Release Notes For GenBank Release 244
GBREL.TXT Genetic Sequence Data Bank
June 15 2021
NCBI-GenBank Flat File Release 244.0
Distribution Release Notes
227888889 sequences, 866009790959 bases, for traditional GenBank records
2230100893 sequences, 13917767400956 bases, for set-based (WGS/TSA/TLS) records
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 244.0
1.2 Cutoff Date
1.3 Important Changes in Release 244.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 244.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for GenBank's web-based submission tool (BankIt) :
http://www.ncbi.nlm.nih.gov/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 244.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:
ftp://ftp.ncbi.nih.gov/genbank/wgs
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/tsa
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tls
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
See the README files in those areas for more information.
Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:
ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.
1.2 Cutoff Date
This full release, 244.0, incorporates data processed by the INSDC databases
as of Tuesday June 22 2021 at approximately 5:47AM EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotide' database (see Section 6.4 of this document).
1.3 Important Changes in Release 244.0
1.3.1 Delay in the availability of GenBank 244.0 data files
Due to the significant delays which occurred for the prior GenBank 243.0
release (see Section 1.3.1 of that release's release notes), processing
for this GenBank 244.0 release was also impacted. Delivery is ten days
later than our target date: June 25th rather than June 15th. We expect to
be back on schedule for the August 2021 GenBank release, and regret any
inconvenience caused by the delay.
1.3.2 Organizational changes
The total number of sequence data files increased by 127 with this release:
- the BCT division is now composed of 618 files (+30)
- the INV division is now composed of 300 files (+29)
- the PLN division is now composed of 664 files (+7)
- the VRL division is now composed of 130 files (+54)
- the VRT division is now composed of 266 files (+7)
1.4 Upcoming Changes
1.4.1 New /regulatory_class values for the regulatory feature
As of the October 2021 GenBank Release 246.0, new values will be
supported for the /regulatory_class qualifier:
recombination_enhancer : A regulatory region that promotes
or induces the process of recombination.
uORF (or regulatory_uORF) : A short open reading frame that is
found in the 5' untranslated region of an mRNA and plays a role
in translational regulation.
Further details about this change will be made available via the
release notes for GenBank 245.0, in August.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the ENA and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the ENA and DDBJ databases.
BankIt may be used with any modern web browser. You can access BankIt
from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] .
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.
2.2 Files
This GenBank flat file release consists of 3806 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct395.seq - Bacterial sequence entries, part 395.
330. gbbct396.seq - Bacterial sequence entries, part 396.
331. gbbct397.seq - Bacterial sequence entries, part 397.
332. gbbct398.seq - Bacterial sequence entries, part 398.
333. gbbct399.seq - Bacterial sequence entries, part 399.
334. gbbct4.seq - Bacterial sequence entries, part 4.
335. gbbct40.seq - Bacterial sequence entries, part 40.
336. gbbct400.seq - Bacterial sequence entries, part 400.
337. gbbct401.seq - Bacterial sequence entries, part 401.
338. gbbct402.seq - Bacterial sequence entries, part 402.
339. gbbct403.seq - Bacterial sequence entries, part 403.
340. gbbct404.seq - Bacterial sequence entries, part 404.
341. gbbct405.seq - Bacterial sequence entries, part 405.
342. gbbct406.seq - Bacterial sequence entries, part 406.
343. gbbct407.seq - Bacterial sequence entries, part 407.
344. gbbct408.seq - Bacterial sequence entries, part 408.
345. gbbct409.seq - Bacterial sequence entries, part 409.
346. gbbct41.seq - Bacterial sequence entries, part 41.
347. gbbct410.seq - Bacterial sequence entries, part 410.
348. gbbct411.seq - Bacterial sequence entries, part 411.
349. gbbct412.seq - Bacterial sequence entries, part 412.
350. gbbct413.seq - Bacterial sequence entries, part 413.
351. gbbct414.seq - Bacterial sequence entries, part 414.
352. gbbct415.seq - Bacterial sequence entries, part 415.
353. gbbct416.seq - Bacterial sequence entries, part 416.
354. gbbct417.seq - Bacterial sequence entries, part 417.
355. gbbct418.seq - Bacterial sequence entries, part 418.
356. gbbct419.seq - Bacterial sequence entries, part 419.
357. gbbct42.seq - Bacterial sequence entries, part 42.
358. gbbct420.seq - Bacterial sequence entries, part 420.
359. gbbct421.seq - Bacterial sequence entries, part 421.
360. gbbct422.seq - Bacterial sequence entries, part 422.
361. gbbct423.seq - Bacterial sequence entries, part 423.
362. gbbct424.seq - Bacterial sequence entries, part 424.
363. gbbct425.seq - Bacterial sequence entries, part 425.
364. gbbct426.seq - Bacterial sequence entries, part 426.
365. gbbct427.seq - Bacterial sequence entries, part 427.
366. gbbct428.seq - Bacterial sequence entries, part 428.
367. gbbct429.seq - Bacterial sequence entries, part 429.
368. gbbct43.seq - Bacterial sequence entries, part 43.
369. gbbct430.seq - Bacterial sequence entries, part 430.
370. gbbct431.seq - Bacterial sequence entries, part 431.
371. gbbct432.seq - Bacterial sequence entries, part 432.
372. gbbct433.seq - Bacterial sequence entries, part 433.
373. gbbct434.seq - Bacterial sequence entries, part 434.
374. gbbct435.seq - Bacterial sequence entries, part 435.
375. gbbct436.seq - Bacterial sequence entries, part 436.
376. gbbct437.seq - Bacterial sequence entries, part 437.
377. gbbct438.seq - Bacterial sequence entries, part 438.
378. gbbct439.seq - Bacterial sequence entries, part 439.
379. gbbct44.seq - Bacterial sequence entries, part 44.
380. gbbct440.seq - Bacterial sequence entries, part 440.
381. gbbct441.seq - Bacterial sequence entries, part 441.
382. gbbct442.seq - Bacterial sequence entries, part 442.
383. gbbct443.seq - Bacterial sequence entries, part 443.
384. gbbct444.seq - Bacterial sequence entries, part 444.
385. gbbct445.seq - Bacterial sequence entries, part 445.
386. gbbct446.seq - Bacterial sequence entries, part 446.
387. gbbct447.seq - Bacterial sequence entries, part 447.
388. gbbct448.seq - Bacterial sequence entries, part 448.
389. gbbct449.seq - Bacterial sequence entries, part 449.
390. gbbct45.seq - Bacterial sequence entries, part 45.
391. gbbct450.seq - Bacterial sequence entries, part 450.
392. gbbct451.seq - Bacterial sequence entries, part 451.
393. gbbct452.seq - Bacterial sequence entries, part 452.
394. gbbct453.seq - Bacterial sequence entries, part 453.
395. gbbct454.seq - Bacterial sequence entries, part 454.
396. gbbct455.seq - Bacterial sequence entries, part 455.
397. gbbct456.seq - Bacterial sequence entries, part 456.
398. gbbct457.seq - Bacterial sequence entries, part 457.
399. gbbct458.seq - Bacterial sequence entries, part 458.
400. gbbct459.seq - Bacterial sequence entries, part 459.
401. gbbct46.seq - Bacterial sequence entries, part 46.
402. gbbct460.seq - Bacterial sequence entries, part 460.
403. gbbct461.seq - Bacterial sequence entries, part 461.
404. gbbct462.seq - Bacterial sequence entries, part 462.
405. gbbct463.seq - Bacterial sequence entries, part 463.
406. gbbct464.seq - Bacterial sequence entries, part 464.
407. gbbct465.seq - Bacterial sequence entries, part 465.
408. gbbct466.seq - Bacterial sequence entries, part 466.
409. gbbct467.seq - Bacterial sequence entries, part 467.
410. gbbct468.seq - Bacterial sequence entries, part 468.
411. gbbct469.seq - Bacterial sequence entries, part 469.
412. gbbct47.seq - Bacterial sequence entries, part 47.
413. gbbct470.seq - Bacterial sequence entries, part 470.
414. gbbct471.seq - Bacterial sequence entries, part 471.
415. gbbct472.seq - Bacterial sequence entries, part 472.
416. gbbct473.seq - Bacterial sequence entries, part 473.
417. gbbct474.seq - Bacterial sequence entries, part 474.
418. gbbct475.seq - Bacterial sequence entries, part 475.
419. gbbct476.seq - Bacterial sequence entries, part 476.
420. gbbct477.seq - Bacterial sequence entries, part 477.
421. gbbct478.seq - Bacterial sequence entries, part 478.
422. gbbct479.seq - Bacterial sequence entries, part 479.
423. gbbct48.seq - Bacterial sequence entries, part 48.
424. gbbct480.seq - Bacterial sequence entries, part 480.
425. gbbct481.seq - Bacterial sequence entries, part 481.
426. gbbct482.seq - Bacterial sequence entries, part 482.
427. gbbct483.seq - Bacterial sequence entries, part 483.
428. gbbct484.seq - Bacterial sequence entries, part 484.
429. gbbct485.seq - Bacterial sequence entries, part 485.
430. gbbct486.seq - Bacterial sequence entries, part 486.
431. gbbct487.seq - Bacterial sequence entries, part 487.
432. gbbct488.seq - Bacterial sequence entries, part 488.
433. gbbct489.seq - Bacterial sequence entries, part 489.
434. gbbct49.seq - Bacterial sequence entries, part 49.
435. gbbct490.seq - Bacterial sequence entries, part 490.
436. gbbct491.seq - Bacterial sequence entries, part 491.
437. gbbct492.seq - Bacterial sequence entries, part 492.
438. gbbct493.seq - Bacterial sequence entries, part 493.
439. gbbct494.seq - Bacterial sequence entries, part 494.
440. gbbct495.seq - Bacterial sequence entries, part 495.
441. gbbct496.seq - Bacterial sequence entries, part 496.
442. gbbct497.seq - Bacterial sequence entries, part 497.
443. gbbct498.seq - Bacterial sequence entries, part 498.
444. gbbct499.seq - Bacterial sequence entries, part 499.
