seq
810459540 gbpln404.seq
761872100 gbpln405.seq
878702815 gbpln406.seq
627081460 gbpln407.seq
994320235 gbpln408.seq
999434327 gbpln409.seq
433198965 gbpln41.seq
823789349 gbpln410.seq
945629782 gbpln411.seq
1062113821 gbpln412.seq
792298939 gbpln413.seq
941851700 gbpln414.seq
850142413 gbpln415.seq
656955691 gbpln416.seq
904094753 gbpln417.seq
900193903 gbpln418.seq
728906821 gbpln419.seq
317392296 gbpln42.seq
741172650 gbpln420.seq
898719079 gbpln421.seq
599002526 gbpln422.seq
937117048 gbpln423.seq
936021119 gbpln424.seq
812696702 gbpln425.seq
746628212 gbpln426.seq
897168807 gbpln427.seq
626698501 gbpln428.seq
1007072101 gbpln429.seq
494333229 gbpln43.seq
1000831797 gbpln430.seq
841918855 gbpln431.seq
963426816 gbpln432.seq
1093654114 gbpln433.seq
791118382 gbpln434.seq
959940756 gbpln435.seq
853263842 gbpln436.seq
648051398 gbpln437.seq
901282075 gbpln438.seq
923491092 gbpln439.seq
475206592 gbpln44.seq
732477869 gbpln440.seq
789987733 gbpln441.seq
926022053 gbpln442.seq
610840579 gbpln443.seq
949759032 gbpln444.seq
955444559 gbpln445.seq
818480442 gbpln446.seq
752251380 gbpln447.seq
897893149 gbpln448.seq
631111272 gbpln449.seq
468207974 gbpln45.seq
1022032953 gbpln450.seq
1006306956 gbpln451.seq
837035085 gbpln452.seq
966140819 gbpln453.seq
1090560006 gbpln454.seq
800164754 gbpln455.seq
959884028 gbpln456.seq
886916735 gbpln457.seq
641540050 gbpln458.seq
910168783 gbpln459.seq
477377284 gbpln46.seq
908785549 gbpln460.seq
729527181 gbpln461.seq
797552105 gbpln462.seq
910975470 gbpln463.seq
616026199 gbpln464.seq
945685366 gbpln465.seq
953145956 gbpln466.seq
820081609 gbpln467.seq
763165947 gbpln468.seq
870898266 gbpln469.seq
272302955 gbpln47.seq
618200825 gbpln470.seq
1009123187 gbpln471.seq
1016689515 gbpln472.seq
832912303 gbpln473.seq
952656374 gbpln474.seq
1065835283 gbpln475.seq
776075044 gbpln476.seq
935940025 gbpln477.seq
846831932 gbpln478.seq
641399988 gbpln479.seq
172902191 gbpln48.seq
892709705 gbpln480.seq
594848385 gbpln481.seq
720169483 gbpln482.seq
780564861 gbpln483.seq
888344689 gbpln484.seq
610800072 gbpln485.seq
934713391 gbpln486.seq
1233388213 gbpln487.seq
807523234 gbpln488.seq
31653373 gbpln489.seq
471233536 gbpln49.seq
9838016 gbpln490.seq
10182293 gbpln491.seq
766528189 gbpln492.seq
10567626 gbpln493.seq
756143249 gbpln494.seq
878426054 gbpln495.seq
631056251 gbpln496.seq
993852367 gbpln497.seq
1020132695 gbpln498.seq
830166807 gbpln499.seq
464664626 gbpln5.seq
455042321 gbpln50.seq
955723315 gbpln500.seq
1057964328 gbpln501.seq
784007552 gbpln502.seq
947940191 gbpln503.seq
857511193 gbpln504.seq
649137171 gbpln505.seq
903393879 gbpln506.seq
908180396 gbpln507.seq
721135945 gbpln508.seq
786739709 gbpln509.seq
488809223 gbpln51.seq
918070756 gbpln510.seq
603192844 gbpln511.seq
938102555 gbpln512.seq
955978436 gbpln513.seq
813787878 gbpln514.seq
639701128 gbpln515.seq
468392956 gbpln516.seq
499432094 gbpln517.seq
498557023 gbpln518.seq
20746920 gbpln519.seq
355272263 gbpln52.seq
768129678 gbpln520.seq
891209633 gbpln521.seq
1017177961 gbpln522.seq
1036708108 gbpln523.seq
980496603 gbpln524.seq
1096870510 gbpln525.seq
964601805 gbpln526.seq
883690282 gbpln527.seq
879367269 gbpln528.seq
922136688 gbpln529.seq
200538454 gbpln53.seq
805432021 gbpln530.seq
912345991 gbpln531.seq
954500353 gbpln532.seq
944560088 gbpln533.seq
29467767 gbpln534.seq
395802172 gbpln535.seq
500000236 gbpln536.seq
499999344 gbpln537.seq
444123129 gbpln538.seq
499997994 gbpln539.seq
377219536 gbpln54.seq
499999500 gbpln540.seq
489207526 gbpln541.seq
499998489 gbpln542.seq
499741709 gbpln543.seq
499998535 gbpln544.seq
499999430 gbpln545.seq
500000145 gbpln546.seq
68479073 gbpln547.seq
375192640 gbpln55.seq
386441749 gbpln56.seq
496901336 gbpln57.seq
408713394 gbpln58.seq
476593700 gbpln59.seq
499992314 gbpln6.seq
434249982 gbpln60.seq
440487400 gbpln61.seq
444203819 gbpln62.seq
189178941 gbpln63.seq
460466746 gbpln64.seq
440542307 gbpln65.seq
452992006 gbpln66.seq
497916786 gbpln67.seq
480376128 gbpln68.seq
71745252 gbpln69.seq
499959124 gbpln7.seq
470938498 gbpln70.seq
490964263 gbpln71.seq
449178016 gbpln72.seq
472881526 gbpln73.seq
424121784 gbpln74.seq
434231712 gbpln75.seq
447914384 gbpln76.seq
498427579 gbpln77.seq
20012493 gbpln78.seq
449964742 gbpln79.seq
225235386 gbpln8.seq
422837725 gbpln80.seq
383453843 gbpln81.seq
376172115 gbpln82.seq
326317072 gbpln83.seq
320571252 gbpln84.seq
286199716 gbpln85.seq
277716231 gbpln86.seq
499733063 gbpln87.seq
37688177 gbpln88.seq
391026515 gbpln89.seq
499990067 gbpln9.seq
362500946 gbpln90.seq
390024684 gbpln91.seq
341773034 gbpln92.seq
199854530 gbpln93.seq
486884285 gbpln94.seq
461536811 gbpln95.seq
497242619 gbpln96.seq
455991285 gbpln97.seq
496692449 gbpln98.seq
41266897 gbpln99.seq
147984207 gbpri1.seq
499825450 gbpri10.seq
499978638 gbpri11.seq
248926180 gbpri12.seq
499853606 gbpri13.seq
317002520 gbpri14.seq
162642332 gbpri15.seq
494709737 gbpri16.seq
499956353 gbpri17.seq
499952905 gbpri18.seq
499962101 gbpri19.seq
499830358 gbpri2.seq
499976989 gbpri20.seq
18244945 gbpri21.seq
499987105 gbpri22.seq
499998525 gbpri23.seq
430418935 gbpri24.seq
499993635 gbpri25.seq
499998952 gbpri26.seq
316316671 gbpri27.seq
499986431 gbpri28.seq
461900289 gbpri29.seq
499891257 gbpri3.seq
314294173 gbpri30.seq
258775295 gbpri31.seq
499999774 gbpri32.seq
499999156 gbpri33.seq
499956230 gbpri34.seq
17504909 gbpri35.seq
499855390 gbpri4.seq
499729136 gbpri5.seq
393528728 gbpri6.seq
499802910 gbpri7.seq
499984764 gbpri8.seq
499967010 gbpri9.seq
493727 gbrel.txt
499890690 gbrod1.seq
499998660 gbrod10.seq
4074615 gbrod11.seq
499812135 gbrod12.seq
203924668 gbrod13.seq
499994704 gbrod14.seq
499997569 gbrod15.seq
499997035 gbrod16.seq
294123370 gbrod17.seq
395218033 gbrod18.seq
485622431 gbrod19.seq
499802341 gbrod2.seq
447177606 gbrod20.seq
401874104 gbrod21.seq
366906621 gbrod22.seq
178573599 gbrod23.seq
488460696 gbrod24.seq
424418862 gbrod25.seq
451727059 gbrod26.seq
499112036 gbrod27.seq
467946548 gbrod28.seq
425428799 gbrod29.seq
499880319 gbrod3.seq
380509124 gbrod30.seq
359291146 gbrod31.seq
441031541 gbrod32.seq
489661762 gbrod33.seq
301144399 gbrod34.seq
245696648 gbrod35.seq
444533022 gbrod36.seq
404900421 gbrod37.seq
350078681 gbrod38.seq
484303056 gbrod39.seq
499702715 gbrod4.seq
479115490 gbrod40.seq
486160129 gbrod41.seq
499960342 gbrod5.seq
80291490 gbrod6.seq
499846851 gbrod7.seq
499742719 gbrod8.seq
499945822 gbrod9.seq
500000046 gbsts1.seq
499998618 gbsts10.seq
433284460 gbsts11.seq
499996680 gbsts2.seq
38061494 gbsts3.seq
499998792 gbsts4.seq
499996883 gbsts5.seq
456729482 gbsts6.seq
499998288 gbsts7.seq
499997752 gbsts8.seq
21526219 gbsts9.seq
300830890 gbsyn1.seq
484840372 gbsyn10.seq
420813753 gbsyn11.seq
490139440 gbsyn12.seq
343340422 gbsyn13.seq
372527348 gbsyn14.seq
417861289 gbsyn15.seq
448312981 gbsyn16.seq
416378132 gbsyn17.seq
453065790 gbsyn18.seq
263307032 gbsyn19.seq
343340424 gbsyn2.seq
484840366 gbsyn20.seq
420813747 gbsyn21.seq
500000171 gbsyn22.seq
456181545 gbsyn23.seq
499993129 gbsyn24.seq
500000130 gbsyn25.seq
499999218 gbsyn26.seq
499991650 gbsyn27.seq
8170819 gbsyn28.seq
372527353 gbsyn3.seq
417861297 gbsyn4.seq
448312992 gbsyn5.seq
81377357 gbsyn6.seq
470781602 gbsyn7.seq
317285242 gbsyn8.seq
263307034 gbsyn9.seq
499999287 gbtsa1.seq
500000000 gbtsa10.seq
499997439 gbtsa100.seq
499999811 gbtsa101.seq
499996108 gbtsa102.seq
404671505 gbtsa103.seq
499996434 gbtsa104.seq
499998444 gbtsa105.seq
499998535 gbtsa106.seq
473627173 gbtsa107.seq
499999949 gbtsa108.seq
499997426 gbtsa109.seq
499997424 gbtsa11.seq
236376146 gbtsa110.seq
499999916 gbtsa111.seq
499999178 gbtsa112.seq
499998485 gbtsa113.seq
499999039 gbtsa114.seq
32605644 gbtsa115.seq
500000071 gbtsa116.seq
499996732 gbtsa117.seq
499998477 gbtsa118.seq
469116011 gbtsa119.seq
280130073 gbtsa12.seq
499999748 gbtsa120.seq
499999037 gbtsa121.seq
499998875 gbtsa122.seq
278733702 gbtsa123.seq
499999266 gbtsa124.seq
499999256 gbtsa125.seq
499998286 gbtsa126.seq
421530147 gbtsa127.seq
499996235 gbtsa13.seq
499999964 gbtsa14.seq
151618535 gbtsa15.seq
499999603 gbtsa16.seq
499996688 gbtsa17.seq
258373800 gbtsa18.seq
499997252 gbtsa19.seq
499998984 gbtsa2.seq
499998175 gbtsa20.seq
499998875 gbtsa21.seq
66356608 gbtsa22.seq
499999053 gbtsa23.seq
499997273 gbtsa24.seq
499999492 gbtsa25.seq
275956906 gbtsa26.seq
499999635 gbtsa27.seq
499999791 gbtsa28.seq
71311344 gbtsa29.seq
146878920 gbtsa3.seq
499998196 gbtsa30.seq
499999529 gbtsa31.seq
153218059 gbtsa32.seq
499998095 gbtsa33.seq
499996730 gbtsa34.seq
499999647 gbtsa35.seq
488666701 gbtsa36.seq
499999485 gbtsa37.seq
499997575 gbtsa38.seq
499998617 gbtsa39.seq
499998567 gbtsa4.seq
225919334 gbtsa40.seq
499999675 gbtsa41.seq
499991892 gbtsa42.seq
499998590 gbtsa43.seq
174944914 gbtsa44.seq
499998997 gbtsa45.seq
499999560 gbtsa46.seq
354820490 gbtsa47.seq
499999373 gbtsa48.seq
499997080 gbtsa49.seq
499999940 gbtsa5.seq
289649000 gbtsa50.seq
499999724 gbtsa51.seq
499999766 gbtsa52.seq
394617331 gbtsa53.seq
499998483 gbtsa54.seq
499998629 gbtsa55.seq
499998068 gbtsa56.seq
350275966 gbtsa57.seq
499999428 gbtsa58.seq
499999306 gbtsa59.seq
50314135 gbtsa6.seq
499998097 gbtsa60.seq
221419020 gbtsa61.seq
499999964 gbtsa62.seq
499999918 gbtsa63.seq
259941502 gbtsa64.seq
499999212 gbtsa65.seq
465402653 gbtsa66.seq
499998493 gbtsa67.seq
499998356 gbtsa68.seq
499996902 gbtsa69.seq
499998877 gbtsa7.seq
165103829 gbtsa70.seq
499997567 gbtsa71.seq
500000162 gbtsa72.seq
499998185 gbtsa73.seq
2512297 gbtsa74.seq
499997981 gbtsa75.seq
499998780 gbtsa76.seq
131354879 gbtsa77.seq
499998723 gbtsa78.seq
499997516 gbtsa79.seq
499999768 gbtsa8.seq
30973467 gbtsa80.seq
499999375 gbtsa81.seq
499998969 gbtsa82.seq
499999731 gbtsa83.seq
499998462 gbtsa84.seq
45716037 gbtsa85.seq
499997106 gbtsa86.seq
499998546 gbtsa87.seq
499998812 gbtsa88.seq
81423881 gbtsa89.seq
266838890 gbtsa9.seq
499999824 gbtsa90.seq
389215892 gbtsa91.seq
499998191 gbtsa92.seq
499994249 gbtsa93.seq
499998640 gbtsa94.seq
208350764 gbtsa95.seq
499995192 gbtsa96.seq
499998487 gbtsa97.seq
499999226 gbtsa98.seq
230571289 gbtsa99.seq
2179762 gbuna1.seq
499998934 gbvrl1.seq
499997440 gbvrl10.seq
217940728 gbvrl11.seq
499997691 gbvrl12.seq
499998485 gbvrl13.seq
133905481 gbvrl14.seq
499998454 gbvrl15.seq
499999839 gbvrl16.seq
314265825 gbvrl17.seq
499998275 gbvrl18.seq
499998000 gbvrl19.seq
499999424 gbvrl2.seq
345038299 gbvrl20.seq
499996820 gbvrl21.seq
499999778 gbvrl22.seq
368029194 gbvrl23.seq
499999215 gbvrl24.seq
499997091 gbvrl25.seq
312275717 gbvrl26.seq
499993485 gbvrl27.seq
499999514 gbvrl28.seq
456626458 gbvrl29.seq
370481383 gbvrl3.seq
499972061 gbvrl30.seq
499999818 gbvrl31.seq
403687069 gbvrl32.seq
499997149 gbvrl33.seq
499997707 gbvrl34.seq
361424476 gbvrl35.seq
500000088 gbvrl36.seq
499946839 gbvrl37.seq
499987318 gbvrl38.seq
405996655 gbvrl39.seq
499997372 gbvrl4.seq
499998494 gbvrl5.seq
499997979 gbvrl6.seq
499996838 gbvrl7.seq
301332719 gbvrl8.seq
499985418 gbvrl9.seq
499921524 gbvrt1.seq
289935612 gbvrt10.seq
339881206 gbvrt100.seq
404715122 gbvrt101.seq
489464189 gbvrt102.seq
499106075 gbvrt103.seq
486716913 gbvrt104.seq
58362214 gbvrt105.seq
436487263 gbvrt106.seq
486733599 gbvrt107.seq
492783918 gbvrt108.seq
423399209 gbvrt109.seq
87348323 gbvrt11.seq
280513212 gbvrt110.seq
475547766 gbvrt111.seq
480350778 gbvrt112.seq
495762194 gbvrt113.seq
63704590 gbvrt114.seq
979124861 gbvrt115.seq
838606404 gbvrt116.seq
678361887 gbvrt117.seq
476489691 gbvrt118.seq
461392781 gbvrt119.seq
499776413 gbvrt12.seq