445. gbbct5.seq - Bacterial sequence entries, part 5.
446. gbbct50.seq - Bacterial sequence entries, part 50.
447. gbbct500.seq - Bacterial sequence entries, part 500.
448. gbbct501.seq - Bacterial sequence entries, part 501.
449. gbbct502.seq - Bacterial sequence entries, part 502.
450. gbbct503.seq - Bacterial sequence entries, part 503.
451. gbbct504.seq - Bacterial sequence entries, part 504.
452. gbbct505.seq - Bacterial sequence entries, part 505.
453. gbbct506.seq - Bacterial sequence entries, part 506.
454. gbbct507.seq - Bacterial sequence entries, part 507.
455. gbbct508.seq - Bacterial sequence entries, part 508.
456. gbbct509.seq - Bacterial sequence entries, part 509.
457. gbbct51.seq - Bacterial sequence entries, part 51.
458. gbbct510.seq - Bacterial sequence entries, part 510.
459. gbbct511.seq - Bacterial sequence entries, part 511.
460. gbbct512.seq - Bacterial sequence entries, part 512.
461. gbbct513.seq - Bacterial sequence entries, part 513.
462. gbbct514.seq - Bacterial sequence entries, part 514.
463. gbbct515.seq - Bacterial sequence entries, part 515.
464. gbbct516.seq - Bacterial sequence entries, part 516.
465. gbbct517.seq - Bacterial sequence entries, part 517.
466. gbbct518.seq - Bacterial sequence entries, part 518.
467. gbbct519.seq - Bacterial sequence entries, part 519.
468. gbbct52.seq - Bacterial sequence entries, part 52.
469. gbbct520.seq - Bacterial sequence entries, part 520.
470. gbbct521.seq - Bacterial sequence entries, part 521.
471. gbbct522.seq - Bacterial sequence entries, part 522.
472. gbbct523.seq - Bacterial sequence entries, part 523.
473. gbbct524.seq - Bacterial sequence entries, part 524.
474. gbbct525.seq - Bacterial sequence entries, part 525.
475. gbbct526.seq - Bacterial sequence entries, part 526.
476. gbbct527.seq - Bacterial sequence entries, part 527.
477. gbbct528.seq - Bacterial sequence entries, part 528.
478. gbbct529.seq - Bacterial sequence entries, part 529.
479. gbbct53.seq - Bacterial sequence entries, part 53.
480. gbbct530.seq - Bacterial sequence entries, part 530.
481. gbbct531.seq - Bacterial sequence entries, part 531.
482. gbbct532.seq - Bacterial sequence entries, part 532.
483. gbbct533.seq - Bacterial sequence entries, part 533.
484. gbbct534.seq - Bacterial sequence entries, part 534.
485. gbbct535.seq - Bacterial sequence entries, part 535.
486. gbbct536.seq - Bacterial sequence entries, part 536.
487. gbbct537.seq - Bacterial sequence entries, part 537.
488. gbbct538.seq - Bacterial sequence entries, part 538.
489. gbbct539.seq - Bacterial sequence entries, part 539.
490. gbbct54.seq - Bacterial sequence entries, part 54.
491. gbbct540.seq - Bacterial sequence entries, part 540.
492. gbbct541.seq - Bacterial sequence entries, part 541.
493. gbbct542.seq - Bacterial sequence entries, part 542.
494. gbbct543.seq - Bacterial sequence entries, part 543.
495. gbbct544.seq - Bacterial sequence entries, part 544.
496. gbbct545.seq - Bacterial sequence entries, part 545.
497. gbbct546.seq - Bacterial sequence entries, part 546.
498. gbbct547.seq - Bacterial sequence entries, part 547.
499. gbbct548.seq - Bacterial sequence entries, part 548.
500. gbbct549.seq - Bacterial sequence entries, part 549.
501. gbbct55.seq - Bacterial sequence entries, part 55.
502. gbbct550.seq - Bacterial sequence entries, part 550.
503. gbbct551.seq - Bacterial sequence entries, part 551.
504. gbbct552.seq - Bacterial sequence entries, part 552.
505. gbbct553.seq - Bacterial sequence entries, part 553.
506. gbbct554.seq - Bacterial sequence entries, part 554.
507. gbbct555.seq - Bacterial sequence entries, part 555.
508. gbbct556.seq - Bacterial sequence entries, part 556.
509. gbbct557.seq - Bacterial sequence entries, part 557.
510. gbbct558.seq - Bacterial sequence entries, part 558.
511. gbbct559.seq - Bacterial sequence entries, part 559.
512. gbbct56.seq - Bacterial sequence entries, part 56.
513. gbbct560.seq - Bacterial sequence entries, part 560.
514. gbbct561.seq - Bacterial sequence entries, part 561.
515. gbbct562.seq - Bacterial sequence entries, part 562.
516. gbbct563.seq - Bacterial sequence entries, part 563.
517. gbbct564.seq - Bacterial sequence entries, part 564.
518. gbbct565.seq - Bacterial sequence entries, part 565.
519. gbbct566.seq - Bacterial sequence entries, part 566.
520. gbbct567.seq - Bacterial sequence entries, part 567.
521. gbbct568.seq - Bacterial sequence entries, part 568.
522. gbbct569.seq - Bacterial sequence entries, part 569.
523. gbbct57.seq - Bacterial sequence entries, part 57.
524. gbbct570.seq - Bacterial sequence entries, part 570.
525. gbbct571.seq - Bacterial sequence entries, part 571.
526. gbbct572.seq - Bacterial sequence entries, part 572.
527. gbbct573.seq - Bacterial sequence entries, part 573.
528. gbbct574.seq - Bacterial sequence entries, part 574.
529. gbbct575.seq - Bacterial sequence entries, part 575.
530. gbbct576.seq - Bacterial sequence entries, part 576.
531. gbbct577.seq - Bacterial sequence entries, part 577.
532. gbbct578.seq - Bacterial sequence entries, part 578.
533. gbbct579.seq - Bacterial sequence entries, part 579.
534. gbbct58.seq - Bacterial sequence entries, part 58.
535. gbbct580.seq - Bacterial sequence entries, part 580.
536. gbbct581.seq - Bacterial sequence entries, part 581.
537. gbbct582.seq - Bacterial sequence entries, part 582.
538. gbbct583.seq - Bacterial sequence entries, part 583.
539. gbbct584.seq - Bacterial sequence entries, part 584.
540. gbbct585.seq - Bacterial sequence entries, part 585.
541. gbbct586.seq - Bacterial sequence entries, part 586.
542. gbbct587.seq - Bacterial sequence entries, part 587.
543. gbbct588.seq - Bacterial sequence entries, part 588.
544. gbbct589.seq - Bacterial sequence entries, part 589.
545. gbbct59.seq - Bacterial sequence entries, part 59.
546. gbbct590.seq - Bacterial sequence entries, part 590.
547. gbbct591.seq - Bacterial sequence entries, part 591.
548. gbbct592.seq - Bacterial sequence entries, part 592.
549. gbbct593.seq - Bacterial sequence entries, part 593.
550. gbbct594.seq - Bacterial sequence entries, part 594.
551. gbbct595.seq - Bacterial sequence entries, part 595.
552. gbbct596.seq - Bacterial sequence entries, part 596.
553. gbbct597.seq - Bacterial sequence entries, part 597.
554. gbbct598.seq - Bacterial sequence entries, part 598.
555. gbbct599.seq - Bacterial sequence entries, part 599.
556. gbbct6.seq - Bacterial sequence entries, part 6.
557. gbbct60.seq - Bacterial sequence entries, part 60.
558. gbbct600.seq - Bacterial sequence entries, part 600.
559. gbbct601.seq - Bacterial sequence entries, part 601.
560. gbbct602.seq - Bacterial sequence entries, part 602.
561. gbbct603.seq - Bacterial sequence entries, part 603.
562. gbbct604.seq - Bacterial sequence entries, part 604.
563. gbbct605.seq - Bacterial sequence entries, part 605.
564. gbbct606.seq - Bacterial sequence entries, part 606.
565. gbbct607.seq - Bacterial sequence entries, part 607.
566. gbbct608.seq - Bacterial sequence entries, part 608.
567. gbbct609.seq - Bacterial sequence entries, part 609.
568. gbbct61.seq - Bacterial sequence entries, part 61.
569. gbbct610.seq - Bacterial sequence entries, part 610.
570. gbbct611.seq - Bacterial sequence entries, part 611.
571. gbbct612.seq - Bacterial sequence entries, part 612.
572. gbbct613.seq - Bacterial sequence entries, part 613.
573. gbbct614.seq - Bacterial sequence entries, part 614.
574. gbbct615.seq - Bacterial sequence entries, part 615.
575. gbbct616.seq - Bacterial sequence entries, part 616.
576. gbbct617.seq - Bacterial sequence entries, part 617.
577. gbbct618.seq - Bacterial sequence entries, part 618.
578. gbbct62.seq - Bacterial sequence entries, part 62.
579. gbbct63.seq - Bacterial sequence entries, part 63.
580. gbbct64.seq - Bacterial sequence entries, part 64.
581. gbbct65.seq - Bacterial sequence entries, part 65.
582. gbbct66.seq - Bacterial sequence entries, part 66.
583. gbbct67.seq - Bacterial sequence entries, part 67.
584. gbbct68.seq - Bacterial sequence entries, part 68.
585. gbbct69.seq - Bacterial sequence entries, part 69.
586. gbbct7.seq - Bacterial sequence entries, part 7.
587. gbbct70.seq - Bacterial sequence entries, part 70.
588. gbbct71.seq - Bacterial sequence entries, part 71.
589. gbbct72.seq - Bacterial sequence entries, part 72.
590. gbbct73.seq - Bacterial sequence entries, part 73.
591. gbbct74.seq - Bacterial sequence entries, part 74.
592. gbbct75.seq - Bacterial sequence entries, part 75.
593. gbbct76.seq - Bacterial sequence entries, part 76.
594. gbbct77.seq - Bacterial sequence entries, part 77.
595. gbbct78.seq - Bacterial sequence entries, part 78.
596. gbbct79.seq - Bacterial sequence entries, part 79.