438813789 gbvrt120.seq
394333916 gbvrt121.seq
313817861 gbvrt122.seq
288999337 gbvrt123.seq
280185755 gbvrt124.seq
407764323 gbvrt125.seq
421854186 gbvrt126.seq
478932645 gbvrt127.seq
480028007 gbvrt128.seq
438022009 gbvrt129.seq
284656236 gbvrt13.seq
174441466 gbvrt130.seq
487902327 gbvrt131.seq
456814552 gbvrt132.seq
462308829 gbvrt133.seq
168813991 gbvrt134.seq
455914575 gbvrt135.seq
469538684 gbvrt136.seq
479142159 gbvrt137.seq
211433853 gbvrt138.seq
481251522 gbvrt139.seq
15637437 gbvrt14.seq
475910668 gbvrt140.seq
366784880 gbvrt141.seq
464881586 gbvrt142.seq
697335097 gbvrt143.seq
670835450 gbvrt144.seq
524090200 gbvrt145.seq
413419773 gbvrt146.seq
345316791 gbvrt147.seq
329840736 gbvrt148.seq
250750064 gbvrt149.seq
36032850 gbvrt15.seq
486599684 gbvrt150.seq
364885005 gbvrt151.seq
448394467 gbvrt152.seq
471786712 gbvrt153.seq
393642536 gbvrt154.seq
355134416 gbvrt155.seq
470602746 gbvrt156.seq
448657488 gbvrt157.seq
384724558 gbvrt158.seq
432320923 gbvrt159.seq
18507952 gbvrt16.seq
470227786 gbvrt160.seq
497676594 gbvrt161.seq
441894493 gbvrt162.seq
496133395 gbvrt163.seq
382102573 gbvrt164.seq
431425246 gbvrt165.seq
474666330 gbvrt166.seq
479195821 gbvrt167.seq
352850318 gbvrt168.seq
479851070 gbvrt169.seq
497676663 gbvrt17.seq
497038176 gbvrt170.seq
432276498 gbvrt171.seq
439843808 gbvrt172.seq
469531790 gbvrt173.seq
496015817 gbvrt174.seq
488626307 gbvrt175.seq
432135676 gbvrt176.seq
70119528 gbvrt177.seq
491056051 gbvrt178.seq
457305144 gbvrt179.seq
497173924 gbvrt18.seq
478791561 gbvrt180.seq
450956856 gbvrt181.seq
68350586 gbvrt182.seq
490842556 gbvrt183.seq
463385772 gbvrt184.seq
446788975 gbvrt185.seq
438416202 gbvrt186.seq
170595769 gbvrt187.seq
451342688 gbvrt188.seq
474563355 gbvrt189.seq
481350583 gbvrt19.seq
461335548 gbvrt190.seq
436658187 gbvrt191.seq
154682616 gbvrt192.seq
456837606 gbvrt193.seq
488930196 gbvrt194.seq
466502331 gbvrt195.seq
455725140 gbvrt196.seq
453475816 gbvrt197.seq
462276007 gbvrt198.seq
497473221 gbvrt199.seq
499828586 gbvrt2.seq
400795564 gbvrt20.seq
499283767 gbvrt200.seq
481742871 gbvrt201.seq
101053743 gbvrt202.seq
450550965 gbvrt203.seq
494368803 gbvrt204.seq
470691314 gbvrt205.seq
470514883 gbvrt206.seq
229543959 gbvrt207.seq
499998361 gbvrt208.seq
499998514 gbvrt209.seq
488197715 gbvrt21.seq
328088568 gbvrt210.seq
479291185 gbvrt22.seq
480798341 gbvrt23.seq
499274554 gbvrt24.seq
483255170 gbvrt25.seq
484153821 gbvrt26.seq
65325604 gbvrt27.seq
4698304 gbvrt28.seq
14151693 gbvrt29.seq
460794981 gbvrt3.seq
21383246 gbvrt30.seq
90967413 gbvrt31.seq
499908979 gbvrt32.seq
499999489 gbvrt33.seq
499999158 gbvrt34.seq
55582539 gbvrt35.seq
499998756 gbvrt36.seq
499999469 gbvrt37.seq
364453291 gbvrt38.seq
499999406 gbvrt39.seq
179100370 gbvrt4.seq
443205691 gbvrt40.seq
499998115 gbvrt41.seq
28358817 gbvrt42.seq
443903861 gbvrt43.seq
499999479 gbvrt44.seq
386454853 gbvrt45.seq
499997380 gbvrt46.seq
278249169 gbvrt47.seq
499998961 gbvrt48.seq
497482842 gbvrt49.seq
448778544 gbvrt5.seq
488886836 gbvrt50.seq
487434008 gbvrt51.seq
497527342 gbvrt52.seq
396367123 gbvrt53.seq
202128841 gbvrt54.seq
123737443 gbvrt55.seq
483323044 gbvrt56.seq
481925504 gbvrt57.seq
499999199 gbvrt58.seq
499926681 gbvrt59.seq
490703641 gbvrt6.seq
296494910 gbvrt60.seq
491037858 gbvrt61.seq
492375887 gbvrt62.seq
479677491 gbvrt63.seq
480814553 gbvrt64.seq
362168611 gbvrt65.seq
490940681 gbvrt66.seq
475376599 gbvrt67.seq
489403698 gbvrt68.seq
352369869 gbvrt69.seq
499120716 gbvrt7.seq
465368608 gbvrt70.seq
488761954 gbvrt71.seq
189335727 gbvrt72.seq
443535502 gbvrt73.seq
421190409 gbvrt74.seq
391875588 gbvrt75.seq
372304558 gbvrt76.seq
293994257 gbvrt77.seq
265964554 gbvrt78.seq
252405654 gbvrt79.seq
483653444 gbvrt8.seq
496924908 gbvrt80.seq
428777944 gbvrt81.seq
385782563 gbvrt82.seq
401943336 gbvrt83.seq
480032615 gbvrt84.seq
474823439 gbvrt85.seq
480706138 gbvrt86.seq
89575236 gbvrt87.seq
435875138 gbvrt88.seq
487966705 gbvrt89.seq
263646987 gbvrt9.seq
497561523 gbvrt90.seq
468903694 gbvrt91.seq
1063697024 gbvrt92.seq
1045817107 gbvrt93.seq
754876349 gbvrt94.seq
616753639 gbvrt95.seq
490283567 gbvrt96.seq
470650802 gbvrt97.seq
397152541 gbvrt98.seq
351566465 gbvrt99.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 101568 185822423
BCT10 102 242799654
BCT100 83 222703364
BCT101 21 86233168
BCT102 68 221578114
BCT103 87 219795379
BCT104 87 223588406
BCT105 80 226287962
BCT106 20 45564131
BCT107 124 217933644
BCT108 53 217706139
BCT109 90 227492926
BCT11 149 243367132
BCT110 57 149506400
BCT111 93 227745457
BCT112 73 219469130
BCT113 112 221134503
BCT114 78 197436829
BCT115 155 218036729
BCT116 81 222575776
BCT117 79 216178706
BCT118 131 224258382
BCT119 101 223375525
BCT12 161 256952125
BCT120 83 225648312
BCT121 85 175376921
BCT122 115 225967887
BCT123 92 220409897
BCT124 158 214217907
BCT125 88 207032597
BCT126 140 220978157
BCT127 63 217844098
BCT128 90 214900948
BCT129 125 217101319
BCT13 170 237845538
BCT130 88 223616604
BCT131 21 65066945
BCT132 174 220602790
BCT133 125 222941413
BCT134 123 219745957
BCT135 166 221868080
BCT136 48 154061987
BCT137 104 218683705
BCT138 113 217389079
BCT139 138 222247056
BCT14 161 246345908
BCT140 109 220993944
BCT141 101 223667628
BCT142 118 156232056
BCT143 95 229134325
BCT144 104 222093509
BCT145 97 225368543
BCT146 116 220401677
BCT147 94 219188969
BCT148 134 220654115
BCT149 36 70525291
BCT15 189 252783255
BCT150 169 220902023
BCT151 100 223727909
BCT152 94 222167747
BCT153 93 209436870
BCT154 71 223304376
BCT155 123 228310888
BCT156 150 228808455
BCT157 80 212882661
BCT158 100 225798024
BCT159 96 228319555
BCT16 78 171407593
BCT160 139 223679571
BCT161 77 220323988
BCT162 20 67790727
BCT163 119 222290855
BCT164 153 228109372
BCT165 69 216057546
BCT166 80 115502557
BCT167 111 216184725
BCT168 156 227708035
BCT169 111 220250972
BCT17 135 236293491
BCT170 89 136614524
BCT171 133 229717687
BCT172 111 208992481
BCT173 99 217922433
BCT174 81 223178114
BCT175 10 9680111
BCT176 98 220152536
BCT177 132 227699493
BCT178 126 229823053
BCT179 118 247354286
BCT18 108 230497239
BCT180 116 233244770
BCT181 29 81157459
BCT182 138 219191771
BCT183 86 222769161
BCT184 108 224413134
BCT185 118 222428501
BCT186 67 117928221
BCT187 127 226982633
BCT188 135 255022614
BCT189 119 228641891
BCT19 195 220196232
BCT190 153 217483726
BCT191 42 78130485
BCT192 119 217568478
BCT193 116 219209582
BCT194 90 220191961
BCT195 103 232290071
BCT196 97 179603936
BCT197 97 234475408
BCT198 102 220656832
BCT199 100 218053674
BCT2 106 226909535
BCT20 192 222658099
BCT200 94 224743372
BCT201 104 226992367
BCT202 107 231904945
BCT203 65 141233235
BCT204 104 221661048
BCT205 111 222476358
BCT206 99 224960460
BCT207 71 266229652
BCT208 75 254647899
BCT209 106 225376718
BCT21 101 221119783
BCT210 176 219971681
BCT211 137 226750080
BCT212 52 97375579
BCT213 324 275336670
BCT214 116 218483965
BCT215 118 218157941
BCT216 40 65303441
BCT217 89 220099828
BCT218 85 224231671
BCT219 85 236035678
BCT22 46 222199974
BCT220 102 223628599
BCT221 20 45849980
BCT222 60 216868170
BCT223 120 221119124
BCT224 87 227479657
BCT225 89 224272827
BCT226 19 43569083
BCT227 160 280339359
BCT228 86 231776776
BCT229 96 219192196
BCT23 124 226663344
BCT230 135 191926241
BCT231 109 262921422
BCT232 72 217635148
BCT233 100 214909619
BCT234 76 205489624
BCT235 140 302426918
BCT236 68 237086992
BCT237 95 218513066
BCT238 151 222468975
BCT239 141 300447308
BCT24 480 123894684
BCT240 4 6239871
BCT241 146 273570514
BCT242 99 252747995
BCT243 36 235989283
BCT244 53 189184486
BCT245 117 221820560
BCT246 126 219675710
BCT247 87 248194832
BCT248 78 192276002
BCT249 125 215030391
BCT25 5200 7533877
BCT250 113 223212915
BCT251 136 232444902
BCT252 115 228305978
BCT253 109 224810056
BCT254 117 231775962
BCT255 3 7240707
BCT256 107 219875030
BCT257 82 219611284
BCT258 102 228755615
BCT259 116 222691123
BCT26 10402 13141863
BCT260 81 239709640
BCT261 106 231194258
BCT262 103 228251698
BCT263 16 24943843
BCT264 130 229051582
BCT265 160 213628166
BCT266 163 210208459
BCT267 124 243343666
BCT268 110 228491343
BCT269 148 242546113
BCT27 53918 202021542
BCT270 139 243548850
BCT271 14 59487275
BCT272 137 226969856
BCT273 98 213658574
BCT274 105 225085837
BCT275 108 222359121
BCT276 161 221726110
BCT277 154 219861074
BCT278 16 32786388
BCT279 117 225763925
BCT28 189 216139113
BCT280 101 221433957
BCT281 74 219522789
BCT282 88 215718059
BCT283 86 127852737
BCT284 88 244048892
BCT285 107 228886299
BCT286 83 221517737
BCT287 61 216100377
BCT288 75 170693762
BCT289 115 219540003
BCT29 103 228704622
BCT290 101 218974130
BCT291 124 216924787
BCT292 90 217527347
BCT293 140 185056878
BCT294 121 249554866
BCT295 107 217758362
BCT296 79 226344509
BCT297 83 221285570
BCT298 61 153744996
BCT299 128 238885544
BCT3 37537 123328135
BCT30 118 231551515
BCT300 197 234044756
BCT301 149 219659340
BCT302 119 215120175
BCT303 118 186704652
BCT304 146 245523582
BCT305 121 238271122
BCT306 69 224405406
BCT307 72 228738867
BCT308 128 240829934
BCT309 1239 227789019
BCT31 25 63062813
BCT310 98 230898208
BCT311 10 33593695
BCT312 101 222185425
BCT313 126 217279454
BCT314 105 213801865
BCT315 131 221253768
BCT316 229 225417816
BCT317 180 222566319
BCT318 107 218206544
BCT319 32 61473892
BCT32 103 220877412
BCT320 123 216507866
BCT321 143 220419853
BCT322 144 216203064
BCT323 121 229010250
BCT324 151 237086539
BCT325 95 236861391
BCT326 16 34763915
BCT327 112 224618597
BCT328 158 237900424
BCT329 111 218543270
BCT33 131 225261716
BCT330 133 229471134
BCT331 50 127234135
BCT332 124 231687890
BCT333 127 224545541
BCT334 65 223748986
BCT335 90 225437863
BCT336 164 212986837
BCT337 196 231397194
BCT338 119 253804643
BCT339 154 223922317
BCT34 119 219809790
BCT340 135 232831825
BCT341 96 252134919
BCT342 69 222864982
BCT343 51 216524547
BCT344 33 130047971
BCT345 95 217689329
BCT346 96 227449297
BCT347 164 254473443
BCT348 130 225150393
BCT349 113 216923939
BCT35 125 219253793
BCT350 19 36746323
BCT351 156 263720603
BCT352 518 232091131
BCT353 151 232262914
BCT354 141 242982036
BCT355 133 222701401
BCT356 56 147054248
BCT357 106 232584217
BCT358 86 223343387
BCT359 98 212844849
BCT36 128 223087901
BCT360 145 231721634
BCT361 81 144276388
BCT362 78 216827567
BCT363 117 227977163
BCT364 148 340731997
BCT365 94 259511080
BCT366 90 239474300
BCT367 115 228445667
BCT368 140 223207546
BCT369 96 229632100
BCT37 195 224497881
BCT370 127 222080666
BCT371 124 220735128
BCT372 29 21770866
BCT373 109 226436819
BCT374 94 227769582
BCT375 162 223156863
BCT376 108 241256758
BCT377 108 226962098
BCT378 29 104252829
BCT379 104 222217040
BCT38 26 45760778
BCT380 135 242192326
BCT381 98 217100247
BCT382 117 220387992
BCT383 128 219233005
BCT384 91 222987659
BCT385 95 247708995
BCT386 98 226078954
BCT387 105 218483485
BCT388 98 255997536
BCT389 165 207504666
BCT39 255 228290103
BCT390 146 184612710
BCT391 238 214458452
BCT392 125 212654863
BCT393 82 221857780
BCT394 123 277618698
BCT395 58 131331972
BCT396 93 239043122
BCT397 138 229306670
BCT398 113 228176935
BCT399 111 216298421
BCT4 41293 139254430
BCT40 96 216108910
BCT400 32 66800399
BCT401 179 216844123
BCT402 137 220302786
BCT403 137 219015620
BCT404 204 215927605
BCT405 146 77560548
BCT406 364 210657095
BCT407 102 211461184
BCT408 150 211743935
BCT409 171 217617270
BCT41 102 220149568
BCT410 155 217038415
BCT411 175 211972095
BCT412 161 208257957
BCT413 162 212193463
BCT414 114 210605338
BCT415 157 213126972
BCT416 132 209356669
BCT417 131 195243107
BCT418 183 210687290
BCT419 116 210811583
BCT42 139 223015436
BCT420 136 211390441
BCT421 175 221508733
BCT422 106 227445716
BCT423 113 220914586
BCT424 117 219496429
BCT425 207 242252347
BCT426 116 114925464
BCT427 528 115589384
BCT428 1589 2511957
BCT429 3172 5268484
BCT43 106 222031667
BCT430 6338 7796395
BCT431 12613 14997690
BCT432 25523 27672494
BCT433 50567 54073229
BCT434 148983 156776008
BCT435 14100 193457229
BCT436 3297 203942569
BCT437 2225 213237796
BCT438 47415 187676809
BCT439 75143 183095042
BCT44 161 220965710
BCT440 11016 200055156
BCT441 24933 203173459
BCT442 142320 153138921
BCT443 149317 156958096
BCT444 84382 88037803
BCT445 144671 151203346
BCT446 25798 25435884
BCT447 132663 167651157
BCT448 31354 43379422
BCT449 116364 178821904
BCT45 133 221316823
BCT450 7346 16771629
BCT451 32918 52997908
BCT452 23669 268344278
BCT453 5957 253983929
BCT454 5035 225442726
BCT455 3847 224092509
BCT456 1446 272628098
BCT457 105 221757820
BCT458 55 216742189
BCT459 70 215321341
BCT46 113 217939824
BCT460 33 131631016
BCT461 69 224394912
BCT462 364 238323955
BCT463 814 289036163
BCT464 274 83685207
BCT465 1274 200945958
BCT466 525 242585986
BCT467 128 386127365
BCT468 1046 304847332
BCT469 2536 248149935
BCT47 121 223996906
BCT470 1762 224388819
BCT471 3 6157503
BCT472 86 222746849
BCT473 78 227354684
BCT474 3017 245920958
BCT475 1230 124242115
BCT476 1412 261424764
BCT477 47 241352896
BCT478 45 243003094
BCT479 2180 269716913
BCT48 131 218725866
BCT480 945 54278114
BCT481 2274 268989543
BCT482 83 274582043
BCT483 420 283034189
BCT484 3014 245273795
BCT485 11931 19896835
BCT486 25176 41978637
BCT487 118558 189019736
BCT488 118228 189836883
BCT489 124873 199965145
BCT49 108 235209053
BCT490 23223 50876244
BCT5 20648 169648440
BCT50 128 222344558
BCT51 66 100806997
BCT52 95 230912422
BCT53 117 227983621
BCT54 160 232898310
BCT55 154 221704284
BCT56 128 238275556
BCT57 114 230664549
BCT58 54 123393656
BCT59 300 239582260
BCT6 2600 37759883
BCT60 142 231562727
BCT61 354 225466658
BCT62 111 222896198
BCT63 121 213352666
BCT64 120 227473574
BCT65 98 224926366
BCT66 90 224039666
BCT67 98 222023332
BCT68 58 138528232
BCT69 53 211054879
BCT7 1310 133308362
BCT70 45 210584326
BCT71 45 210864282
BCT72 45 212727898
BCT73 76 222861078
BCT74 40 115080869
BCT75 112 227959956
BCT76 129 231316827
BCT77 99 245428056
BCT78 87 223381451
BCT79 59 181990919
BCT8 191 234251938
BCT80 93 237302287
BCT81 104 227492621
BCT82 62 225930570
BCT83 63 136095527
BCT84 97 233623581
BCT85 82 229505918
BCT86 100 238937572
BCT87 24 34605217
BCT88 94 226656782
BCT89 118 229172918
BCT9 134 239086592
BCT90 127 232212861
BCT91 90 178403076
BCT92 114 212138354
BCT93 75 222053892
BCT94 112 225347102
BCT95 124 217786851
BCT96 3 5977905
BCT97 246 222256023
BCT98 104 221252195
BCT99 100 224644129
ENV1 189981 141874014
ENV10 186256 146038716
ENV11 209753 130994983
ENV12 177054 144862769
ENV13 155459 156526671
ENV14 250295 68810895
ENV15 87156 20071142
ENV16 220965 118700470
ENV17 255780 108833770
ENV18 202929 127147527
ENV19 22334 22042399
ENV2 163118 154109685
ENV20 152294 158746707
ENV21 201148 103384208
ENV22 68252 51339840
ENV23 213342 108929449
ENV24 170946 153801403
ENV25 135008 163682432
ENV26 11518 15692640
ENV27 179957 128306357
ENV28 218066 118482218
ENV29 78466 41725138
ENV3 51880 226612605
ENV30 143993 98017210
ENV31 100659 112292261
ENV32 130020 79921199
ENV33 173945 138872013
ENV34 165401 138569080
ENV35 177094 112198251
ENV36 200966 107312873
ENV37 196348 109592996
ENV38 111366 97690266
ENV39 158076 134832496
ENV4 79715 197172035
ENV40 145109 136793572
ENV41 169000 47751037
ENV42 172206 133132061
ENV43 211030 100432858
ENV44 142288 62174042
ENV45 216478 84259840
ENV46 212756 92644974
ENV47 108060 43424295
ENV48 224555 98849841
ENV49 224552 91869138
ENV5 159286 118078445
ENV50 141109 91005462
ENV51 198727 110751303
ENV52 179663 90408574
ENV53 204331 108835215
ENV54 6796 3398069
ENV55 137316 181877594
ENV56 228330 110851442
ENV57 223595 98441603
ENV58 4142 1185064
ENV59 194803 112108416
ENV6 218987 102585490
ENV60 125934 173220412
ENV61 59052 235093385
ENV62 40437 88100847
ENV7 176387 159893490
ENV8 19543 17055080
ENV9 204710 124203913
EST1 152690 59075604
EST10 155848 67145433
EST100 152900 76533879
EST101 145310 99404929
EST102 145327 85609978
EST103 149133 92918372
EST104 6678 3969414
EST105 149700 109472275
EST106 135201 99323583
EST107 136256 97451505
EST108 136283 94853558
EST109 2281 1508086
EST11 163604 69204453
EST110 137039 77376129
EST111 176769 106148584
EST112 193813 119045227
EST113 235878 141017018
EST114 7153 4398563
EST115 228229 127103651
EST116 183114 103694875
EST117 191632 94586043
EST118 3390 2617463
EST119 148776 100418839
EST12 150663 64729921
EST120 154737 119075941
EST121 166401 98014596
EST122 21716 15235645
EST123 130041 82536108
EST124 83544 30919585
EST125 36755 12481213
EST126 84106 31034635
EST127 84264 34515269
EST128 33711 11378339
EST129 85031 32709177
EST13 186795 83522118
EST130 82017 34968192
EST131 83454 35266094
EST132 84118 32965334
EST133 14468 5903340
EST134 83460 51063090
EST135 173736 87642690
EST136 170524 77715429
EST137 146469 92469833
EST138 28299 17873426
EST139 141402 87644345
EST14 104646 47789359
EST140 149169 98038750
EST141 157781 78491749
EST142 180949 92632171
EST143 7807 4567592
EST144 141653 76089811
EST145 151601 73212586
EST146 148400 87046777
EST147 155941 83671468
EST148 11479 6769132
EST149 166189 102138931
EST15 197356 111644310
EST150 202212 107328947
EST151 158884 93297129
EST152 102213 51068199
EST153 156473 79478757
EST154 135464 80316582
EST155 141411 87993125
EST156 166643 86165156
EST157 7537 4352491
EST158 179043 104198048
EST159 218733 94430895
EST16 147207 104729580
EST160 145774 85841747
EST161 161649 87789494
EST162 2683 1273073
EST163 141208 82864856
EST164 133292 84275790
EST165 147172 88147413
EST166 146199 80311563
EST167 19658 9971321
EST168 117769 61073260
EST169 115690 61941713
EST17 156552 83419127
EST170 122419 54128062
EST171 121107 48630686
EST172 29423 11431564
EST173 122215 48678047
EST174 125704 48478849
EST175 165762 83297359
EST176 172200 75566895
EST177 24700 15540223
EST178 147743 104364925
EST179 163429 99358064
EST18 191244 116974070
EST180 205284 116217156
EST181 167204 93396394
EST182 154084 103356716
EST183 134246 92945359
EST184 10653 5946360
EST185 146778 94225559
EST186 155073 81015985
EST187 131997 71132556
EST188 160937 90625260
EST189 12973 8196510
EST19 177593 113222957
EST190 148391 87401995
EST191 153611 95444734
EST192 175584 99196287
EST193 140448 77038260
EST194 5542 4509600
EST195 124098 64355359
EST196 163129 91083402
EST197 172923 99397463
EST198 149966 93107453
EST199 5575 3516018
EST2 157296 60515696
EST20 70514 55347428
EST200 165648 79426994
EST201 122447 84557335
EST202 163883 96574839
EST203 163910 95924410
EST204 12958 6236595
EST205 5847 2580354
EST206 111214 63111892
EST207 151296 87160332
EST208 107004 63421283
EST209 164716 101071760
EST21 194718 109379150
EST210 168459 124870746
EST211 82054 66695266
EST212 186353 95082816
EST213 145812 90577718
EST214 86904 65310717
EST215 142201 85383081
EST216 138332 75186486
EST217 94883 30485372
EST218 146949 86297456
EST219 149236 82715857
EST22 180131 92525151
EST220 141193 94333672
EST221 156025 90299220
EST222 8570 6132529
EST223 162128 99670103
EST224 153937 93688513
EST225 123359 88331804
EST226 145974 90182708
EST227 6794 4112514
EST228 129109 82213321
EST229 127974 89760637
EST23 106728 50178019
EST230 44066 31667399
EST231 156430 83332027
EST232 167399 92029681
EST233 166930 92691512
EST234 158124 88082424
EST235 163896 91508682
EST236 163228 92242200
EST237 166033 91294921
EST238 154891 85088026
EST239 168030 90687163
EST24 191052 61413874
EST240 187909 98489047
EST241 191640 107206156
EST242 168052 100159582
EST243 180324 103395206
EST244 190067 112774100
EST245 186313 113300888
EST246 177976 115378463
EST247 6774 5366330
EST248 140681 86100991
EST249 212269 139255055
EST25 136493 39205181
EST250 224139 109445086
EST251 164077 113921229
EST252 183152 95755613
EST253 198082 98538516
EST254 122211 89202303
EST255 5592 3806885
EST256 140265 82389799
EST257 206490 112904568
EST258 162417 106268822
EST259 94108 93119220
EST26 102352 27613958
EST260 14631 19056566
EST261 147747 99274549
EST262 151103 89971001
EST263 139494 102032068
EST264 217388 99711626
EST265 2734 1874907
EST266 134214 96874320
EST267 131014 91582085
EST268 135743 98224674
EST269 113667 81487104
EST27 201622 85286892
EST270 14870 9390607
EST271 136074 84237789
EST272 126197 86196946
EST273 128323 97050498
EST274 35670 25454263
EST275 126754 89472101
EST276 116718 79174411
EST277 139495 84170357
EST278 145826 114776899
EST279 14813 10436163
EST28 19493 8764926
EST280 125388 117381359
EST281 132659 98909184
EST282 162562 97730338
EST283 165651 104454173
EST284 18826 11791989
EST285 142295 92460345
EST286 169036 115171128
EST287 151612 103866108
EST288 136563 103388843
EST289 3122 2012582
EST29 204108 100212775
EST290 159550 97230714
EST291 222471 90724791
EST292 152859 111337310
EST293 160411 71793266
EST294 10529 1190647
EST295 208923 37984366
EST296 212167 83253891
EST297 150191 115332672
EST298 168072 97738207
EST299 154877 103184165
EST3 156029 54736569
EST30 216063 108845959
EST300 169072 109984637
EST301 149584 109939896
EST302 1975 1335588
EST303 180875 102305456
EST304 178791 93163079
EST305 168899 109550180
EST306 158882 104101268
EST307 2135 1704887
EST308 226903 106725089
EST309 267202 116187840
EST31 153987 67134151
EST310 184609 111769181
EST311 149924 28237311
EST312 230065 100576835
EST313 174888 100151227
EST314 156386 99990555
EST315 158540 94407905
EST316 166394 114093378
EST317 179942 95197248
EST318 143687 97189386
EST319 188156 110324042
EST32 149541 63744943
EST320 187345 49208208
EST321 201870 33894008
EST322 174443 95509500
EST323 14472 9105625
EST324 158346 113326097
EST325 184784 110470367
EST326 167586 97771795
EST327 165650 109621452
EST328 165922 71417216
EST329 127843 80161184
EST33 165218 65709042
EST330 121728 80853125
EST331 146606 101299104
EST332 21746 7720907
EST333 250640 26635193
EST334 254708 23392102
EST335 151991 94206454
EST336 152235 98594976
EST337 151209 99840551
EST338 145954 92203211
EST339 237889 43423093
EST34 147099 64547696
EST340 185433 81237254
EST341 3685 4554017
EST342 169321 100001066
EST343 163485 100908119
EST344 145649 92756666
EST345 189916 103387744
EST346 155962 109693704
EST347 153571 101545456
EST348 1864 707553
EST349 184471 108452053
EST35 162713 70911147
EST350 169894 94651816
EST351 169250 105165467
EST352 178308 59602870
EST353 195038 71941256
EST354 194528 75305704
EST355 197065 74426894
EST356 135405 70508640
EST357 174836 127386098
EST358 148407 85117807
EST359 150566 86648213
EST36 160500 65842690
EST360 122052 95387840
EST361 5228 4156832
EST362 143577 94945899
EST363 155634 94558686
EST364 162062 90080072
EST365 157801 100316004
EST366 21621 9602251
EST367 45656 24624838
EST368 155318 104549016
EST369 137850 97037511
EST37 107955 33687683
EST370 158528 102036132
EST371 153057 110091631
EST372 29680 25288248
EST373 173564 146756127
EST374 163573 85433530
EST375 128159 81338884
EST376 137895 94127120
EST377 50612 35397347
EST378 131619 88276056
EST379 137447 89871154
EST38 99514 30487965
EST380 139754 97233001
EST381 147706 97347466
EST382 49930 40332362
EST383 164182 86552371
EST384 143622 81415127
EST385 144915 86073821
EST386 144157 103713157