597. gbbct8.seq - Bacterial sequence entries, part 8.
598. gbbct80.seq - Bacterial sequence entries, part 80.
599. gbbct81.seq - Bacterial sequence entries, part 81.
600. gbbct82.seq - Bacterial sequence entries, part 82.
601. gbbct83.seq - Bacterial sequence entries, part 83.
602. gbbct84.seq - Bacterial sequence entries, part 84.
603. gbbct85.seq - Bacterial sequence entries, part 85.
604. gbbct86.seq - Bacterial sequence entries, part 86.
605. gbbct87.seq - Bacterial sequence entries, part 87.
606. gbbct88.seq - Bacterial sequence entries, part 88.
607. gbbct89.seq - Bacterial sequence entries, part 89.
608. gbbct9.seq - Bacterial sequence entries, part 9.
609. gbbct90.seq - Bacterial sequence entries, part 90.
610. gbbct91.seq - Bacterial sequence entries, part 91.
611. gbbct92.seq - Bacterial sequence entries, part 92.
612. gbbct93.seq - Bacterial sequence entries, part 93.
613. gbbct94.seq - Bacterial sequence entries, part 94.
614. gbbct95.seq - Bacterial sequence entries, part 95.
615. gbbct96.seq - Bacterial sequence entries, part 96.
616. gbbct97.seq - Bacterial sequence entries, part 97.
617. gbbct98.seq - Bacterial sequence entries, part 98.
618. gbbct99.seq - Bacterial sequence entries, part 99.
619. gbchg.txt - Accession numbers of entries updated since the previous release.
620. gbcon1.seq - Constructed sequence entries, part 1.
621. gbcon10.seq - Constructed sequence entries, part 10.
622. gbcon100.seq - Constructed sequence entries, part 100.
623. gbcon101.seq - Constructed sequence entries, part 101.
624. gbcon102.seq - Constructed sequence entries, part 102.
625. gbcon103.seq - Constructed sequence entries, part 103.
626. gbcon104.seq - Constructed sequence entries, part 104.
627. gbcon105.seq - Constructed sequence entries, part 105.
628. gbcon106.seq - Constructed sequence entries, part 106.
629. gbcon107.seq - Constructed sequence entries, part 107.
630. gbcon108.seq - Constructed sequence entries, part 108.
631. gbcon109.seq - Constructed sequence entries, part 109.
632. gbcon11.seq - Constructed sequence entries, part 11.
633. gbcon110.seq - Constructed sequence entries, part 110.
634. gbcon111.seq - Constructed sequence entries, part 111.
635. gbcon112.seq - Constructed sequence entries, part 112.
636. gbcon113.seq - Constructed sequence entries, part 113.
637. gbcon114.seq - Constructed sequence entries, part 114.
638. gbcon115.seq - Constructed sequence entries, part 115.
639. gbcon116.seq - Constructed sequence entries, part 116.
640. gbcon117.seq - Constructed sequence entries, part 117.
641. gbcon118.seq - Constructed sequence entries, part 118.
642. gbcon119.seq - Constructed sequence entries, part 119.
643. gbcon12.seq - Constructed sequence entries, part 12.
644. gbcon120.seq - Constructed sequence entries, part 120.
645. gbcon121.seq - Constructed sequence entries, part 121.
646. gbcon122.seq - Constructed sequence entries, part 122.
647. gbcon123.seq - Constructed sequence entries, part 123.
648. gbcon124.seq - Constructed sequence entries, part 124.
649. gbcon125.seq - Constructed sequence entries, part 125.
650. gbcon126.seq - Constructed sequence entries, part 126.
651. gbcon127.seq - Constructed sequence entries, part 127.
652. gbcon128.seq - Constructed sequence entries, part 128.
653. gbcon129.seq - Constructed sequence entries, part 129.
654. gbcon13.seq - Constructed sequence entries, part 13.
655. gbcon130.seq - Constructed sequence entries, part 130.
656. gbcon131.seq - Constructed sequence entries, part 131.
657. gbcon132.seq - Constructed sequence entries, part 132.
658. gbcon133.seq - Constructed sequence entries, part 133.
659. gbcon134.seq - Constructed sequence entries, part 134.
660. gbcon135.seq - Constructed sequence entries, part 135.
661. gbcon136.seq - Constructed sequence entries, part 136.
662. gbcon137.seq - Constructed sequence entries, part 137.
663. gbcon138.seq - Constructed sequence entries, part 138.
664. gbcon139.seq - Constructed sequence entries, part 139.
665. gbcon14.seq - Constructed sequence entries, part 14.
666. gbcon140.seq - Constructed sequence entries, part 140.
667. gbcon141.seq - Constructed sequence entries, part 141.
668. gbcon142.seq - Constructed sequence entries, part 142.
669. gbcon143.seq - Constructed sequence entries, part 143.
670. gbcon144.seq - Constructed sequence entries, part 144.
671. gbcon145.seq - Constructed sequence entries, part 145.
672. gbcon146.seq - Constructed sequence entries, part 146.
673. gbcon147.seq - Constructed sequence entries, part 147.
674. gbcon148.seq - Constructed sequence entries, part 148.
675. gbcon149.seq - Constructed sequence entries, part 149.
676. gbcon15.seq - Constructed sequence entries, part 15.
677. gbcon150.seq - Constructed sequence entries, part 150.
678. gbcon151.seq - Constructed sequence entries, part 151.
679. gbcon152.seq - Constructed sequence entries, part 152.
680. gbcon153.seq - Constructed sequence entries, part 153.
681. gbcon154.seq - Constructed sequence entries, part 154.
682. gbcon155.seq - Constructed sequence entries, part 155.
683. gbcon156.seq - Constructed sequence entries, part 156.
684. gbcon157.seq - Constructed sequence entries, part 157.
685. gbcon158.seq - Constructed sequence entries, part 158.
686. gbcon159.seq - Constructed sequence entries, part 159.
687. gbcon16.seq - Constructed sequence entries, part 16.
688. gbcon160.seq - Constructed sequence entries, part 160.
689. gbcon161.seq - Constructed sequence entries, part 161.
690. gbcon162.seq - Constructed sequence entries, part 162.
691. gbcon163.seq - Constructed sequence entries, part 163.
692. gbcon164.seq - Constructed sequence entries, part 164.
693. gbcon165.seq - Constructed sequence entries, part 165.
694. gbcon166.seq - Constructed sequence entries, part 166.
695. gbcon167.seq - Constructed sequence entries, part 167.
696. gbcon168.seq - Constructed sequence entries, part 168.
697. gbcon169.seq - Constructed sequence entries, part 169.
698. gbcon17.seq - Constructed sequence entries, part 17.
699. gbcon170.seq - Constructed sequence entries, part 170.
700. gbcon171.seq - Constructed sequence entries, part 171.
701. gbcon172.seq - Constructed sequence entries, part 172.
702. gbcon173.seq - Constructed sequence entries, part 173.
703. gbcon174.seq - Constructed sequence entries, part 174.
704. gbcon175.seq - Constructed sequence entries, part 175.
705. gbcon176.seq - Constructed sequence entries, part 176.
706. gbcon177.seq - Constructed sequence entries, part 177.
707. gbcon178.seq - Constructed sequence entries, part 178.
708. gbcon179.seq - Constructed sequence entries, part 179.
709. gbcon18.seq - Constructed sequence entries, part 18.
710. gbcon180.seq - Constructed sequence entries, part 180.
711. gbcon181.seq - Constructed sequence entries, part 181.
712. gbcon182.seq - Constructed sequence entries, part 182.
713. gbcon183.seq - Constructed sequence entries, part 183.
714. gbcon184.seq - Constructed sequence entries, part 184.
715. gbcon185.seq - Constructed sequence entries, part 185.
716. gbcon186.seq - Constructed sequence entries, part 186.
717. gbcon187.seq - Constructed sequence entries, part 187.
718. gbcon188.seq - Constructed sequence entries, part 188.
719. gbcon189.seq - Constructed sequence entries, part 189.
720. gbcon19.seq - Constructed sequence entries, part 19.
721. gbcon190.seq - Constructed sequence entries, part 190.
722. gbcon191.seq - Constructed sequence entries, part 191.
723. gbcon192.seq - Constructed sequence entries, part 192.
724. gbcon193.seq - Constructed sequence entries, part 193.
725. gbcon194.seq - Constructed sequence entries, part 194.
726. gbcon195.seq - Constructed sequence entries, part 195.
727. gbcon196.seq - Constructed sequence entries, part 196.
728. gbcon197.seq - Constructed sequence entries, part 197.
729. gbcon198.seq - Constructed sequence entries, part 198.
730. gbcon199.seq - Constructed sequence entries, part 199.
731. gbcon2.seq - Constructed sequence entries, part 2.
732. gbcon20.seq - Constructed sequence entries, part 20.
733. gbcon200.seq - Constructed sequence entries, part 200.
734. gbcon201.seq - Constructed sequence entries, part 201.
735. gbcon202.seq - Constructed sequence entries, part 202.
736. gbcon203.seq - Constructed sequence entries, part 203.
737. gbcon204.seq - Constructed sequence entries, part 204.
738. gbcon205.seq - Constructed sequence entries, part 205.
739. gbcon206.seq - Constructed sequence entries, part 206.
740. gbcon207.seq - Constructed sequence entries, part 207.
741. gbcon208.seq - Constructed sequence entries, part 208.
742. gbcon209.seq - Constructed sequence entries, part 209.
743. gbcon21.seq - Constructed sequence entries, part 21.
744. gbcon210.seq - Constructed sequence entries, part 210.
745. gbcon211.seq - Constructed sequence entries, part 211.
746. gbcon212.seq - Constructed sequence entries, part 212.
747. gbcon213.seq - Constructed sequence entries, part 213.
748. gbcon214.seq - Constructed sequence entries, part 214.
749. gbcon215.seq - Constructed sequence entries, part 215.
750. gbcon216.seq - Constructed sequence entries, part 216.
751. gbcon217.seq - Constructed sequence entries, part 217.
752. gbcon218.seq - Constructed sequence entries, part 218.
753. gbcon219.seq - Constructed sequence entries, part 219.
754. gbcon22.seq - Constructed sequence entries, part 22.
755. gbcon220.seq - Constructed sequence entries, part 220.
756. gbcon221.seq - Constructed sequence entries, part 221.
757. gbcon23.seq - Constructed sequence entries, part 23.
758. gbcon24.seq - Constructed sequence entries, part 24.
759. gbcon25.seq - Constructed sequence entries, part 25.
760. gbcon26.seq - Constructed sequence entries, part 26.
761. gbcon27.seq - Constructed sequence entries, part 27.
762. gbcon28.seq - Constructed sequence entries, part 28.
763. gbcon29.seq - Constructed sequence entries, part 29.
764. gbcon3.seq - Constructed sequence entries, part 3.
765. gbcon30.seq - Constructed sequence entries, part 30.
766. gbcon31.seq - Constructed sequence entries, part 31.
767. gbcon32.seq - Constructed sequence entries, part 32.
768. gbcon33.seq - Constructed sequence entries, part 33.
769. gbcon34.seq - Constructed sequence entries, part 34.
770. gbcon35.seq - Constructed sequence entries, part 35.
771. gbcon36.seq - Constructed sequence entries, part 36.
772. gbcon37.seq - Constructed sequence entries, part 37.
773. gbcon38.seq - Constructed sequence entries, part 38.
774. gbcon39.seq - Constructed sequence entries, part 39.
775. gbcon4.seq - Constructed sequence entries, part 4.
776. gbcon40.seq - Constructed sequence entries, part 40.
777. gbcon41.seq - Constructed sequence entries, part 41.
778. gbcon42.seq - Constructed sequence entries, part 42.
779. gbcon43.seq - Constructed sequence entries, part 43.
780. gbcon44.seq - Constructed sequence entries, part 44.
781. gbcon45.seq - Constructed sequence entries, part 45.
782. gbcon46.seq - Constructed sequence entries, part 46.
783. gbcon47.seq - Constructed sequence entries, part 47.
784. gbcon48.seq - Constructed sequence entries, part 48.
785. gbcon49.seq - Constructed sequence entries, part 49.
786. gbcon5.seq - Constructed sequence entries, part 5.
787. gbcon50.seq - Constructed sequence entries, part 50.
788. gbcon51.seq - Constructed sequence entries, part 51.
789. gbcon52.seq - Constructed sequence entries, part 52.
790. gbcon53.seq - Constructed sequence entries, part 53.
791. gbcon54.seq - Constructed sequence entries, part 54.
792. gbcon55.seq - Constructed sequence entries, part 55.
793. gbcon56.seq - Constructed sequence entries, part 56.
794. gbcon57.seq - Constructed sequence entries, part 57.
795. gbcon58.seq - Constructed sequence entries, part 58.
796. gbcon59.seq - Constructed sequence entries, part 59.
797. gbcon6.seq - Constructed sequence entries, part 6.
798. gbcon60.seq - Constructed sequence entries, part 60.
799. gbcon61.seq - Constructed sequence entries, part 61.
800. gbcon62.seq - Constructed sequence entries, part 62.
801. gbcon63.seq - Constructed sequence entries, part 63.
802. gbcon64.seq - Constructed sequence entries, part 64.
803. gbcon65.seq - Constructed sequence entries, part 65.
804. gbcon66.seq - Constructed sequence entries, part 66.
805. gbcon67.seq - Constructed sequence entries, part 67.
806. gbcon68.seq - Constructed sequence entries, part 68.
807. gbcon69.seq - Constructed sequence entries, part 69.
808. gbcon7.seq - Constructed sequence entries, part 7.
809. gbcon70.seq - Constructed sequence entries, part 70.
810. gbcon71.seq - Constructed sequence entries, part 71.
811. gbcon72.seq - Constructed sequence entries, part 72.
812. gbcon73.seq - Constructed sequence entries, part 73.
813. gbcon74.seq - Constructed sequence entries, part 74.
814. gbcon75.seq - Constructed sequence entries, part 75.
815. gbcon76.seq - Constructed sequence entries, part 76.
816. gbcon77.seq - Constructed sequence entries, part 77.
817. gbcon78.seq - Constructed sequence entries, part 78.
818. gbcon79.seq - Constructed sequence entries, part 79.
819. gbcon8.seq - Constructed sequence entries, part 8.
820. gbcon80.seq - Constructed sequence entries, part 80.
821. gbcon81.seq - Constructed sequence entries, part 81.
822. gbcon82.seq - Constructed sequence entries, part 82.
823. gbcon83.seq - Constructed sequence entries, part 83.
824. gbcon84.seq - Constructed sequence entries, part 84.
825. gbcon85.seq - Constructed sequence entries, part 85.
826. gbcon86.seq - Constructed sequence entries, part 86.
827. gbcon87.seq - Constructed sequence entries, part 87.
828. gbcon88.seq - Constructed sequence entries, part 88.
829. gbcon89.seq - Constructed sequence entries, part 89.
830. gbcon9.seq - Constructed sequence entries, part 9.
831. gbcon90.seq - Constructed sequence entries, part 90.
832. gbcon91.seq - Constructed sequence entries, part 91.
833. gbcon92.seq - Constructed sequence entries, part 92.
834. gbcon93.seq - Constructed sequence entries, part 93.
835. gbcon94.seq - Constructed sequence entries, part 94.
836. gbcon95.seq - Constructed sequence entries, part 95.
837. gbcon96.seq - Constructed sequence entries, part 96.
838. gbcon97.seq - Constructed sequence entries, part 97.
839. gbcon98.seq - Constructed sequence entries, part 98.
840. gbcon99.seq - Constructed sequence entries, part 99.
841. gbdel.txt - Accession numbers of entries deleted since the previous release.
842. gbenv1.seq - Environmental sampling sequence entries, part 1.
843. gbenv10.seq - Environmental sampling sequence entries, part 10.
844. gbenv11.seq - Environmental sampling sequence entries, part 11.
845. gbenv12.seq - Environmental sampling sequence entries, part 12.
846. gbenv13.seq - Environmental sampling sequence entries, part 13.
847. gbenv14.seq - Environmental sampling sequence entries, part 14.
848. gbenv15.seq - Environmental sampling sequence entries, part 15.
849. gbenv16.seq - Environmental sampling sequence entries, part 16.
850. gbenv17.seq - Environmental sampling sequence entries, part 17.
851. gbenv18.seq - Environmental sampling sequence entries, part 18.
852. gbenv19.seq - Environmental sampling sequence entries, part 19.
853. gbenv2.seq - Environmental sampling sequence entries, part 2.
854. gbenv20.seq - Environmental sampling sequence entries, part 20.
855. gbenv21.seq - Environmental sampling sequence entries, part 21.
856. gbenv22.seq - Environmental sampling sequence entries, part 22.
857. gbenv23.seq - Environmental sampling sequence entries, part 23.
858. gbenv24.seq - Environmental sampling sequence entries, part 24.
859. gbenv25.seq - Environmental sampling sequence entries, part 25.
860. gbenv26.seq - Environmental sampling sequence entries, part 26.
861. gbenv27.seq - Environmental sampling sequence entries, part 27.
862. gbenv28.seq - Environmental sampling sequence entries, part 28.
863. gbenv29.seq - Environmental sampling sequence entries, part 29.
864. gbenv3.seq - Environmental sampling sequence entries, part 3.
865. gbenv30.seq - Environmental sampling sequence entries, part 30.
866. gbenv31.seq - Environmental sampling sequence entries, part 31.
867. gbenv32.seq - Environmental sampling sequence entries, part 32.
868. gbenv33.seq - Environmental sampling sequence entries, part 33.
869. gbenv34.seq - Environmental sampling sequence entries, part 34.
870. gbenv35.seq - Environmental sampling sequence entries, part 35.
871. gbenv36.seq - Environmental sampling sequence entries, part 36.
872. gbenv37.seq - Environmental sampling sequence entries, part 37.
873. gbenv38.seq - Environmental sampling sequence entries, part 38.
874. gbenv39.seq - Environmental sampling sequence entries, part 39.
875. gbenv4.seq - Environmental sampling sequence entries, part 4.
876. gbenv40.seq - Environmental sampling sequence entries, part 40.
877. gbenv41.seq - Environmental sampling sequence entries, part 41.
878. gbenv42.seq - Environmental sampling sequence entries, part 42.
879. gbenv43.seq - Environmental sampling sequence entries, part 43.
880. gbenv44.seq - Environmental sampling sequence entries, part 44.
881. gbenv45.seq - Environmental sampling sequence entries, part 45.
882. gbenv46.seq - Environmental sampling sequence entries, part 46.
883. gbenv47.seq - Environmental sampling sequence entries, part 47.
884. gbenv48.seq - Environmental sampling sequence entries, part 48.
885. gbenv49.seq - Environmental sampling sequence entries, part 49.
886. gbenv5.seq - Environmental sampling sequence entries, part 5.
887. gbenv50.seq - Environmental sampling sequence entries, part 50.
888. gbenv51.seq - Environmental sampling sequence entries, part 51.
889. gbenv52.seq - Environmental sampling sequence entries, part 52.
890. gbenv53.seq - Environmental sampling sequence entries, part 53.
891. gbenv54.seq - Environmental sampling sequence entries, part 54.
892. gbenv55.seq - Environmental sampling sequence entries, part 55.
893. gbenv56.seq - Environmental sampling sequence entries, part 56.
894. gbenv57.seq - Environmental sampling sequence entries, part 57.
895. gbenv58.seq - Environmental sampling sequence entries, part 58.
896. gbenv59.seq - Environmental sampling sequence entries, part 59.
897. gbenv6.seq - Environmental sampling sequence entries, part 6.
898. gbenv60.seq - Environmental sampling sequence entries, part 60.
899. gbenv61.seq - Environmental sampling sequence entries, part 61.
900. gbenv62.seq - Environmental sampling sequence entries, part 62.
901. gbenv63.seq - Environmental sampling sequence entries, part 63.
902. gbenv64.seq - Environmental sampling sequence entries, part 64.