EST387 155646 93181756
EST388 138127 87591810
EST389 133463 84875714
EST39 99152 31401585
EST390 19252 11819086
EST391 196902 107235645
EST392 137014 75086496
EST393 92962 54579752
EST394 120675 80303449
EST395 23099 14175362
EST396 131518 83245448
EST397 119611 76575368
EST398 147508 80760259
EST399 210532 82594640
EST4 142933 56343102
EST40 98817 29785816
EST400 29791 12543861
EST401 163649 84380495
EST402 163929 99177970
EST403 159177 95841266
EST404 125633 81071284
EST405 12450 8163608
EST406 129141 86476992
EST407 137033 89905278
EST408 178976 112236854
EST409 154128 93135231
EST41 39222 11595646
EST410 28333 12277799
EST411 166745 92047209
EST412 168862 124889078
EST413 87364 56108523
EST414 69679 41103486
EST415 34092 16783013
EST416 137530 79965946
EST417 82413 49409226
EST418 139766 56852944
EST419 148868 30145933
EST42 101326 31351096
EST420 148732 30447498
EST421 163273 80663592
EST422 26173 14136342
EST423 201222 115845880
EST424 237755 108748183
EST425 220202 107509766
EST426 127047 74475061
EST427 128057 85803248
EST428 131704 80409324
EST429 93228 56881081
EST43 102633 36243427
EST430 173975 110008863
EST431 213501 84775693
EST432 106339 28485828
EST433 184754 112765379
EST434 204073 111451758
EST435 178856 105573885
EST436 197595 116862339
EST437 134477 63096462
EST438 110830 60475088
EST439 163287 109043698
EST44 95475 48218258
EST440 182140 116752022
EST441 106403 84554937
EST442 177181 139826371
EST443 150386 90557227
EST444 53982 34345685
EST445 166520 107182981
EST446 178543 101235231
EST447 42175 24141500
EST448 195798 106768392
EST449 185317 95089728
EST45 121121 52335541
EST450 50433 37888207
EST451 189934 115836172
EST452 180026 118008074
EST453 54535 33956141
EST454 196677 133946397
EST455 218252 122876729
EST456 191464 127720063
EST457 184004 144689626
EST458 204243 156003038
EST459 192710 115536227
EST46 55810 33167886
EST460 161445 96690107
EST461 181214 94252913
EST462 6221 516980
EST463 53496 4381716
EST464 158232 12239421
EST465 144975 12987161
EST466 148608 30079541
EST467 149063 29643665
EST468 7062 1471579
EST469 148744 30417064
EST47 177065 89170482
EST470 141959 81858084
EST471 172662 101047129
EST472 161391 110665996
EST473 16965 12150641
EST474 160968 92911974
EST475 150622 104098642
EST476 133699 93222175
EST477 141788 98123147
EST478 16075 8262115
EST479 157380 103682725
EST48 158217 65104402
EST480 146153 105108584
EST481 162010 97565605
EST482 165902 51041233
EST483 12075 1898567
EST484 160517 40369185
EST485 151959 102983430
EST486 149516 98088273
EST487 170713 111736796
EST488 17955 10002926
EST489 132815 75920561
EST49 162352 92229006
EST490 189716 107933724
EST491 149564 109198403
EST492 53155 36073998
EST493 126855 87064282
EST494 145709 90286473
EST495 148633 89486839
EST496 163483 89070769
EST497 35259 17962765
EST498 151814 92135788
EST499 156231 92108182
EST5 162094 62614875
EST50 154203 80120373
EST500 168660 102139232
EST501 136390 85619035
EST502 15232 8453667
EST503 100274 71184924
EST504 78633 60626261
EST505 97623 64860807
EST506 143664 80553208
EST507 36770 20999127
EST508 120992 73607850
EST509 133540 87501363
EST51 156506 74874317
EST510 135574 79506177
EST511 152825 93053797
EST512 44831 24810594
EST513 155676 85797389
EST514 184807 110595728
EST515 121358 79430510
EST516 178199 94655647
EST517 4663 1735339
EST518 52576 18674859
EST519 183566 101186007
EST52 108103 61120240
EST520 152045 81312605
EST521 22159 13415636
EST522 162316 94446797
EST523 211757 123975299
EST524 29664 19024876
EST525 147952 99622109
EST526 158950 98067836
EST527 134310 87388255
EST528 129803 88585688
EST529 24481 15268552
EST53 153908 88947693
EST530 179560 74468277
EST531 179108 79600547
EST532 198743 83525940
EST533 194777 80469363
EST534 3399 1184710
EST535 178841 95307232
EST536 174444 102485197
EST537 180225 107869574
EST538 171856 103650134
EST539 197056 126802532
EST54 154293 84993684
EST540 186220 103229406
EST541 178860 82786794
EST542 146160 93442201
EST543 206771 125126638
EST544 205624 126733200
EST545 194291 113936766
EST546 197936 113918089
EST547 154091 96436815
EST548 187948 117407713
EST549 166670 98999925
EST55 152223 92300142
EST550 133843 98243253
EST551 8876 7222302
EST552 157285 92184364
EST553 170556 85010427
EST554 149108 85057667
EST555 151186 81955201
EST556 11761 7024059
EST557 156517 79983850
EST558 181361 106397624
EST559 162545 103085348
EST56 149911 69862704
EST560 175369 108186389
EST561 3227 2163095
EST562 170744 117107232
EST563 183920 113640835
EST564 129040 83662465
EST565 169422 97775191
EST566 184559 110497798
EST567 34599 22589324
EST568 204465 119127975
EST569 269542 91763948
EST57 142238 76745964
EST570 25664 9425377
EST571 262943 83717893
EST572 157489 57559627
EST573 162302 59144545
EST574 80395 30734692
EST58 151729 83212808
EST59 161295 65822492
EST6 166275 65040988
EST60 144394 70073562
EST61 160487 90001957
EST62 150493 92644578
EST63 150083 99330860
EST64 157769 94520045
EST65 2307 970564
EST66 154957 103559420
EST67 163155 82983914
EST68 166584 84965551
EST69 141947 77582568
EST7 163878 67751506
EST70 148486 82582643
EST71 149152 86202189
EST72 148770 92334607
EST73 150781 87651832
EST74 2421 1413907
EST75 29919 18235506
EST76 186810 102879363
EST77 170462 90743046
EST78 212601 115726606
EST79 179452 103378064
EST8 160911 67789464
EST80 2020 1372932
EST81 196745 121640362
EST82 167627 93384513
EST83 136175 63354978
EST84 128096 62641861
EST85 10912 5586839
EST86 150434 92651323
EST87 154703 97020497
EST88 130185 66307353
EST89 140318 89371875
EST9 169422 69381975
EST90 14221 7368767
EST91 183554 91946533
EST92 204555 119869140
EST93 201962 107955235
EST94 191956 90364467
EST95 204075 87104446
EST96 145909 86980407
EST97 137871 84933955
EST98 158560 76393126
EST99 9280 6073374
GSS1 172834 126576577
GSS10 14910 14401612
GSS100 169261 144380017
GSS101 157745 108933470
GSS102 155986 106345499
GSS103 152475 105542661
GSS104 168005 122783070
GSS105 149829 126592844
GSS106 162068 125197053
GSS107 186640 116036674
GSS108 16014 9794559
GSS109 185786 119804494
GSS11 146507 107094841
GSS110 201450 104020421
GSS111 219926 124042541
GSS112 87280 56947051
GSS113 152300 114320098
GSS114 155174 118808877
GSS115 155139 118868834
GSS116 163490 106671356
GSS117 36986 21467879
GSS118 179848 132289982
GSS119 189894 117148040
GSS12 200839 104097643
GSS120 166036 55080797
GSS121 170071 76702837
GSS122 2028 1303403
GSS123 161778 105245778
GSS124 189210 124956394
GSS125 200987 81591982
GSS126 166850 79919427
GSS127 137307 94457298
GSS128 129872 104613764
GSS129 132040 108783227
GSS13 192061 84602304
GSS130 132451 106046726
GSS131 8003 5920029
GSS132 135214 112032054
GSS133 56598 47104660
GSS134 132584 107786768
GSS135 139149 116140565
GSS136 140043 114408742
GSS137 138251 109584898
GSS138 4155 2820771
GSS139 134784 106426486
GSS14 173249 89238431
GSS140 134049 108003847
GSS141 134400 111531585
GSS142 138188 116474348
GSS143 4675 3643453
GSS144 139468 108106612
GSS145 136810 113648547
GSS146 136898 113473892
GSS147 137299 112649085
GSS148 559 466085
GSS149 137155 110923756
GSS15 167983 83930679
GSS150 134480 106278327
GSS151 133002 107665198
GSS152 138659 116136290
GSS153 1985 1674795
GSS154 127182 92203837
GSS155 174275 105162567
GSS156 184914 110237552
GSS157 162345 108755150
GSS158 176892 102083573
GSS159 197105 129369627
GSS16 160060 81615096
GSS160 201456 133367764
GSS161 200727 134041970
GSS162 179380 125427766
GSS163 198341 136948587
GSS164 196713 139067120
GSS165 196065 138672070
GSS166 174298 134353538
GSS167 144791 97546246
GSS168 138200 80523134
GSS169 165330 73398615
GSS17 156174 85673627
GSS170 129814 57820242
GSS171 163014 141019316
GSS172 170950 113527672
GSS173 80812 52920567
GSS174 191881 129015715
GSS175 196554 117983862
GSS176 28456 14940540
GSS177 180225 98140530
GSS178 181302 123365801
GSS179 178800 126906476
GSS18 152981 95677320
GSS180 181098 127179984
GSS181 19114 12799890
GSS182 165902 130533276
GSS183 170977 155597399
GSS184 219919 123799690
GSS185 216581 103401654
GSS186 17290 8049466
GSS187 210015 95106166
GSS188 156579 134385514
GSS189 6807 6749646
GSS19 153777 72780066
GSS190 125540 102753347
GSS191 122235 93469471
GSS192 156847 154495780
GSS193 167720 158232911
GSS194 131396 104305071
GSS195 149360 107958474
GSS196 170325 141788280
GSS197 174263 119970230
GSS198 20136 11688868
GSS199 181316 133971324
GSS2 173590 107820141
GSS20 106476 59071274
GSS200 184911 120117379
GSS201 180126 93029105
GSS202 172829 121726073
GSS203 189216 117024741
GSS204 189414 116726891
GSS205 21729 12651457
GSS206 200615 129990067
GSS207 215712 142629172
GSS208 217635 140382802
GSS209 166429 136402995
GSS21 132536 64638951
GSS210 152471 108703336
GSS211 160065 120654204
GSS212 160039 145460383
GSS213 158365 140331734
GSS214 160859 145750229
GSS215 162431 144534355
GSS216 163049 142910892
GSS217 159417 122903915
GSS218 168345 139695448
GSS219 161743 115993986
GSS22 125191 56725897
GSS220 180530 88689585
GSS221 2575 1768585
GSS222 251369 52150506
GSS223 262481 40466091
GSS224 262523 40408947
GSS225 122800 38229504
GSS226 253355 52912344
GSS227 182565 86129448
GSS228 189053 56109501
GSS229 154111 118306719
GSS23 134196 73094577
GSS230 177033 144334259
GSS231 160568 145787944
GSS232 159531 147010793
GSS233 174549 109955224
GSS234 238210 57319690
GSS235 198151 101373468
GSS236 229425 39759432
GSS237 119092 74589582
GSS238 174029 112048984
GSS239 147879 90055083
GSS24 143035 74371292
GSS240 140666 84082420
GSS241 159798 149653267
GSS242 5874 5001697
GSS243 112668 95722541
GSS244 180351 149222837
GSS245 172954 122407496
GSS246 201906 127716652
GSS247 188210 120275961
GSS248 166175 94403497
GSS249 159875 84508026
GSS25 12092 5172754
GSS250 156434 119873333
GSS251 203514 148104231
GSS252 14295 9396358
GSS253 171523 67875770
GSS254 176683 96454754
GSS255 195475 152072364
GSS256 199776 154504000
GSS257 7495 6183699
GSS258 197814 157230621
GSS259 197524 124135449
GSS26 140902 65659537
GSS260 194960 142651188
GSS261 609 420698
GSS262 214911 131530338
GSS263 189958 57638710
GSS264 218598 111928830
GSS265 170488 153872948
GSS266 163848 150141940
GSS267 234900 132469628
GSS268 220564 118386800
GSS27 159863 79841194
GSS28 156780 92817384
GSS29 165484 85429638
GSS3 138093 115755794
GSS30 9311 4809210
GSS31 171978 102877480
GSS32 182794 109078835
GSS33 182358 87083745
GSS34 172892 102148238
GSS35 191042 104301903
GSS36 162180 112295088
GSS37 160410 98257518
GSS38 173347 108755067
GSS39 3659 2625600
GSS4 140176 112446194
GSS40 183985 122974505
GSS41 181701 117299100
GSS42 52326 27358639
GSS43 177832 102911728
GSS44 164530 141989063
GSS45 179635 148565674
GSS46 139660 92477151
GSS47 182857 132009511
GSS48 181604 114543954
GSS49 204426 116967818
GSS5 11597 8660962
GSS50 185612 99477863
GSS51 211954 108037045
GSS52 211747 108318359
GSS53 197315 132797049
GSS54 158211 124808059
GSS55 185589 139410158
GSS56 196775 63134337
GSS57 171826 96464104
GSS58 157611 106106204
GSS59 23373 13575160
GSS6 152749 116375726
GSS60 166616 156645100
GSS61 177157 98801574
GSS62 161196 115202462
GSS63 172331 112351434
GSS64 173858 117792409
GSS65 184258 127655843
GSS66 205711 128748730
GSS67 189998 113287440
GSS68 200686 134224634
GSS69 215702 158336970
GSS7 170888 120025042
GSS70 189038 138024221
GSS71 173742 107642623
GSS72 198219 111980277
GSS73 140725 76414851
GSS74 163079 95884017
GSS75 10697 6814502
GSS76 159270 97756741
GSS77 159481 96970229
GSS78 172285 114351414
GSS79 170749 109399099