903. gbenv65.seq - Environmental sampling sequence entries, part 65.
904. gbenv7.seq - Environmental sampling sequence entries, part 7.
905. gbenv8.seq - Environmental sampling sequence entries, part 8.
906. gbenv9.seq - Environmental sampling sequence entries, part 9.
907. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
908. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
909. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
910. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
911. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
912. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
913. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
914. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
915. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
916. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
917. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
918. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
919. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
920. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
921. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
922. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
923. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
924. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
925. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
926. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
927. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
928. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
929. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
930. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
931. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
932. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
933. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
934. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
935. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
936. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
937. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
938. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
939. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
940. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
941. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
942. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
943. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
944. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
945. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
946. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
947. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
948. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
949. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
950. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
951. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
952. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
953. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
954. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
955. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
956. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
957. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
958. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
959. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
960. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
961. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
962. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
963. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
964. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
965. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
966. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
967. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
968. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
969. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
970. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
971. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
972. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
973. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
974. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
975. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
976. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
977. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
978. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
979. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
980. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
981. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
982. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
983. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
984. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
985. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
986. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
987. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
988. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
989. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
990. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
991. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
992. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
993. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
994. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
995. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
996. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
997. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
998. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
999. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
1000. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
1001. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
1002. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
1003. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
1004. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
1005. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
1006. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
1007. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
1008. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
1009. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
1010. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
1011. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
1012. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
1013. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
1014. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
1015. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
1016. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
1017. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
1018. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
1019. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
1020. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
1021. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
1022. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
1023. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
1024. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
1025. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
1026. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
1027. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
1028. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
1029. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
1030. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
1031. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
1032. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
1033. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
1034. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
1035. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
1036. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
1037. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
1038. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
1039. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
1040. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
1041. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
1042. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
1043. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
1044. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
1045. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
1046. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
1047. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
1048. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
1049. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
1050. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
1051. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
1052. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
1053. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
1054. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
1055. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
1056. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
1057. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
1058. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
1059. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
1060. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
1061. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
1062. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
1063. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
1064. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
1065. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
1066. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
1067. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
1068. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
1069. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
1070. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
1071. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
1072. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
1073. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
1074. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
1075. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
1076. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
1077. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
1078. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
1079. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
1080. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
1081. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
1082. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
1083. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
1084. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
1085. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
1086. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
1087. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
1088. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
1089. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
1090. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
1091. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
1092. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
1093. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
1094. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
1095. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
1096. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
1097. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
1098. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
1099. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
1100. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
1101. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
1102. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
1103. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
1104. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
1105. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
1106. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
1107. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
1108. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
1109. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
1110. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
1111. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
1112. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
1113. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
1114. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
1115. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
1116. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
1117. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
1118. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
1119. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
1120. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
1121. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
1122. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
1123. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
1124. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
1125. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
1126. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
1127. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
1128. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
1129. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
1130. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
1131. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
1132. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
1133. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
1134. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1135. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1136. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1137. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1138. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1139. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1140. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1141. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1142. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1143. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1144. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1145. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1146. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1147. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1148. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1149. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1150. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1151. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1152. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1153. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1154. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1155. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1156. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1157. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1158. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1159. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1160. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1161. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1162. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1163. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1164. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1165. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1166. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1167. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1168. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1169. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1170. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1171. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1172. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1173. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1174. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1175. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1176. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1177. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1178. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1179. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1180. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1181. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1182. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1183. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1184. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1185. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1186. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1187. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1188. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1189. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1190. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1191. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1192. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1193. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1194. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1195. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1196. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1197. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1198. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1199. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1200. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1201. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1202. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1203. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1204. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1205. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1206. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1207. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1208. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1209. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1210. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1211. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1212. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1213. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1214. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1215. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1216. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1217. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1218. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1219. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1220. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1221. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1222. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1223. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1224. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1225. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1226. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1227. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1228. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1229. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1230. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1231. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1232. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1233. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1234. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1235. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1236. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1237. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1238. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1239. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1240. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1241. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1242. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1243. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1244. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1245. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1246. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1247. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1248. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1249. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1250. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1251. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1252. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1253. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1254. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1255. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1256. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1257. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1258. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1259. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1260. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1261. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1262. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1263. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1264. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1265. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1266. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1267. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1268. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1269. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1270. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1271. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1272. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1273. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1274. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1275. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1276. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1277. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1278. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1279. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1280. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1281. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1282. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1283. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1284. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1285. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1286. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1287. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1288. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1289. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1290. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1291. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1292. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1293. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1294. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1295. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1296. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1297. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1298. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1299. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1300. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1301. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1302. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1303. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1304. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1305. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1306. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1307. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1308. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1309. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1310. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1311. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1312. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1313. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1314. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1315. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1316. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1317. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1318. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1319. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1320. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1321. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1322. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1323. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1324. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1325. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1326. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1327. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1328. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1329. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1330. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1331. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1332. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1333. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1334. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
1335. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
1336. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
1337. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
1338. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
1339. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
1340. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1341. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
1342. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
1343. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
1344. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
1345. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
1346. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
1347. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
1348. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
1349. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
1350. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
1351. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1352. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1353. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
1354. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
1355. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
1356. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
1357. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
1358. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
1359. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
1360. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
1361. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
1362. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
1363. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1364. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
1365. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
1366. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
1367. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
1368. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
1369. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
1370. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
1371. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
1372. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
1373. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
1374. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1375. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
1376. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
1377. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
1378. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
1379. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
1380. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
1381. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
1382. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
1383. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
1384. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
1385. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1386. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
1387. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
1388. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
1389. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
1390. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
1391. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
1392. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
1393. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
1394. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
1395. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
1396. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1397. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
1398. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
1399. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
1400. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
1401. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
1402. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
1403. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
1404. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
1405. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
1406. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
1407. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1408. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
1409. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
1410. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
1411. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
1412. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
1413. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
1414. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
1415. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
1416. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
1417. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
1418. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1419. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
1420. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
1421. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
1422. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
1423. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
1424. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
1425. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
1426. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
1427. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
1428. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
1429. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1430. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
1431. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
1432. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
1433. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
1434. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
1435. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
1436. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1437. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1438. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1439. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1440. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1441. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1442. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1443. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1444. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1445. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1446. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1447. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1448. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1449. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1450. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1451. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1452. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1453. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1454. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1455. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1456. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1457. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1458. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1459. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1460. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1461. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1462. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1463. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1464. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1465. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1466. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1467. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1468. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1469. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1470. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1471. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1472. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1473. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1474. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1475. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1476. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1477. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1478. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1479. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1480. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1481. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1482. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1483. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1484. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1485. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1486. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1487. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1488. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1489. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1490. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1491. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1492. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1493. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1494. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1495. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1496. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1497. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1498. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1499. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1500. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1501. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1502. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1503. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1504. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1505. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1506. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1507. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1508. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1509. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1510. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1511. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1512. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1513. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1514. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1515. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1516. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1517. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1518. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1519. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1520. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1521. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1522. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1523. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1524. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1525. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1526. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1527. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1528. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1529. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1530. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1531. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1532. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1533. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1534. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1535. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1536. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1537. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1538. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1539. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1540. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1541. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1542. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1543. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1544. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1545. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1546. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1547. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1548. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1549. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1550. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1551. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1552. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1553. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1554. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1555. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1556. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1557. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1558. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1559. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1560. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1561. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1562. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1563. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1564. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1565. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1566. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1567. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1568. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1569. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1570. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1571. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1572. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1573. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1574. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1575. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1576. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1577. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1578. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1579. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1580. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1581. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1582. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1583. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1584. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1585. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1586. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1587. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1588. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1589. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1590. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1591. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1592. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1593. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1594. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1595. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1596. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1597. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1598. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1599. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1600. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1601. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1602. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1603. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1604. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1605. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1606. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1607. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1608. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1609. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1610. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1611. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1612. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1613. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1614. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1615. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1616. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1617. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1618. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1619. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1620. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1621. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1622. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1623. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1624. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1625. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1626. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1627. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1628. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1629. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1630. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1631. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1632. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1633. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1634. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1635. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1636. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1637. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1638. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1639. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1640. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1641. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1642. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1643. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1644. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1645. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1646. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1647. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1648. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1649. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1650. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1651. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1652. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1653. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1654. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1655. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1656. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1657. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1658. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1659. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1660. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1661. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1662. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1663. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1664. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1665. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1666. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1667. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1668. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1669. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1670. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1671. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1672. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1673. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1674. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1675. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1676. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1677. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1678. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1679. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1680. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1681. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1682. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1683. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1684. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1685. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1686. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1687. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1688. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1689. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1690. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1691. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1692. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1693. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1694. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1695. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1696. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1697. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1698. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1699. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1700. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1701. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1702. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1703. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1704. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1705. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1706. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1707. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1708. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1709. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1710. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1711. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1712. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1713. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1714. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1715. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1716. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1717. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1718. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1719. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1720. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1721. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1722. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1723. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1724. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1725. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1726. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1727. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1728. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1729. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1730. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1731. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1732. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1733. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1734. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1735. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1736. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1737. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1738. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1739. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1740. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1741. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1742. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1743. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1744. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1745. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1746. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1747. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1748. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1749. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1750. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1751. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1752. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1753. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1754. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1755. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1756. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1757. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1758. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1759. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1760. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1761. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1762. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1763. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1764. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1765. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1766. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1767. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1768. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1769. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1770. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1771. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1772. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1773. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1774. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1775. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1776. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1777. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1778. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1779. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1780. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1781. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1782. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1783. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1784. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1785. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1786. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1787. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1788. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1789. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1790. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1791. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1792. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1793. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1794. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1795. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1796. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1797. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1798. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1799. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1800. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1801. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1802. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1803. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1804. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1805. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1806. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1807. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1808. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1809. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1810. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1811. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1812. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1813. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1814. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1815. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1816. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1817. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1818. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1819. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1820. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1821. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1822. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1823. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1824. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1825. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1826. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1827. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1828. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1829. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1830. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1831. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1832. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1833. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1834. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1835. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1836. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1837. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1838. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1839. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1840. gbinv1.seq - Invertebrate sequence entries, part 1.
1841. gbinv10.seq - Invertebrate sequence entries, part 10.
1842. gbinv100.seq - Invertebrate sequence entries, part 100.
1843. gbinv101.seq - Invertebrate sequence entries, part 101.
1844. gbinv102.seq - Invertebrate sequence entries, part 102.
1845. gbinv103.seq - Invertebrate sequence entries, part 103.
1846. gbinv104.seq - Invertebrate sequence entries, part 104.
1847. gbinv105.seq - Invertebrate sequence entries, part 105.
1848. gbinv106.seq - Invertebrate sequence entries, part 106.
1849. gbinv107.seq - Invertebrate sequence entries, part 107.
1850. gbinv108.seq - Invertebrate sequence entries, part 108.
1851. gbinv109.seq - Invertebrate sequence entries, part 109.
1852. gbinv11.seq - Invertebrate sequence entries, part 11.
1853. gbinv110.seq - Invertebrate sequence entries, part 110.
1854. gbinv111.seq - Invertebrate sequence entries, part 111.
1855. gbinv112.seq - Invertebrate sequence entries, part 112.
1856. gbinv113.seq - Invertebrate sequence entries, part 113.
1857. gbinv114.seq - Invertebrate sequence entries, part 114.
1858. gbinv115.seq - Invertebrate sequence entries, part 115.
1859. gbinv116.seq - Invertebrate sequence entries, part 116.
1860. gbinv117.seq - Invertebrate sequence entries, part 117.
1861. gbinv118.seq - Invertebrate sequence entries, part 118.
1862. gbinv119.seq - Invertebrate sequence entries, part 119.
1863. gbinv12.seq - Invertebrate sequence entries, part 12.
1864. gbinv120.seq - Invertebrate sequence entries, part 120.
1865. gbinv121.seq - Invertebrate sequence entries, part 121.
1866. gbinv122.seq - Invertebrate sequence entries, part 122.
1867. gbinv123.seq - Invertebrate sequence entries, part 123.
1868. gbinv124.seq - Invertebrate sequence entries, part 124.
1869. gbinv125.seq - Invertebrate sequence entries, part 125.
1870. gbinv126.seq - Invertebrate sequence entries, part 126.
1871. gbinv127.seq - Invertebrate sequence entries, part 127.
1872. gbinv128.seq - Invertebrate sequence entries, part 128.
1873. gbinv129.seq - Invertebrate sequence entries, part 129.
1874. gbinv13.seq - Invertebrate sequence entries, part 13.
1875. gbinv130.seq - Invertebrate sequence entries, part 130.
1876. gbinv131.seq - Invertebrate sequence entries, part 131.
1877. gbinv132.seq - Invertebrate sequence entries, part 132.
1878. gbinv133.seq - Invertebrate sequence entries, part 133.
1879. gbinv134.seq - Invertebrate sequence entries, part 134.
1880. gbinv135.seq - Invertebrate sequence entries, part 135.
1881. gbinv136.seq - Invertebrate sequence entries, part 136.
1882. gbinv137.seq - Invertebrate sequence entries, part 137.
1883. gbinv138.seq - Invertebrate sequence entries, part 138.
1884. gbinv139.seq - Invertebrate sequence entries, part 139.
1885. gbinv14.seq - Invertebrate sequence entries, part 14.
1886. gbinv140.seq - Invertebrate sequence entries, part 140.
1887. gbinv141.seq - Invertebrate sequence entries, part 141.
1888. gbinv142.seq - Invertebrate sequence entries, part 142.
1889. gbinv143.seq - Invertebrate sequence entries, part 143.
1890. gbinv144.seq - Invertebrate sequence entries, part 144.
1891. gbinv145.seq - Invertebrate sequence entries, part 145.
1892. gbinv146.seq - Invertebrate sequence entries, part 146.
1893. gbinv147.seq - Invertebrate sequence entries, part 147.
1894. gbinv148.seq - Invertebrate sequence entries, part 148.
1895. gbinv149.seq - Invertebrate sequence entries, part 149.
1896. gbinv15.seq - Invertebrate sequence entries, part 15.
1897. gbinv150.seq - Invertebrate sequence entries, part 150.
1898. gbinv151.seq - Invertebrate sequence entries, part 151.
1899. gbinv152.seq - Invertebrate sequence entries, part 152.
1900. gbinv153.seq - Invertebrate sequence entries, part 153.
1901. gbinv154.seq - Invertebrate sequence entries, part 154.
1902. gbinv155.seq - Invertebrate sequence entries, part 155.
1903. gbinv156.seq - Invertebrate sequence entries, part 156.
1904. gbinv157.seq - Invertebrate sequence entries, part 157.
1905. gbinv158.seq - Invertebrate sequence entries, part 158.
1906. gbinv159.seq - Invertebrate sequence entries, part 159.
1907. gbinv16.seq - Invertebrate sequence entries, part 16.
1908. gbinv160.seq - Invertebrate sequence entries, part 160.
1909. gbinv161.seq - Invertebrate sequence entries, part 161.
1910. gbinv162.seq - Invertebrate sequence entries, part 162.
1911. gbinv163.seq - Invertebrate sequence entries, part 163.
1912. gbinv164.seq - Invertebrate sequence entries, part 164.
1913. gbinv165.seq - Invertebrate sequence entries, part 165.
1914. gbinv166.seq - Invertebrate sequence entries, part 166.
1915. gbinv167.seq - Invertebrate sequence entries, part 167.
1916. gbinv168.seq - Invertebrate sequence entries, part 168.
1917. gbinv169.seq - Invertebrate sequence entries, part 169.
1918. gbinv17.seq - Invertebrate sequence entries, part 17.
1919. gbinv170.seq - Invertebrate sequence entries, part 170.
1920. gbinv171.seq - Invertebrate sequence entries, part 171.
1921. gbinv172.seq - Invertebrate sequence entries, part 172.
1922. gbinv173.seq - Invertebrate sequence entries, part 173.
1923. gbinv174.seq - Invertebrate sequence entries, part 174.
1924. gbinv175.seq - Invertebrate sequence entries, part 175.
1925. gbinv176.seq - Invertebrate sequence entries, part 176.
1926. gbinv177.seq - Invertebrate sequence entries, part 177.
1927. gbinv178.seq - Invertebrate sequence entries, part 178.
1928. gbinv179.seq - Invertebrate sequence entries, part 179.
1929. gbinv18.seq - Invertebrate sequence entries, part 18.
1930. gbinv180.seq - Invertebrate sequence entries, part 180.
1931. gbinv181.seq - Invertebrate sequence entries, part 181.
1932. gbinv182.seq - Invertebrate sequence entries, part 182.
1933. gbinv183.seq - Invertebrate sequence entries, part 183.
1934. gbinv184.seq - Invertebrate sequence entries, part 184.
1935. gbinv185.seq - Invertebrate sequence entries, part 185.
1936. gbinv186.seq - Invertebrate sequence entries, part 186.
1937. gbinv187.seq - Invertebrate sequence entries, part 187.
1938. gbinv188.seq - Invertebrate sequence entries, part 188.
1939. gbinv189.seq - Invertebrate sequence entries, part 189.
1940. gbinv19.seq - Invertebrate sequence entries, part 19.
1941. gbinv190.seq - Invertebrate sequence entries, part 190.
1942. gbinv191.seq - Invertebrate sequence entries, part 191.
1943. gbinv192.seq - Invertebrate sequence entries, part 192.
1944. gbinv193.seq - Invertebrate sequence entries, part 193.
1945. gbinv194.seq - Invertebrate sequence entries, part 194.
1946. gbinv195.seq - Invertebrate sequence entries, part 195.
1947. gbinv196.seq - Invertebrate sequence entries, part 196.
1948. gbinv197.seq - Invertebrate sequence entries, part 197.
1949. gbinv198.seq - Invertebrate sequence entries, part 198.
1950. gbinv199.seq - Invertebrate sequence entries, part 199.
1951. gbinv2.seq - Invertebrate sequence entries, part 2.
1952. gbinv20.seq - Invertebrate sequence entries, part 20.
1953. gbinv200.seq - Invertebrate sequence entries, part 200.
1954. gbinv201.seq - Invertebrate sequence entries, part 201.
1955. gbinv202.seq - Invertebrate sequence entries, part 202.
1956. gbinv203.seq - Invertebrate sequence entries, part 203.
1957. gbinv204.seq - Invertebrate sequence entries, part 204.
1958. gbinv205.seq - Invertebrate sequence entries, part 205.
1959. gbinv206.seq - Invertebrate sequence entries, part 206.
1960. gbinv207.seq - Invertebrate sequence entries, part 207.
1961. gbinv208.seq - Invertebrate sequence entries, part 208.
1962. gbinv209.seq - Invertebrate sequence entries, part 209.
1963. gbinv21.seq - Invertebrate sequence entries, part 21.
1964. gbinv210.seq - Invertebrate sequence entries, part 210.
1965. gbinv211.seq - Invertebrate sequence entries, part 211.
1966. gbinv212.seq - Invertebrate sequence entries, part 212.
1967. gbinv213.seq - Invertebrate sequence entries, part 213.
1968. gbinv214.seq - Invertebrate sequence entries, part 214.
1969. gbinv215.seq - Invertebrate sequence entries, part 215.
1970. gbinv216.seq - Invertebrate sequence entries, part 216.
1971. gbinv217.seq - Invertebrate sequence entries, part 217.
1972. gbinv218.seq - Invertebrate sequence entries, part 218.
1973. gbinv219.seq - Invertebrate sequence entries, part 219.
1974. gbinv22.seq - Invertebrate sequence entries, part 22.
1975. gbinv220.seq - Invertebrate sequence entries, part 220.
1976. gbinv221.seq - Invertebrate sequence entries, part 221.
1977. gbinv222.seq - Invertebrate sequence entries, part 222.
1978. gbinv223.seq - Invertebrate sequence entries, part 223.
1979. gbinv224.seq - Invertebrate sequence entries, part 224.
1980. gbinv225.seq - Invertebrate sequence entries, part 225.