GSS8 177211 109005139
GSS80 174370 122402741
GSS81 188944 105262393
GSS82 174817 125816528
GSS83 164286 106564471
GSS84 1704 1352882
GSS85 189623 108718187
GSS86 182037 114287366
GSS87 167146 118346285
GSS88 193343 106201902
GSS89 7220 4213495
GSS9 141891 118699622
GSS90 213933 107583686
GSS91 227285 89235627
GSS92 213465 139505605
GSS93 182539 91847418
GSS94 94686 37020965
GSS95 193805 75823638
GSS96 201086 123394316
GSS97 191020 122180795
GSS98 156116 139401502
GSS99 16660 10968419
HTC1 41206 63404125
HTC2 32318 72275691
HTC3 32080 77890442
HTC4 84836 50647832
HTC5 129901 161568308
HTC6 124887 122728899
HTC7 137620 130764902
HTC8 62396 53929827
HTG1 3784 374870703
HTG10 2848 363016285
HTG11 1976 365940103
HTG12 1714 382089084
HTG13 1718 381796340
HTG14 1659 383118453
HTG15 1835 380424998
HTG16 1750 361896240
HTG17 1843 380599315
HTG18 1752 382301790
HTG19 1775 381824019
HTG2 5068 373604329
HTG20 1891 380883515
HTG21 2135 355865123
HTG22 2426 376351102
HTG23 2269 379507879
HTG24 2442 381163865
HTG25 2175 382733656
HTG26 2070 368006459
HTG27 2074 380458182
HTG28 2061 380108509
HTG29 1047 202962639
HTG3 2556 370662362
HTG30 2040 379446758
HTG31 2203 375546591
HTG32 986 170706729
HTG33 2152 379221269
HTG34 2348 376393195
HTG35 1372 195850538
HTG36 2462 370234045
HTG37 2428 372528369
HTG38 1015 169191937
HTG39 2235 381490266
HTG4 2735 369989641
HTG40 2336 385145188
HTG41 1069 180930974
HTG42 2312 384776536
HTG43 2363 384490832
HTG44 906 155597869
HTG45 2500 379735659
HTG46 2319 385244375
HTG47 927 158722850
HTG48 2315 385567657
HTG49 2293 386023883
HTG5 2500 373389217
HTG50 900 149450476
HTG51 2237 385154833
HTG52 2106 380011723
HTG53 657 122585305
HTG54 2010 379525743
HTG55 1981 378955508
HTG56 1184 193581815
HTG57 2144 380658486
HTG58 2686 383430148
HTG59 2973 383248998
HTG6 2 386956
HTG60 884 128257683
HTG61 2959 380503057
HTG62 3012 366231486
HTG63 2990 372824610
HTG64 2953 336850403
HTG65 3178 359117111
HTG66 3179 359260560
HTG67 3185 360470245
HTG68 3128 367751420
HTG69 2904 377632818
HTG7 2327 375791086
HTG70 1764 299443585
HTG71 3420 365501690
HTG72 2072 381349721
HTG73 1669 298368668
HTG74 2088 382520375
HTG75 2244 384445864
HTG76 1669 296247510
HTG77 2201 385233869
HTG78 2249 384504439
HTG79 3219 384192102
HTG8 1500 384347777
HTG80 2166 384708164
HTG81 3033 373087380
HTG82 1920 201675445
HTG9 1582 384062276
INV1 154218 140988705
INV10 14 359428768
INV11 9 363281720
INV12 45 381339161
INV13 17 391129107
INV14 7 343527847
INV15 27035 350981565
INV16 126018 101872192
INV17 167341 134486799
INV18 126646 112156476
INV19 37136 273256295
INV2 2286 315524754
INV20 131138 159758922
INV21 93677 76212871
INV22 28889 325575169
INV23 102829 206004223
INV24 147314 102167991
INV25 148928 103585680
INV26 153130 117037796
INV27 118241 81152301
INV28 155145 113576333
INV29 153826 120376695
INV3 104934 182074324
INV30 53029 35450854
INV31 152932 109457750
INV32 153571 115647847
INV33 36878 31829972
INV34 141599 88524971
INV35 147896 93706227
INV36 43606 33295033
INV37 148226 97306068
INV38 139035 81416256
INV39 42996 25488394
INV4 59054 272781510
INV40 138453 82788298
INV41 138177 82838190
INV42 53389 35294208
INV43 139132 83451035
INV44 135510 99043960
INV45 74473 58283929
INV46 142231 108270928
INV47 151740 119976346
INV48 155716 119171525
INV49 91628 221108145
INV5 37209 48817604
INV50 183035 236941459
INV51 216228 165877386
INV52 38629 187147326
INV53 800 42674647
INV54 566 40635863
INV55 8037 115580217
INV56 23329 332915377
INV57 23255 171962006
INV58 68041 305365919
INV59 123287 266863020
INV6 129081 165754653
INV60 64375 76908791
INV61 180571 237306452
INV62 41592 302727004
INV63 311 394019569
INV64 1008 100305774
INV65 1563 383238927
INV66 2 41011863
INV67 542 361595061
INV68 8 378508614
INV69 845 354182410
INV7 207 346774014
INV70 6 380479040
INV71 2 95552909
INV72 22 390382246
INV73 10043 159298619
INV74 1 536602846
INV75 1 685423969
INV76 1 640667275
INV77 1 639123876
INV78 1 612949391
INV79 1 577192767
INV8 85 322154899
INV80 1 641629864
INV81 1961 368038177
INV82 9041 297612995
INV83 21624 302797482
INV84 19041 14060620
INV85 149115 105518438
INV86 153075 93976442
INV87 79400 46151813
INV88 151528 93733257
INV89 151754 110144108
INV9 3 136766944
INV90 54273 46774362
INV91 152318 123926018
INV92 151670 118569900
INV93 152043 114905533
INV94 135436 144124028
INV95 14295 53636308
MAM1 34361 321461081
MAM10 26813 24993452
MAM11 13731 20581276
MAM12 3445 7368868
MAM13 107 699953
MAM14 20 277696380
MAM15 1 249270926
MAM16 2 343930246
MAM17 3 325384739
MAM18 1 90795278
MAM19 4 322903327
MAM2 20251 275417549
MAM20 4 298795355
MAM21 6 353843759
MAM22 5 329700903
MAM23 2 289079565
MAM24 3 348530310
MAM25 4 336581445
MAM26 5 375256260
MAM27 6 373952570
MAM28 8 377813420
MAM29 5 379300313
MAM3 2 316219032
MAM30 1 38035513
MAM31 5 285741626
MAM32 5 342804543
MAM33 8 370485433
MAM34 6 316655225
MAM35 4 238884849
MAM36 4 355768297
MAM37 6 355037276
MAM38 7 389945117
MAM39 6 319172640
MAM4 2 376685399
MAM40 5 323047396
MAM41 4 347221982
MAM42 5 288444151
MAM43 5 375232988
MAM44 13 249854952
MAM45 54 7614329
MAM46 215 34073042
MAM47 431 71272130
MAM48 861 68509101
MAM49 1706 2411269
MAM5 2 295769989
MAM50 6836 6159435
MAM51 110526 193401624
MAM52 146745 135845720
MAM53 118675 168111581
MAM54 21925 23317139
MAM55 1 716413629
MAM56 1 662751787
MAM57 1 611347268
MAM58 1 464895054
MAM59 1 288121652
MAM6 2 385026516
MAM60 3 338107697
MAM61 1 223449203
MAM62 1 210645437
MAM63 1 201318998
MAM64 1 197708286
MAM65 2 320231256
MAM66 2 293750401
MAM67 3 367535284
MAM68 4 351244600
MAM69 367 269065793
MAM7 3 316699161
MAM70 1 203623556
MAM71 2 383513587
MAM72 4 383666147
MAM73 5 381503248
MAM74 1697 391939678
MAM75 66778 270594583
MAM76 25777 32349546
MAM8 5 343489620
MAM9 933 216317382
PAT1 420092 157379621
PAT10 304145 130867951
PAT100 352852 189327041
PAT101 310862 206556098
PAT102 261889 226571161
PAT103 130469 96637053
PAT104 304402 217824161
PAT105 276793 236021165
PAT106 255575 243191966
PAT107 219302 91982645
PAT108 185527 168151315
PAT109 194778 145579485
PAT11 235972 217033990
PAT110 98093 55999755
PAT111 244010 110313663
PAT112 143102 226374942
PAT113 78461 27196701
PAT114 88280 271848690
PAT115 224871 124891536
PAT116 225583 104856368
PAT117 1414 4459822
PAT118 247765 75673289
PAT119 230776 33741646
PAT12 83502 75729157
PAT120 94886 123403652
PAT121 98574 119749391
PAT122 81936 115812708
PAT123 203208 107726817
PAT124 26044 9049668
PAT125 203753 100524714
PAT126 183498 80758866
PAT127 117398 19496465
PAT128 249637 208803922
PAT129 386159 114654006
PAT13 242994 211781414
PAT130 52433 7531865
PAT131 283991 180138336
PAT132 123569 298383437
PAT133 110179 303201848
PAT134 393178 122403578
PAT135 291009 159034483
PAT136 12314 8288567
PAT137 287141 182646284
PAT138 409360 14039521
PAT139 496812 33315384
PAT14 328334 148441988
PAT140 525210 7878150
PAT141 153458 3896573
PAT142 377421 123804728
PAT143 245701 106298543
PAT144 259895 238802744
PAT145 4634 392128968
PAT146 190899 207809354
PAT147 308470 120437803
PAT148 140528 153756176
PAT149 6430 91690961
PAT15 63672 1591800
PAT150 177885 181303248
PAT151 71549 185117590
PAT152 75797 115785873
PAT153 75754 115777597
PAT154 46228 38672101
PAT155 245587 68642890
PAT156 201626 63081611
PAT157 264572 57807553
PAT158 309595 83974457
PAT159 458714 54677491
PAT16 197494 165327046
PAT160 227775 118065838
PAT161 360562 132720074
PAT162 287901 50205964
PAT163 154028 4621518
PAT164 229296 77215858
PAT165 228262 72764716
PAT166 281032 19059194
PAT167 63881 6660379
PAT168 153383 170227500
PAT169 73417 134980723
PAT17 217877 141825891
PAT170 74139 123431457
PAT171 137229 84274353
PAT172 175192 2627880
PAT173 234159 99508566
PAT174 198451 145145451
PAT175 89448 118154807
PAT176 175762 91489210
PAT177 289925 11005010
PAT178 135330 2029950
PAT179 278538 10765362
PAT18 217763 104542668
PAT180 99590 135915739
PAT181 220910 105875731
PAT182 23917 35278529
PAT183 143999 206566501
PAT184 173285 186742155
PAT185 70129 243259642
PAT186 6542 8869371
PAT187 137168 133366031
PAT188 136595 204924448
PAT189 208590 98959368
PAT19 238917 105580979
PAT190 284111 31395194
PAT191 26257 42269195
PAT192 264589 66935450
PAT193 227269 82111943
PAT194 179588 5746816
PAT195 203543 143065481
PAT196 72786 37541240
PAT197 268658 230373189
PAT198 282624 222310160
PAT199 192664 139614235
PAT2 329706 203014025
PAT20 217530 131791446
PAT200 276098 235021090
PAT201 188385 291326630
PAT202 137484 196232251
PAT203 247191 246690030
PAT204 11728 387687504
PAT205 313354 152356909
PAT206 244602 252477336
PAT207 160029 300870611
PAT208 215545 135077252
PAT209 172971 290885692
PAT21 295509 53592192
PAT210 266027 215707025
PAT211 388068 123028502
PAT212 208476 41955373
PAT22 146922 94654137
PAT23 196052 155778288
PAT24 279900 73148417
PAT25 228134 147576888
PAT26 209293 140264044
PAT27 62574 53738469
PAT28 304663 206977404
PAT29 321047 202868622
PAT3 50139 20256441
PAT30 69606 127456844
PAT31 217213 274043600
PAT32 399532 38379558
PAT33 255767 169058622
PAT34 232488 137932347
PAT35 62180 29243455
PAT36 159610 193120910
PAT37 187244 152014323
PAT38 212002 134509422
PAT39 97873 9820208
PAT4 329563 180389506
PAT40 349668 21562100
PAT41 269131 102155190
PAT42 166 390395449
PAT43 7285 386170321
PAT44 91553 5256860
PAT45 304606 19422510
PAT46 304621 19407682
PAT47 188194 183531683
PAT48 31101 33389761
PAT49 100023 274297096
PAT5 261970 200081780
PAT50 347921 22045153
PAT51 356635 6776065
PAT52 92422 1756018
PAT53 351488 15876269
PAT54 360979 6858601
PAT55 133551 2537469
PAT56 360626 6851894
PAT57 359974 6839506
PAT58 125418 2711844
PAT59 535700 100616524
PAT6 217552 164400590
PAT60 111356 330233433
PAT61 289774 158820679
PAT62 481511 50384210
PAT63 225627 89296915
PAT64 254622 194677034
PAT65 328398 204068799
PAT66 171634 140652198
PAT67 349862 190728733
PAT68 612603 75778089
PAT69 132887 40797313
PAT7 247431 122525335
PAT70 484033 127126269
PAT71 126354 109119371
PAT72 150168 307250321
PAT73 318626 211710240
PAT74 51881 214846609
PAT75 189165 289007376
PAT76 317843 207880789
PAT77 123868 129694058
PAT78 342751 192409991
PAT79 362616 180214431
PAT8 224342 103164038
PAT80 20467 17346132
PAT81 311143 212599739
PAT82 414691 138165335
PAT83 481329 57361173
PAT84 327289 49350302
PAT85 456882 82651653
PAT86 157572 115867974
PAT87 167229 186393240
PAT88 316359 151157174
PAT89 224143 179688474
PAT9 153245 77997239
PAT90 160741 40019110
PAT91 548289 10417491
PAT92 499577 9491963
PAT93 509422 32511534
PAT94 211221 45759082
PAT95 257694 203241576
PAT96 388324 141427300
PAT97 39430 44100894
PAT98 361773 186862184
PAT99 415062 154422395
PHG1 8919 215885820
PHG2 4447 221143529
PHG3 5545 216097226
PHG4 2462 129444748
PLN1 135246 172319848
PLN10 18921 157294990
PLN100 37 16871
PLN101 149 79314
PLN102 2469 93786416
PLN103 7181 18795412
PLN104 14346 29953091
PLN105 97797 209443460
PLN106 129345 89969141
PLN107 159106 148395673
PLN108 162946 146632061
PLN109 57340 31220002
PLN11 29377 278503063
PLN110 181662 125850093
PLN111 49813 255589519
PLN112 41703 287605797
PLN113 71413 107590451
PLN114 98644 85504678
PLN115 49729 72847341
PLN116 25061 110565816
PLN117 13561 89764040
PLN118 1 774434471
PLN119 8305 28494037
PLN12 2655 333939338
PLN120 1861 361385154
PLN121 5 372618381
PLN122 6 372447772
PLN123 6 368295254
PLN124 12434 261982605
PLN125 175450 124272636
PLN126 23459 15735853
PLN127 148592 156365042
PLN128 149770 145547120
PLN129 85707 71290289
PLN13 37 329935405