1981. gbinv226.seq - Invertebrate sequence entries, part 226.
1982. gbinv227.seq - Invertebrate sequence entries, part 227.
1983. gbinv228.seq - Invertebrate sequence entries, part 228.
1984. gbinv229.seq - Invertebrate sequence entries, part 229.
1985. gbinv23.seq - Invertebrate sequence entries, part 23.
1986. gbinv230.seq - Invertebrate sequence entries, part 230.
1987. gbinv231.seq - Invertebrate sequence entries, part 231.
1988. gbinv232.seq - Invertebrate sequence entries, part 232.
1989. gbinv233.seq - Invertebrate sequence entries, part 233.
1990. gbinv234.seq - Invertebrate sequence entries, part 234.
1991. gbinv235.seq - Invertebrate sequence entries, part 235.
1992. gbinv236.seq - Invertebrate sequence entries, part 236.
1993. gbinv237.seq - Invertebrate sequence entries, part 237.
1994. gbinv238.seq - Invertebrate sequence entries, part 238.
1995. gbinv239.seq - Invertebrate sequence entries, part 239.
1996. gbinv24.seq - Invertebrate sequence entries, part 24.
1997. gbinv240.seq - Invertebrate sequence entries, part 240.
1998. gbinv241.seq - Invertebrate sequence entries, part 241.
1999. gbinv242.seq - Invertebrate sequence entries, part 242.
2000. gbinv243.seq - Invertebrate sequence entries, part 243.
2001. gbinv244.seq - Invertebrate sequence entries, part 244.
2002. gbinv245.seq - Invertebrate sequence entries, part 245.
2003. gbinv246.seq - Invertebrate sequence entries, part 246.
2004. gbinv247.seq - Invertebrate sequence entries, part 247.
2005. gbinv248.seq - Invertebrate sequence entries, part 248.
2006. gbinv249.seq - Invertebrate sequence entries, part 249.
2007. gbinv25.seq - Invertebrate sequence entries, part 25.
2008. gbinv250.seq - Invertebrate sequence entries, part 250.
2009. gbinv251.seq - Invertebrate sequence entries, part 251.
2010. gbinv252.seq - Invertebrate sequence entries, part 252.
2011. gbinv253.seq - Invertebrate sequence entries, part 253.
2012. gbinv254.seq - Invertebrate sequence entries, part 254.
2013. gbinv255.seq - Invertebrate sequence entries, part 255.
2014. gbinv256.seq - Invertebrate sequence entries, part 256.
2015. gbinv257.seq - Invertebrate sequence entries, part 257.
2016. gbinv258.seq - Invertebrate sequence entries, part 258.
2017. gbinv259.seq - Invertebrate sequence entries, part 259.
2018. gbinv26.seq - Invertebrate sequence entries, part 26.
2019. gbinv260.seq - Invertebrate sequence entries, part 260.
2020. gbinv261.seq - Invertebrate sequence entries, part 261.
2021. gbinv262.seq - Invertebrate sequence entries, part 262.
2022. gbinv263.seq - Invertebrate sequence entries, part 263.
2023. gbinv264.seq - Invertebrate sequence entries, part 264.
2024. gbinv265.seq - Invertebrate sequence entries, part 265.
2025. gbinv266.seq - Invertebrate sequence entries, part 266.
2026. gbinv267.seq - Invertebrate sequence entries, part 267.
2027. gbinv268.seq - Invertebrate sequence entries, part 268.
2028. gbinv269.seq - Invertebrate sequence entries, part 269.
2029. gbinv27.seq - Invertebrate sequence entries, part 27.
2030. gbinv270.seq - Invertebrate sequence entries, part 270.
2031. gbinv271.seq - Invertebrate sequence entries, part 271.
2032. gbinv272.seq - Invertebrate sequence entries, part 272.
2033. gbinv273.seq - Invertebrate sequence entries, part 273.
2034. gbinv274.seq - Invertebrate sequence entries, part 274.
2035. gbinv275.seq - Invertebrate sequence entries, part 275.
2036. gbinv276.seq - Invertebrate sequence entries, part 276.
2037. gbinv277.seq - Invertebrate sequence entries, part 277.
2038. gbinv278.seq - Invertebrate sequence entries, part 278.
2039. gbinv279.seq - Invertebrate sequence entries, part 279.
2040. gbinv28.seq - Invertebrate sequence entries, part 28.
2041. gbinv280.seq - Invertebrate sequence entries, part 280.
2042. gbinv281.seq - Invertebrate sequence entries, part 281.
2043. gbinv282.seq - Invertebrate sequence entries, part 282.
2044. gbinv283.seq - Invertebrate sequence entries, part 283.
2045. gbinv284.seq - Invertebrate sequence entries, part 284.
2046. gbinv285.seq - Invertebrate sequence entries, part 285.
2047. gbinv286.seq - Invertebrate sequence entries, part 286.
2048. gbinv287.seq - Invertebrate sequence entries, part 287.
2049. gbinv288.seq - Invertebrate sequence entries, part 288.
2050. gbinv289.seq - Invertebrate sequence entries, part 289.
2051. gbinv29.seq - Invertebrate sequence entries, part 29.
2052. gbinv290.seq - Invertebrate sequence entries, part 290.
2053. gbinv291.seq - Invertebrate sequence entries, part 291.
2054. gbinv292.seq - Invertebrate sequence entries, part 292.
2055. gbinv293.seq - Invertebrate sequence entries, part 293.
2056. gbinv294.seq - Invertebrate sequence entries, part 294.
2057. gbinv295.seq - Invertebrate sequence entries, part 295.
2058. gbinv296.seq - Invertebrate sequence entries, part 296.
2059. gbinv297.seq - Invertebrate sequence entries, part 297.
2060. gbinv298.seq - Invertebrate sequence entries, part 298.
2061. gbinv299.seq - Invertebrate sequence entries, part 299.
2062. gbinv3.seq - Invertebrate sequence entries, part 3.
2063. gbinv30.seq - Invertebrate sequence entries, part 30.
2064. gbinv300.seq - Invertebrate sequence entries, part 300.
2065. gbinv31.seq - Invertebrate sequence entries, part 31.
2066. gbinv32.seq - Invertebrate sequence entries, part 32.
2067. gbinv33.seq - Invertebrate sequence entries, part 33.
2068. gbinv34.seq - Invertebrate sequence entries, part 34.
2069. gbinv35.seq - Invertebrate sequence entries, part 35.
2070. gbinv36.seq - Invertebrate sequence entries, part 36.
2071. gbinv37.seq - Invertebrate sequence entries, part 37.
2072. gbinv38.seq - Invertebrate sequence entries, part 38.
2073. gbinv39.seq - Invertebrate sequence entries, part 39.
2074. gbinv4.seq - Invertebrate sequence entries, part 4.
2075. gbinv40.seq - Invertebrate sequence entries, part 40.
2076. gbinv41.seq - Invertebrate sequence entries, part 41.
2077. gbinv42.seq - Invertebrate sequence entries, part 42.
2078. gbinv43.seq - Invertebrate sequence entries, part 43.
2079. gbinv44.seq - Invertebrate sequence entries, part 44.
2080. gbinv45.seq - Invertebrate sequence entries, part 45.
2081. gbinv46.seq - Invertebrate sequence entries, part 46.
2082. gbinv47.seq - Invertebrate sequence entries, part 47.
2083. gbinv48.seq - Invertebrate sequence entries, part 48.
2084. gbinv49.seq - Invertebrate sequence entries, part 49.
2085. gbinv5.seq - Invertebrate sequence entries, part 5.
2086. gbinv50.seq - Invertebrate sequence entries, part 50.
2087. gbinv51.seq - Invertebrate sequence entries, part 51.
2088. gbinv52.seq - Invertebrate sequence entries, part 52.
2089. gbinv53.seq - Invertebrate sequence entries, part 53.
2090. gbinv54.seq - Invertebrate sequence entries, part 54.
2091. gbinv55.seq - Invertebrate sequence entries, part 55.
2092. gbinv56.seq - Invertebrate sequence entries, part 56.
2093. gbinv57.seq - Invertebrate sequence entries, part 57.
2094. gbinv58.seq - Invertebrate sequence entries, part 58.
2095. gbinv59.seq - Invertebrate sequence entries, part 59.
2096. gbinv6.seq - Invertebrate sequence entries, part 6.
2097. gbinv60.seq - Invertebrate sequence entries, part 60.
2098. gbinv61.seq - Invertebrate sequence entries, part 61.
2099. gbinv62.seq - Invertebrate sequence entries, part 62.
2100. gbinv63.seq - Invertebrate sequence entries, part 63.
2101. gbinv64.seq - Invertebrate sequence entries, part 64.
2102. gbinv65.seq - Invertebrate sequence entries, part 65.
2103. gbinv66.seq - Invertebrate sequence entries, part 66.
2104. gbinv67.seq - Invertebrate sequence entries, part 67.
2105. gbinv68.seq - Invertebrate sequence entries, part 68.
2106. gbinv69.seq - Invertebrate sequence entries, part 69.
2107. gbinv7.seq - Invertebrate sequence entries, part 7.
2108. gbinv70.seq - Invertebrate sequence entries, part 70.
2109. gbinv71.seq - Invertebrate sequence entries, part 71.
2110. gbinv72.seq - Invertebrate sequence entries, part 72.
2111. gbinv73.seq - Invertebrate sequence entries, part 73.
2112. gbinv74.seq - Invertebrate sequence entries, part 74.
2113. gbinv75.seq - Invertebrate sequence entries, part 75.
2114. gbinv76.seq - Invertebrate sequence entries, part 76.
2115. gbinv77.seq - Invertebrate sequence entries, part 77.
2116. gbinv78.seq - Invertebrate sequence entries, part 78.
2117. gbinv79.seq - Invertebrate sequence entries, part 79.
2118. gbinv8.seq - Invertebrate sequence entries, part 8.
2119. gbinv80.seq - Invertebrate sequence entries, part 80.
2120. gbinv81.seq - Invertebrate sequence entries, part 81.