PLN130 154511 132764397
PLN131 164242 118600682
PLN132 22412 25521817
PLN133 146800 135187077
PLN134 121879 152300810
PLN135 167354 121831188
PLN136 115332 120249917
PLN137 133956 150295547
PLN138 101626 120092426
PLN139 136047 150064943
PLN14 46 124218893
PLN140 126663 163326583
PLN141 120605 166392541
PLN142 19184 17464875
PLN143 124603 164377844
PLN144 113102 172811831
PLN145 83310 156344160
PLN146 119124 172429961
PLN147 91354 192599848
PLN148 11193 354296686
PLN149 18851 95968324
PLN15 9 366014477
PLN150 19737 363518883
PLN151 10199 333647910
PLN152 302 288936846
PLN153 5 324373291
PLN154 1340 370278471
PLN155 1271 1160350
PLN156 342 386037290
PLN157 8 179149947
PLN158 886 232040685
PLN159 1 522466905
PLN16 2394 340343722
PLN160 1 675310294
PLN161 1 628753756
PLN162 1 624247919
PLN163 1 599018945
PLN164 1 573247234
PLN165 1 634667502
PLN166 12381 359628384
PLN167 11 349691620
PLN168 43 363356916
PLN169 235 366467862
PLN17 1949 233857567
PLN170 9 335385998
PLN171 27 308914810
PLN172 2 317663561
PLN173 1 192140685
PLN174 1 279860179
PLN175 1 259520967
PLN176 2 294703259
PLN177 1 238633233
PLN178 1 162496318
PLN179 1 420743833
PLN18 3 330514248
PLN180 41 92088865
PLN181 16 383095167
PLN182 6 120796436
PLN183 1 541700351
PLN184 1 696809892
PLN185 1 655542733
PLN186 1 648987779
PLN187 1 622068216
PLN188 1 583456046
PLN189 1 654005093
PLN19 19710 239328876
PLN190 98 274330
PLN191 1 522466905
PLN192 1 675310294
PLN193 1 628753756
PLN194 1 624247919
PLN195 1 599018945
PLN196 1 573247234
PLN197 1 634667502
PLN198 260 94757770
PLN199 1 521073757
PLN2 39226 283346200
PLN20 96587 101382138
PLN200 1 672273650
PLN201 1 634137895
PLN202 1 624121443
PLN203 1 607506942
PLN204 1 564293627
PLN205 1 632401812
PLN206 1 520603772
PLN207 1 661076038
PLN208 1 626572591
PLN209 1 612852138
PLN21 113433 117616150
PLN210 1 598896166
PLN211 1 570629545
PLN212 1 623813090
PLN213 1 513014082
PLN214 1 653624577
PLN215 1 616219606
PLN216 1 610044819
PLN217 1 583417444
PLN218 1 550735148
PLN219 1 620104558
PLN22 57311 72144580
PLN220 1 523168208
PLN221 1 671211297
PLN222 1 630677708
PLN223 1 623428415
PLN224 1 604298040
PLN225 1 558526623
PLN226 1 628419988
PLN227 1 500012378
PLN228 1 648922534
PLN229 1 604770208
PLN23 28689 28922869
PLN230 1 597403059
PLN231 1 576456374
PLN232 1 556080982
PLN233 1 603311816
PLN234 1 512023576
PLN235 1 652551272
PLN236 1 615767531
PLN237 1 605571303
PLN238 1 592249714
PLN239 1 549757368
PLN24 2648 194594881
PLN240 1 616509610
PLN241 1 550024188
PLN242 1 710194481
PLN243 1 661081403
PLN244 1 659460550
PLN245 1 630572514
PLN246 1 598618390
PLN247 1 658974642
PLN248 1 559656399
PLN249 1 717517502
PLN25 344 254550430
PLN250 1 672450454
PLN251 1 665297378
PLN252 1 636785599
PLN253 1 599706080
PLN254 1 675658265
PLN255 1 495661851
PLN256 1 640830439
PLN257 1 597781253
PLN258 1 600363860
PLN259 1 570178053
PLN26 400 261235914
PLN260 1 534998810
PLN261 1 616598997
PLN262 1 537457279
PLN263 1 685947972
PLN264 1 649921694
PLN265 1 641099225
PLN266 1 611845738
PLN267 1 581041262
PLN268 1 655783664
PLN269 1 521174834
PLN27 198 168828441
PLN270 1 667717957
PLN271 1 631819663
PLN272 1 624692602
PLN273 1 597351075
PLN274 1 561737938
PLN275 1 629651422
PLN276 1 524514255
PLN277 1 670202054
PLN278 1 631946783
PLN279 1 626743494
PLN28 298 258873545
PLN280 1 600801835
PLN281 1 566971015
PLN282 1 629827058
PLN283 1 522114480
PLN284 1 671530377
PLN285 1 631910401
PLN286 1 622474059
PLN287 1 598240357
PLN288 1 562137082
PLN289 1 633805855
PLN29 339 265493888
PLN290 1 525723083
PLN291 1 684336246
PLN292 1 636053469
PLN293 1 629969872
PLN294 1 604087610
PLN295 1 568600391
PLN296 1 640498578
PLN297 1 519546829
PLN298 1 665715246
PLN299 1 624683667
PLN3 3695 380536593
PLN30 485 350911896
PLN300 1 621078253
PLN301 1 600910593
PLN302 1 558953701
PLN303 1 626840912
PLN304 1 543344542
PLN305 1 697540743
PLN306 1 655862368
PLN307 1 646765634
PLN308 1 618540729
PLN309 1 587963859
PLN31 112 80604200
PLN310 1 658085510
PLN311 33 378260111
PLN312 15 312691008
PLN313 8 111507617
PLN314 1 596211899
PLN315 1 705338699
PLN316 1 493450010
PLN317 1 804285258
PLN318 1 810734643
PLN319 1 673981989
PLN32 455 379563194
PLN320 1 754496630
PLN321 1 855759449
PLN322 1 614042580
PLN323 1 743847818
PLN324 1 673340788
PLN325 1 515668560
PLN326 1 713320806
PLN327 1 703598484
PLN328 1 570159854
PLN329 1 625793224
PLN33 127 379253996
PLN330 1 721110502
PLN331 1 459355444
PLN332 1 745201001
PLN333 1 749284433
PLN334 1 643344672
PLN335 1 595297365
PLN336 1 688905267
PLN337 1 491807393
PLN338 1 769338634
PLN339 1 671568023
PLN34 91 241350431
PLN340 1 635285330
PLN341 1 745618965
PLN342 1 839470345
PLN343 1 646400022
PLN344 1 747589525
PLN345 1 665179885
PLN346 1 506585010
PLN347 1 703962928
PLN348 1 702438406
PLN349 1 568126671
PLN35 107 353068716
PLN350 1 610851963
PLN351 1 707596419
PLN352 1 465558328
PLN353 1 734536914
PLN354 1 738743901
PLN355 1 636778132
PLN356 1 602900890
PLN357 1 697493198
PLN358 1 490518203
PLN359 1 784661008
PLN36 21 391404607
PLN360 1 810500911
PLN361 1 655314739
PLN362 1 752710991
PLN363 1 890847171
PLN364 1 621781073
PLN365 1 743084022
PLN366 1 676741658
PLN367 1 509452426
PLN368 1 710124532
PLN369 1 480767623
PLN37 229 244592824
PLN370 1 578021311
PLN371 1 620140791
PLN372 1 716573881
PLN373 1 476726550
PLN374 1 756324664
PLN375 1 977471539
PLN376 1 642207261
PLN377 1 502612092
PLN378 1 646234737
PLN379 1 605172934
PLN38 181 340210184
PLN380 1 593744788
PLN381 1 571972453
PLN382 1 545472572
PLN383 1 607667504
PLN384 1 590561804
PLN385 1 685720839
PLN386 1 490910922
PLN387 1 782694893
PLN388 1 796420183
PLN389 1 650274702
PLN39 12 380640183
PLN390 1 739889549
PLN391 1 848590828
PLN392 1 610626473
PLN393 1 738023571
PLN394 1 667607564
PLN395 1 506274898
PLN396 1 701434008
PLN397 1 690770133
PLN398 1 567265955
PLN399 1 612987783
PLN4 3520 387672190
PLN40 26 364323699
PLN400 1 704156067
PLN401 1 475327881
PLN402 1 732118298
PLN403 1 733931846
PLN404 1 636796232
PLN405 1 599764323
PLN406 1 691313424
PLN407 1 493357854
PLN408 1 782685093
PLN409 1 786410271
PLN41 6 339659276
PLN410 1 648139033
PLN411 1 744407562
PLN412 1 835583350
PLN413 1 623221719
PLN414 1 741299132
PLN415 1 669032550
PLN416 1 517040482
PLN417 1 711661679
PLN418 1 708205786
PLN419 1 573398137
PLN42 4 249554057
PLN420 1 583494258
PLN421 1 707105489
PLN422 1 471251328
PLN423 1 737453356
PLN424 1 736349413
PLN425 1 639162162
PLN426 1 586755746
PLN427 1 704478343
PLN428 1 492109999
PLN429 1 791475352
PLN43 93 388494695
PLN430 1 785940626
PLN431 1 661246824
PLN432 1 756990402
PLN433 1 858776195
PLN434 1 621195942
PLN435 1 754256086
PLN436 1 670301833
PLN437 1 509263899
PLN438 1 708234589
PLN439 1 725120110
PLN44 15 373888800
PLN440 1 575129590
PLN441 1 620883766
PLN442 1 727285804
PLN443 1 479660269
PLN444 1 745978486
PLN445 1 750160716
PLN446 1 642428577
PLN447 1 591313643
PLN448 1 705330581
PLN449 1 495656580
PLN45 9 363551984
PLN450 1 803232604
PLN451 1 790745243
PLN452 1 657494025
PLN453 1 759305888
PLN454 1 856542542
PLN455 1 628321883
PLN456 1 754364263
PLN457 1 697113365
PLN458 1 504254270
PLN459 1 715354979
PLN46 60 374148929
PLN460 1 713929667
PLN461 1 572943128
PLN462 1 626959190
PLN463 1 715714221
PLN464 1 483823121
PLN465 1 742917797
PLN466 1 748536659
PLN467 1 643784981
PLN468 1 600654286
PLN469 1 685083685
PLN47 14 212654302
PLN470 1 486317123
PLN471 1 794150360
PLN472 1 799857935
PLN473 1 655329108
PLN474 1 749763888
PLN475 1 838116175
PLN476 1 610468321
PLN477 1 736551279
PLN478 1 666328382
PLN479 1 504826275
PLN48 74 124609184
PLN480 1 702606209
PLN481 1 467876140
PLN482 1 566465558
PLN483 1 614421429
PLN484 1 698878671
PLN485 1 480431564
PLN486 1 735408736
PLN487 1 969998116
PLN488 1 635024734
PLN489 16360 7336435
PLN49 8 358353307
PLN490 5636 1862075
PLN491 5224 2478918
PLN492 1 563502314
PLN493 2014 4567060
PLN494 1 594102056
PLN495 1 689851870
PLN496 1 495453186
PLN497 1 780798557
PLN498 1 801256715
PLN499 1 651852609
PLN5 97732 200907168
PLN50 3 347496433
PLN500 1 750843639
PLN501 1 830829764
PLN502 1 615552423
PLN503 1 744588157
PLN504 1 673617499
PLN505 1 509857067
PLN506 1 709773743
PLN507 1 713149757
PLN508 1 566080677
PLN509 1 618079260
PLN51 4 370651368
PLN510 1 720988478
PLN511 1 473592718
PLN512 1 736706236
PLN513 1 750620385
PLN514 1 638686055
PLN515 1 480980714
PLN516 6629 330538619
PLN517 3760 370633860
PLN518 10097 326490424
PLN519 1739 12306627
PLN52 2 271593360
PLN520 1 585266722
PLN521 1 681112512
PLN522 1 775448786
PLN523 1 790338525
PLN524 1 746673839
PLN525 1 836514780
PLN526 1 736872137
PLN527 1 676292951
PLN528 1 669155517
PLN529 1 701372996
PLN53 1 150766190
PLN530 1 615672275
PLN531 1 698614761
PLN532 1 728031845
PLN533 1 722970987
PLN534 12266 8463745
PLN535 94349 139656935
PLN536 108843 180123922
PLN537 90750 197604511
PLN538 74933 185700051
PLN539 99340 190981516
PLN54 2 288204953
PLN540 103302 186450748
PLN541 97873 190820125
PLN542 90192 203760922
PLN543 102873 187762827
PLN544 81156 214459619
PLN545 71984 218631891
PLN546 91857 208445584
PLN547 12203 26347653
PLN55 2 286787940
PLN56 2 295931502
PLN57 41 379963265
PLN58 7 322635309
PLN59 7 376229618
PLN6 111716 128158776
PLN60 6 342806685
PLN61 6 347730275
PLN62 6 350661716
PLN63 43 144640005
PLN64 144 326417895
PLN65 7 298887356
PLN66 6 332369654
PLN67 50 340388796
PLN68 34 333743749
PLN69 1 48961553
PLN7 64133 184834120
PLN70 176 319207187
PLN71 6 349441353
PLN72 5 315927722
PLN73 6 337181162
PLN74 5 299052774
PLN75 13 295635548
PLN76 5 292734482
PLN77 60 337527719
PLN78 8 9715909
PLN79 2 355063454
PLN8 21748 106778457
PLN80 1 333667882
PLN81 1 302574826
PLN82 1 296818136
PLN83 1 257455782
PLN84 1 252943167
PLN85 1 225803546
PLN86 1 219123305
PLN87 2 394302667
PLN88 25 17999201
PLN89 15 305289289
PLN9 35233 291274408
PLN90 2 286029496
PLN91 2 307738366
PLN92 2 269669619
PLN93 1 157681923
PLN94 8 372679169
PLN95 14 358536578
PLN96 50 392296317
PLN97 79 333907880
PLN98 105 333332560
PLN99 18 24366262
PRI1 23038 59778442
PRI10 2265 387936439
PRI11 4375 381729455
PRI12 2069 191983096
PRI13 2459 391020768
PRI14 17185 217620811
PRI15 27929 79132073
PRI16 96050 166265556
PRI17 11025 363947920
PRI18 3741 383223079
PRI19 15303 353911286
PRI2 23838 319338979
PRI20 59152 259982661
PRI21 3806 7249854
PRI22 53142 193855733
PRI23 87999 233147013
PRI24 90506 166078696
PRI25 74330 199952244
PRI26 54430 215567543
PRI27 34621 144331188
PRI28 69718 214226791
PRI29 93587 171383428
PRI3 2613 370370379
PRI30 1 229594237
PRI31 1 190673448
PRI32 9369 358514136
PRI33 48803 210961465
PRI34 101115 191718450
PRI35 1089 12062371
PRI4 2409 360399901
PRI5 2593 353874487
PRI6 2112 282951291
PRI7 2729 356953890
PRI8 3181 362167571
PRI9 2423 385530941
ROD1 38431 309733257
ROD10 15332 351795437
ROD11 1044 1485319
ROD12 22214 347968493
ROD13 1002 157743814
ROD14 53466 238707384
ROD15 21658 310382782
ROD16 228387 97434634
ROD17 96802 64970926
ROD18 36885 244261075
ROD19 2 383374219
ROD2 1810 346957759
ROD20 2 353017828
ROD21 2 317259772
ROD22 2 289653994
ROD23 1 140975125
ROD24 3 385591618
ROD25 4 335044383
ROD26 5 356599364
ROD27 2 394024503
ROD28 2 369416674
ROD29 2 335852806
ROD3 1885 352024250
ROD30 2 300392300
ROD31 2 283621167
ROD32 3 348161973
ROD33 5 386542915
ROD34 5 237722395
ROD35 1 193958709
ROD36 2 350925653
ROD37 2 319641744
ROD38 2 276360533
ROD39 3 382322699
ROD4 1943 360884621
ROD40 4 378225564
ROD41 67331 259333998
ROD5 1990 363733749
ROD6 306 57843793
ROD7 1975 368354297
ROD8 1990 369693686
ROD9 1959 368016559
STS1 170465 86854641
STS10 202214 61354897
STS11 167033 59462982
STS2 143549 63344935
STS3 8241 4837486
STS4 108725 63673512
STS5 110379 70040590
STS6 106166 81423611
STS7 122523 86626565
STS8 198745 60874215
STS9 8948 2429703
SYN1 54442 100617525
SYN10 2 382762979
SYN11 2 332214168
SYN12 4 386933112
SYN13 1 271050050
SYN14 2 294093621
SYN15 3 329883353
SYN16 4 353920981
SYN17 2 328712085
SYN18 4 357672913
SYN19 1 207870274
SYN2 1 271050050
SYN20 2 382762979
SYN21 2 332214168
SYN22 550 392407673
SYN23 65804 185101409
SYN24 9183 352928592
SYN25 17219 334476572
SYN26 109228 160414221
SYN27 32635 299225636
SYN28 1083 4077397
SYN3 2 294093621
SYN4 3 329883353
SYN5 4 353920981
SYN6 1 64242768
SYN7 3 371658272
SYN8 2 250483958
SYN9 1 207870274
TSA1 233380 79653983
TSA10 168620 151882439
TSA100 63252 114802277
TSA101 79841 41351312
TSA102 82721 28609319
TSA103 67721 19747702
TSA104 84021 22863253
TSA105 84236 21912832
TSA106 84446 20981295
TSA107 134042 46621688
TSA108 155667 149676184
TSA109 183762 101150200
TSA11 157833 129928381
TSA110 47316 107437033
TSA111 136931 166476864
TSA112 166663 125028887
TSA113 97439 238063556
TSA114 99621 234258577
TSA115 12096 5797980
TSA116 134299 172499287
TSA117 127822 180391048
TSA118 129653 177320123
TSA119 120977 167690794
TSA12 96970 81223522
TSA120 161752 123773928
TSA121 122463 187577773
TSA122 148092 145309800
TSA123 94145 61033986
TSA124 136345 168539405
TSA125 159333 125157880
TSA126 156667 125822948
TSA127 123052 121148961
TSA13 144445 166877725
TSA14 183430 128404479
TSA15 63704 19333264
TSA16 207559 109270376
TSA17 186915 104023410
TSA18 49380 65170400
TSA19 154786 149639718
TSA2 222501 88764704
TSA20 217000 100217335
TSA21 206229 104285391
TSA22 22275 12385671
TSA23 159463 127641062
TSA24 173240 148979716
TSA25 215107 83751466
TSA26 105264 74950797
TSA27 172910 71716168
TSA28 221930 89798997
TSA29 26888 19147632
TSA3 74593 22546411
TSA30 206110 106021139
TSA31 179811 146674399
TSA32 67801 29056436
TSA33 188249 126080028
TSA34 147266 171548953
TSA35 162994 142851570
TSA36 149877 161586478
TSA37 167355 152088001
TSA38 141407 134166635
TSA39 170803 157995856
TSA4 200107 117397278
TSA40 68091 94849454
TSA41 171892 122248327
TSA42 190077 128883583
TSA43 179568 129766485
TSA44 74709 42505780
TSA45 179837 148961559
TSA46 157618 110427650
TSA47 134614 95382384
TSA48 185173 132793697
TSA49 208467 104145310
TSA5 215390 134315100
TSA50 79060 109863998
TSA51 193326 109684073
TSA52 179856 119164458
TSA53 111895 116975633
TSA54 155188 135994981
TSA55 161488 91817715
TSA56 130888 143857547
TSA57 137093 81293196
TSA58 155281 162331143
TSA59 162871 156980202
TSA6 15756 19456676
TSA60 194209 122378904
TSA61 57557 94587557
TSA62 173905 118336916
TSA63 151865 162169607
TSA64 60980 124236262
TSA65 201109 152115772
TSA66 185638 143700395
TSA67 163423 121712708
TSA68 182114 137377481
TSA69 170731 97712914
TSA7 194553 54897033
TSA70 40637 38146354
TSA71 119065 123313318
TSA72 131964 141438855
TSA73 151655 115933671
TSA74 830 251943
TSA75 152989 102336522
TSA76 156503 143538644
TSA77 40595 33645981
TSA78 177556 139010934
TSA79 162022 159228390
TSA8 158334 121004747
TSA80 10510 8595284
TSA81 185669 115791752
TSA82 143419 147913350
TSA83 177759 145455461
TSA84 159235 177039745
TSA85 17013 11869134
TSA86 168307 128893220
TSA87 156344 150391937
TSA88 195418 125564755
TSA89 31945 22564229
TSA9 98089 68621619
TSA90 196286 138439609
TSA91 112986 113189975
TSA92 98986 206634893
TSA93 87112 229168164
TSA94 77344 247719367
TSA95 30093 107285833
TSA96 141044 144633048
TSA97 106079 76616395
TSA98 74427 65411867
TSA99 33717 32835466
UNA1 678 679302
VRL1 132456 138755430
VRL10 120581 138866022
VRL11 50915 63700809
VRL12 114073 144984831
VRL13 112614 147928192
VRL14 26308 44243606
VRL15 90937 158540660
VRL16 96773 150149662
VRL17 60716 99338630
VRL18 92378 166040016
VRL19 91131 163958602
VRL2 127481 150673455
VRL20 53898 120815995
VRL21 83104 172853812
VRL22 86062 167238696
VRL23 69291 118644244
VRL24 83141 167450828
VRL25 83186 167553898
VRL26 50044 111273073
VRL27 80490 210024995
VRL28 76985 189968423
VRL29 72189 169820171
VRL3 98669 103262084
VRL30 68030 182015752
VRL31 77016 186472235
VRL32 61723 148107302
VRL33 75397 192092856
VRL34 82743 172544038
VRL35 63361 120093924
VRL36 79850 171864258
VRL37 48931 193853087
VRL38 18492 216219546
VRL39 35697 162272447
VRL4 94614 149040310
VRL5 87219 144400290
VRL6 93294 144787793
VRL7 130407 141354625
VRL8 70156 88271747
VRL9 121334 144550574
VRT1 69926 272854961
VRT10 37396 74041240
VRT100 1 268302114
VRT101 3 319484498
VRT102 5 386368861
VRT103 7 393936069
VRT104 7 384166854
VRT105 1 46063367
VRT106 7 344525641
VRT107 6 384186008
VRT108 8 388949147
VRT109 10 334173277
VRT11 18698 27611025
VRT110 1 221441380
VRT111 3 375404155
VRT112 10 379167312
VRT113 34 391313315
VRT114 5 50284038
VRT115 1 772932187
VRT116 1 662004353
VRT117 1 535506559
VRT118 1 376147139
VRT119 1 364230008
VRT12 5986 380511905
VRT120 1 346409914
VRT121 1 311292523
VRT122 1 247732340
VRT123 1 228143320
VRT124 1 221182781
VRT125 2 321892640
VRT126 490 332426844
VRT127 12 378048109
VRT128 9 378909870
VRT129 6 345737823
VRT13 3363 217068541
VRT130 2 137693511
VRT131 7 385107928
VRT132 8 360581972
VRT133 10 364952837
VRT134 4 133261911
VRT135 8 359905961
VRT136 5 370674748
VRT137 9 378247816
VRT138 6 166907986
VRT139 14 379842153
VRT14 4685 4674270
VRT140 15 375595384
VRT141 41 289507176
VRT142 11 366984719
VRT143 1 550518975
VRT144 1 529596002
VRT145 1 413748038
VRT146 1 326378286
VRT147 1 272612222
VRT148 1 260396842
VRT149 1 197956435
VRT15 1171 26255719
VRT150 2 384149701
VRT151 2 288058306
VRT152 4 353983664
VRT153 433 371853020
VRT154 2 310725315
VRT155 2 280326572
VRT156 3 371471404
VRT157 3 354148189
VRT158 3 303679844
VRT159 4 341249946
VRT16 293 13983146
VRT160 18 371172209
VRT161 13 392880011
VRT162 31 343660166
VRT163 6 380232225
VRT164 5 292523491
VRT165 6 330076811
VRT166 7 362796652
VRT167 8 365387335
VRT168 10 273525883
VRT169 9 378695651
VRT17 37 392789976
VRT170 11 392251032
VRT171 6 341206380
VRT172 7 347210350
VRT173 7 370650631
VRT174 8 391548385
VRT175 6 385659507
VRT176 7 341110862
VRT177 1 55350661
VRT178 8 387616857
VRT179 4 361001021
VRT18 13 392458500
VRT180 8 377957950
VRT181 28 355939628
VRT182 1 53950911
VRT183 7 387415360
VRT184 7 365756282
VRT185 6 352657526
VRT186 5 346047628
VRT187 2 134650353
VRT188 5 356250620
VRT189 6 374573269
VRT19 12 379958897
VRT190 6 364137996
VRT191 7 343458516
VRT192 2 121348818
VRT193 7 358240592
VRT194 8 383435354
VRT195 8 365970383
VRT196 6 357597984
VRT197 7 355728138
VRT198 8 362648569
VRT199 7 390172982
VRT2 72837 271707689
VRT20 11 316368323
VRT200 8 391413434
VRT201 8 377681388
VRT202 23 79172410
VRT203 2 352563619
VRT204 7 386835620
VRT205 4313 352824210
VRT206 19 370712563
VRT207 15970 152778591
VRT208 139461 132366936
VRT209 144516 125632841
VRT21 13 385338369
VRT210 93344 86781381
VRT22 14 372163844
VRT23 14 352781625
VRT24 19 384683297
VRT25 16 379729070
VRT26 16 381718727
VRT27 2 51507477
VRT28 27 3633251
VRT29 147 10842596
VRT3 8867 331335312
VRT30 586 15797052
VRT31 2343 67436863
VRT32 19198 357652178
VRT33 54167 304802069
VRT34 158692 137233591
VRT35 18068 13362589
VRT36 117714 200758098
VRT37 158077 126700857
VRT38 119794 84211581
VRT39 185764 123625453
VRT4 3 141387178
VRT40 148068 105455905
VRT41 168367 113508733
VRT42 8316 7105801
VRT43 132996 105667475
VRT44 156590 117905167
VRT45 141358 86923554
VRT46 188429 120012722
VRT47 102729 60974353
VRT48 157732 119372690
VRT49 141839 154130494
VRT5 8 354279535
VRT50 136 381690353
VRT51 378 379606833
VRT52 1980 384952821
VRT53 93276 219917117
VRT54 145106 21008965
VRT55 75789 25336814
VRT56 13375 365641119
VRT57 20 379347618
VRT58 270 393447049
VRT59 3067 391133617
VRT6 11 387350249
VRT60 3471 230588304
VRT61 6443 378555114
VRT62 16 388667304
VRT63 16 378559418
VRT64 12 379509384
VRT65 7 285874095
VRT66 12 387522266
VRT67 18 375242791
VRT68 16 386329687
VRT69 229 277860126
VRT7 11 393947221
VRT70 17 367327734
VRT71 15 385834222
VRT72 7 149460915
VRT73 1 350098611
VRT74 1 332461053
VRT75 1 309313702
VRT76 1 293870033
VRT77 1 232056431
VRT78 1 209933285
VRT79 1 199226436
VRT8 30744 333424138
VRT80 2 392231039
VRT81 2 338442208
VRT82 2 304508243
VRT83 3 317261932
VRT84 7 378896727
VRT85 11 374771935
VRT86 13 379441801
VRT87 3 70710155
VRT88 16 344076996
VRT89 10 385210617
VRT9 74944 70627326
VRT90 15 392781064
VRT91 22 370094349
VRT92 1 839681426
VRT93 1 825560060
VRT94 1 595904407
VRT95 1 486875112
VRT96 1 387033265
VRT97 1 371528181
VRT98 1 313513962
VRT99 1 277530821
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 239.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:
Entries Bases Species
1939996 129766550158 Triticum aestivum
1347245 88465689114 Hordeum vulgare subsp. vulgare
27173320 20762848219 Homo sapiens
10024682 10448079724 Mus musculus
23003 9981161884 Triticum turgidum subsp. durum
1730057 9551301589 Danio rerio
139219 8932673983 Escherichia coli
2201153 6538179177 Rattus norvegicus
1470309 5773737626 Canis lupus familiaris
2239890 5439559231 Bos taurus
4218411 5260521219 Zea mays
53 5178609725 Rhinatrema bivittatum
3304500 5079209507 Sus scrofa
16 4548061038 Microcaecilia unicolor
8 4333590552 Orchesella sp. BIOUG14422-C09
17153 3965136833 Klebsiella pneumoniae
39 3773645297 Geotrypetes seraphini
68 3468703821 Erpetoichthys calabaricus
851 3086460368 Sarcophilus harrisii
2050 3015532682 Bordetella pertussis
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
187 Dec 2011 135117731375 146413798
188 Feb 2012 137384889783 149819246
189 Apr 2012 139266481398 151824421
190 Jun 2012 141343240755 154130210
191 Aug 2012 143081765233 156424033
192 Oct 2012 145430961262 157889737
193 Dec 2012 148390863904 161140325
194 Feb 2013 150141354858 162886727
195 Apr 2013 151178979155 164136731
196 Jun 2013 152599230112 165740164
197 Aug 2013 154192921011 167295840
198 Oct 2013 155176494699 168335396
199 Dec 2013 156230531562 169331407
200 Feb 2014 157943793171 171123749
201 Apr 2014 159813411760 171744486
202 Jun 2014 161822845643 173353076
203 Aug 2014 165722980375 174108750
204 Oct 2014 181563676918 178322253
205 Dec 2014 184938063614 179295769
206 Feb 2015 187893826750 181336445
207 Apr 2015 189739230107 182188746
208 Jun 2015 193921042946 185019352
209 Aug 2015 199823644287 187066846
210 Oct 2015 202237081559 188372017
211 Dec 2015 203939111071 189232925
212 Feb 2016 207018196067 190250235
213 Apr 2016 211423912047 193739511
214 Jun 2016 213200907819 194463572
215 Aug 2016 217971437647 196120831
216 Oct 2016 220731315250 197390691
217 Dec 2016 224973060433 198565475
218 Feb 2017 228719437638 199341377
219 Apr 2017 231824951552 200877884
220 Jun 2017 234997362623 201663568
221 Aug 2017 240343378258 203180606
222 Oct 2017 244914705468 203953682
223 Dec 2017 249722163594 206293625
224 Feb 2018 253630708098 207040555
225 Apr 2018 260189141631 208452303
226 Jun 2018 263957884539 209775348
227 Aug 2018 260806936411 208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
228 Oct 2018 279668290132 209656636
229 Dec 2018 285688542186 211281415
230 Feb 2019 303709510632 212260377
231 Apr 2019 321680566570 212775414
232 Jun 2019 329835282370 213383758
233 Aug 2019 366733917629 213865349
234 Oct 2019 386197018538 216763706
235 Dec 2019 388417258009 215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
236 Feb 2020 399376854872 216214215
237 Apr 2020 415770027949 216531829
238 Jun 2020 427823258901 217122233
239 Aug 2020 654057069549 218642238
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
187 Dec 2011 239868309609 73729553
188 Feb 2012 261370512675 78656704
189 Apr 2012 272693351548 80905298
190 Jun 2012 287577367116 82076779
191 Aug 2012 308196411905 84020064
192 Oct 2012 333881846451 86480509
193 Dec 2012 356002922838 92767765
194 Feb 2013 390900990416 103101291
195 Apr 2013 418026593606 110509314
196 Jun 2013 453829752320 112488036
197 Aug 2013 500420412665 124812020
198 Oct 2013 535842167741 130203205
199 Dec 2013 556764321498 133818570
200 Feb 2014 591378698544 139725795
201 Apr 2014 621015432437 143446790
202 Jun 2014 719581958743 175779064
203 Aug 2014 774052098731 189080419
204 Oct 2014 805549167708 196049974
205 Dec 2014 848977922022 200301550
206 Feb 2015 873281414087 205465046
207 Apr 2015 969102906813 243779199
208 Jun 2015 1038937210221 258702138
209 Aug 2015 1163275601001 302955543
210 Oct 2015 1222635267498 309198943
211 Dec 2015 1297865618365 317122157
212 Feb 2016 1399865495608 333012760
213 Apr 2016 1452207704949 338922537
214 Jun 2016 1556175944648 350278081
215 Aug 2016 1637224970324 359796497
216 Oct 2016 1676238489250 363213315
217 Dec 2016 1817189565845 395301176
218 Feb 2017 1892966308635 409490397
219 Apr 2017 2035032639807 451840147
220 Jun 2017 2164683993369 487891767
221 Aug 2017 2242294609510 499965722
222 Oct 2017 2318156361999 508825331
223 Dec 2017 2466098053327 551063065
224 Feb 2018 2608532210351 564286852
225 Apr 2018 2784740996536 621379029
226 Jun 2018 2944617324086 639804105
227 Aug 2018 3204855013281 665309765
228 Oct 2018 3444172142207 722438528
229 Dec 2018 3656719423096 773773190
230 Feb 2019 4164513961679 945019312
231 Apr 2019 4421986382065 993732214
232 Jun 2019 4847677297950 1022913321
233 Aug 2019 5585922333160 1075272215
234 Oct 2019 5985250251028 1097629174
235 Dec 2019 6277551200690 1127023870
236 Feb 2020 6968991265752 1206720688
237 Apr 2020 7788133221338 1267547429
238 Jun 2020 8114046262158 1302852615
239 Aug 2020 8841649410652 1408122887
The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.
TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).
Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.
Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tsa
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.
Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.
Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.
Release Date Base Pairs Entries
201 Apr 2014 23632325832 29734989
202 Jun 2014 31707343431 38011942
203 Aug 2014 33676182560 40556905
204 Oct 2014 36279458440 43567759
205 Dec 2014 46056420903 62635617
206 Feb 2015 49765340047 66706014
207 Apr 2015 55796332435 71989588
208 Jun 2015 60697472570 76974601
209 Aug 2015 69360654413 87827013
210 Oct 2015 70917172944 81790031
211 Dec 2015 77583339176 87488539
212 Feb 2016 81932555094 92132318
213 Apr 2016 87811163676 98147566
214 Jun 2016 94413958919 104677061
215 Aug 2016 103399742586 113179607
216 Oct 2016 113209225762 124199597
217 Dec 2016 125328824508 142094337
218 Feb 2017 133517212104 151431485
219 Apr 2017 149038907599 165068542
220 Jun 2017 158112969073 176812130
221 Aug 2017 167045663417 186777106
222 Oct 2017 172909268535 192754804
223 Dec 2017 181394660188 201559502
224 Feb 2018 193940551226 214324264
225 Apr 2018 205232396043 227364990
226 Jun 2018 216556686631 238788334
227 Aug 2018 225520004678 249295386
228 Oct 2018 235875573598 259927414
229 Dec 2018 248592892188 274845473
230 Feb 2019 263936885705 294772430
231 Apr 2019 277118019688 311247136
232 Jun 2019 285390240861 319927264
233 Aug 2019 294727165179 331347807
234 Oct 2019 305371891408 342811151
235 Dec 2019 325433016129 367193844
236 Feb 2020 340994289065 386644871
237 Apr 2020 349692751528 396392280
238 Jun 2020 359947709062 409725050
239 Aug 2020 366968951160 417524567
The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.
Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
ftp://ftp.ncbi.nih.gov/genbank/tls
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.
Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.
Release Date Base Pairs Entries
217 Dec 2016 584697919 1268690
218 Feb 2017 636923295 1438349
219 Apr 2017 636923295 1438349 (unchanged)
220 Jun 2017 824191338 1628475
221 Aug 2017 824191338 1628475 (unchanged)
222 Oct 2017 2993818315 9479460
223 Dec 2017 4458042616 12695198
224 Feb 2018 4531966831 12819978
225 Apr 2018 5612769448 14782654
226 Jun 2018 5896511468 15393041
227 Aug 2018 6077824493 15822538
228 Oct 2018 8435112913 20752288
229 Dec 2018 8511829281 20924588
230 Feb 2019 9146836085 23259929
231 Apr 2019 9623321565 24240761
232 Jun 2019 10182427815 25530139
233 Aug 2019 10531800829 26363945
234 Oct 2019 10848455369 27460978
235 Dec 2019 11280596614 28227180
236 Feb 2020 13669678196 34037371
237 Apr 2020 24615270313 65521132
238 Jun 2020 27500635128 75063181
239 Aug 2020 27825059498 75682157
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
August 15 2020
NCBI-GenBank Flat File Release 239.0
Bacterial Sequences (Part 1)
51396 loci, 92682287 bases, from 51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.
NOTE : Presentation of GI sequence identifiers in the GenBank
flatfile format was discontinued as of March 2017.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
or 2010.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
3.4.4.1 : Important notice about parsing the LOCUS line
Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.
Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.
Consider this LOCUS line for a typical complete bacterial genome:
LOCUS CP032762 5868661 bp DNA circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:
LOCUS AZZZAA02123456789 9999999999 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:
LOCUS AZZZAA0212345678910000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:
LOCUS AZZZAA02123456789 10000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.
3.4.4.2 : Data elements of the LOCUS line
The data elements of the LOCUS line format and their typical/historical
column positions are as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus Name (usually identical to the Accession Number)
29-29 space
30-40 Sequence Length, right-justified
41-41 space
42-43 'bp'
44-44 space
45-47 Strandedness : spaces (if not known), ss- (single-stranded),
ds- (double-stranded), or ms- (mixed-stranded)
48-53 Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA).
Left justified.
54-55 space
56-63 Molecule Topology : 'linear' followed by two spaces,
or 'circular'
64-64 space
65-67 Division Code
68-68 space
69-79 Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.
The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :
LOCUS HUMPDNRC 273 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S125 polymorphic dinucleotide repeat.
ACCESSION L10620
LOCUS HUMPDNRG 169 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S114 polymorphic dinucleotide repeat.
ACCESSION L10624
But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:
LOCUS AF035771 1357 bp mRNA linear PRI 30-JUN-1998
DEFINITION Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
complete cds.
ACCESSION AF035771
The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :
PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags)
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites)
GSS - GSS sequences (Genome Survey Sequences)
HTG - HTGS sequences (High Throughput Genomic sequences)
HTC - HTC sequences (High Throughput cDNA sequences)
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences
The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1
^^^^^^^^^^
Compound
Accession.Version
Number
A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:
http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS ANHA01000001 503 bp DNA linear BCT 23-NOV-2012
DEFINITION Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION ANHA01000001 ANHA01000000
VERSION ANHA01000001.1
DBLINK BioProject: PRJNA177352
BioSample: SAMN01795900
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK BioProject:PRJNA174162,PRJNA999998,PRJNA999999
And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.
As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".
DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:
http://www.ncbi.nlm.nih.gov/bioproject
At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:
http://www.ncbi.nlm.nih.gov/books/NBK54016/
DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:
http://www.ncbi.nlm.nih.gov/assembly
At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:
http://www.ncbi.nlm.nih.gov/assembly/help/
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:
http://www.insdc.org/documents/feature-table
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.2
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
The list of valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.3
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS KZ271580 141308 bp DNA linear CON 17-AUG-2017
DEFINITION Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION KZ271580 LQNL01000000
VERSION KZ271580.1
DBLINK BioProject: PRJNA230512
BioSample: SAMN04226856
KEYWORDS WGS; HIGH_QUALITY_DRAFT.
...
mRNA complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/product="hypothetical protein"
CDS complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/codon_start=1
/product="hypothetical protein"
/protein_id="OZC04795.1"
/db_xref="GI:1233056989"
/translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Scaffold/CON-division join() sequence
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.
The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] .
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Sayers E, Cavanaugh M, Clark K, Ostell J, Pruitt K,
Karsch-Mizrachi I, "GenBank", Nucleic Acids Research,
Volume 47, Issue D1, January 2019, pp. D94-D99
PMID: 30365038
PMCID: PMC6323954
DOI: 10.1093/nar/gky989
The following statement is an example of how one might cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'
(1) Sayers, E. et al, Nucleic Acids Res. 47(D1):D94-D99 (2019)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: Simply direct your web browser of choice to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] .
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 218.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
Vincent Calhoun, Larry Chlumsky, Karen Clark, Jianli Dai, Scott Durkin,
Francescopaolo di Cello, Michel Eschenbrenner, Michael Fetchko,
Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
Susan Schafer, Beverly Underwood, and Linda Yankie
Data Management and Preparation
Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
Sergiy Gotvyanskyy, Eugene Gribov, Jonathan Kans, Leonid Khotomliansky,
Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh, Alex Kotliarov,
Alexey Kuznetsov, Frank Ludwig, Anatoly Mnev, Vasuki Palanigobu,
Anton Perkov, Andriy Petrow, Sergey Petrunin, Wenyao Shi, Denis Sinyakov,
Thomas Smith, Vladimir Soussov, Elena Starchenko, Hanzhen Sun,
Andrei Vereshchagin, Jewen Xiao, Eugene Yaschenko, Liwei Zhou
Database Administration
Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
Benjamin Slade, Constantin Vasilyev
Customer Support
Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian
Project Direction
Steve Sherry : Acting Director, NCBI
Kim Pruitt : Branch Chief, NCBI/IEB
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