2121. gbinv82.seq - Invertebrate sequence entries, part 82.
2122. gbinv83.seq - Invertebrate sequence entries, part 83.
2123. gbinv84.seq - Invertebrate sequence entries, part 84.
2124. gbinv85.seq - Invertebrate sequence entries, part 85.
2125. gbinv86.seq - Invertebrate sequence entries, part 86.
2126. gbinv87.seq - Invertebrate sequence entries, part 87.
2127. gbinv88.seq - Invertebrate sequence entries, part 88.
2128. gbinv89.seq - Invertebrate sequence entries, part 89.
2129. gbinv9.seq - Invertebrate sequence entries, part 9.
2130. gbinv90.seq - Invertebrate sequence entries, part 90.
2131. gbinv91.seq - Invertebrate sequence entries, part 91.
2132. gbinv92.seq - Invertebrate sequence entries, part 92.
2133. gbinv93.seq - Invertebrate sequence entries, part 93.
2134. gbinv94.seq - Invertebrate sequence entries, part 94.
2135. gbinv95.seq - Invertebrate sequence entries, part 95.
2136. gbinv96.seq - Invertebrate sequence entries, part 96.
2137. gbinv97.seq - Invertebrate sequence entries, part 97.
2138. gbinv98.seq - Invertebrate sequence entries, part 98.
2139. gbinv99.seq - Invertebrate sequence entries, part 99.
2140. gbmam1.seq - Other mammalian sequence entries, part 1.
2141. gbmam10.seq - Other mammalian sequence entries, part 10.
2142. gbmam11.seq - Other mammalian sequence entries, part 11.
2143. gbmam12.seq - Other mammalian sequence entries, part 12.
2144. gbmam13.seq - Other mammalian sequence entries, part 13.
2145. gbmam14.seq - Other mammalian sequence entries, part 14.
2146. gbmam15.seq - Other mammalian sequence entries, part 15.
2147. gbmam16.seq - Other mammalian sequence entries, part 16.
2148. gbmam17.seq - Other mammalian sequence entries, part 17.
2149. gbmam18.seq - Other mammalian sequence entries, part 18.
2150. gbmam19.seq - Other mammalian sequence entries, part 19.
2151. gbmam2.seq - Other mammalian sequence entries, part 2.
2152. gbmam20.seq - Other mammalian sequence entries, part 20.
2153. gbmam21.seq - Other mammalian sequence entries, part 21.
2154. gbmam22.seq - Other mammalian sequence entries, part 22.
2155. gbmam23.seq - Other mammalian sequence entries, part 23.
2156. gbmam24.seq - Other mammalian sequence entries, part 24.
2157. gbmam25.seq - Other mammalian sequence entries, part 25.
2158. gbmam26.seq - Other mammalian sequence entries, part 26.
2159. gbmam27.seq - Other mammalian sequence entries, part 27.
2160. gbmam28.seq - Other mammalian sequence entries, part 28.
2161. gbmam29.seq - Other mammalian sequence entries, part 29.
2162. gbmam3.seq - Other mammalian sequence entries, part 3.
2163. gbmam30.seq - Other mammalian sequence entries, part 30.
2164. gbmam31.seq - Other mammalian sequence entries, part 31.
2165. gbmam32.seq - Other mammalian sequence entries, part 32.
2166. gbmam33.seq - Other mammalian sequence entries, part 33.
2167. gbmam34.seq - Other mammalian sequence entries, part 34.
2168. gbmam35.seq - Other mammalian sequence entries, part 35.
2169. gbmam36.seq - Other mammalian sequence entries, part 36.
2170. gbmam37.seq - Other mammalian sequence entries, part 37.
2171. gbmam38.seq - Other mammalian sequence entries, part 38.
2172. gbmam39.seq - Other mammalian sequence entries, part 39.
2173. gbmam4.seq - Other mammalian sequence entries, part 4.
2174. gbmam40.seq - Other mammalian sequence entries, part 40.
2175. gbmam41.seq - Other mammalian sequence entries, part 41.
2176. gbmam42.seq - Other mammalian sequence entries, part 42.
2177. gbmam43.seq - Other mammalian sequence entries, part 43.
2178. gbmam44.seq - Other mammalian sequence entries, part 44.
2179. gbmam45.seq - Other mammalian sequence entries, part 45.
2180. gbmam46.seq - Other mammalian sequence entries, part 46.
2181. gbmam47.seq - Other mammalian sequence entries, part 47.
2182. gbmam48.seq - Other mammalian sequence entries, part 48.
2183. gbmam49.seq - Other mammalian sequence entries, part 49.
2184. gbmam5.seq - Other mammalian sequence entries, part 5.
2185. gbmam50.seq - Other mammalian sequence entries, part 50.
2186. gbmam51.seq - Other mammalian sequence entries, part 51.
2187. gbmam52.seq - Other mammalian sequence entries, part 52.
2188. gbmam53.seq - Other mammalian sequence entries, part 53.
2189. gbmam54.seq - Other mammalian sequence entries, part 54.
2190. gbmam55.seq - Other mammalian sequence entries, part 55.
2191. gbmam56.seq - Other mammalian sequence entries, part 56.
2192. gbmam57.seq - Other mammalian sequence entries, part 57.
2193. gbmam58.seq - Other mammalian sequence entries, part 58.
2194. gbmam59.seq - Other mammalian sequence entries, part 59.
2195. gbmam6.seq - Other mammalian sequence entries, part 6.
2196. gbmam60.seq - Other mammalian sequence entries, part 60.
2197. gbmam61.seq - Other mammalian sequence entries, part 61.
2198. gbmam62.seq - Other mammalian sequence entries, part 62.
2199. gbmam63.seq - Other mammalian sequence entries, part 63.
2200. gbmam64.seq - Other mammalian sequence entries, part 64.
2201. gbmam65.seq - Other mammalian sequence entries, part 65.
2202. gbmam66.seq - Other mammalian sequence entries, part 66.
2203. gbmam67.seq - Other mammalian sequence entries, part 67.
2204. gbmam68.seq - Other mammalian sequence entries, part 68.
2205. gbmam69.seq - Other mammalian sequence entries, part 69.
2206. gbmam7.seq - Other mammalian sequence entries, part 7.
2207. gbmam70.seq - Other mammalian sequence entries, part 70.
2208. gbmam71.seq - Other mammalian sequence entries, part 71.
2209. gbmam72.seq - Other mammalian sequence entries, part 72.
2210. gbmam73.seq - Other mammalian sequence entries, part 73.
2211. gbmam74.seq - Other mammalian sequence entries, part 74.
2212. gbmam75.seq - Other mammalian sequence entries, part 75.
2213. gbmam76.seq - Other mammalian sequence entries, part 76.
2214. gbmam77.seq - Other mammalian sequence entries, part 77.
2215. gbmam78.seq - Other mammalian sequence entries, part 78.
2216. gbmam79.seq - Other mammalian sequence entries, part 79.
2217. gbmam8.seq - Other mammalian sequence entries, part 8.
2218. gbmam80.seq - Other mammalian sequence entries, part 80.
2219. gbmam81.seq - Other mammalian sequence entries, part 81.
2220. gbmam82.seq - Other mammalian sequence entries, part 82.
2221. gbmam83.seq - Other mammalian sequence entries, part 83.
2222. gbmam84.seq - Other mammalian sequence entries, part 84.
2223. gbmam85.seq - Other mammalian sequence entries, part 85.
2224. gbmam86.seq - Other mammalian sequence entries, part 86.
2225. gbmam87.seq - Other mammalian sequence entries, part 87.
2226. gbmam88.seq - Other mammalian sequence entries, part 88.
2227. gbmam89.seq - Other mammalian sequence entries, part 89.
2228. gbmam9.seq - Other mammalian sequence entries, part 9.
2229. gbmam90.seq - Other mammalian sequence entries, part 90.
2230. gbmam91.seq - Other mammalian sequence entries, part 91.
2231. gbnew.txt - Accession numbers of entries new since the previous release.
2232. gbpat1.seq - Patent sequence entries, part 1.
2233. gbpat10.seq - Patent sequence entries, part 10.
2234. gbpat100.seq - Patent sequence entries, part 100.
2235. gbpat101.seq - Patent sequence entries, part 101.
2236. gbpat102.seq - Patent sequence entries, part 102.
2237. gbpat103.seq - Patent sequence entries, part 103.
2238. gbpat104.seq - Patent sequence entries, part 104.
2239. gbpat105.seq - Patent sequence entries, part 105.
2240. gbpat106.seq - Patent sequence entries, part 106.
2241. gbpat107.seq - Patent sequence entries, part 107.
2242. gbpat108.seq - Patent sequence entries, part 108.
2243. gbpat109.seq - Patent sequence entries, part 109.
2244. gbpat11.seq - Patent sequence entries, part 11.
2245. gbpat110.seq - Patent sequence entries, part 110.
2246. gbpat111.seq - Patent sequence entries, part 111.
2247. gbpat112.seq - Patent sequence entries, part 112.
2248. gbpat113.seq - Patent sequence entries, part 113.
2249. gbpat114.seq - Patent sequence entries, part 114.
2250. gbpat115.seq - Patent sequence entries, part 115.
2251. gbpat116.seq - Patent sequence entries, part 116.
2252. gbpat117.seq - Patent sequence entries, part 117.
2253. gbpat118.seq - Patent sequence entries, part 118.
2254. gbpat119.seq - Patent sequence entries, part 119.
2255. gbpat12.seq - Patent sequence entries, part 12.
2256. gbpat120.seq - Patent sequence entries, part 120.
2257. gbpat121.seq - Patent sequence entries, part 121.
2258. gbpat122.seq - Patent sequence entries, part 122.
2259. gbpat123.seq - Patent sequence entries, part 123.
2260. gbpat124.seq - Patent sequence entries, part 124.
2261. gbpat125.seq - Patent sequence entries, part 125.
2262. gbpat126.seq - Patent sequence entries, part 126.
2263. gbpat127.seq - Patent sequence entries, part 127.
2264. gbpat128.seq - Patent sequence entries, part 128.
2265. gbpat129.seq - Patent sequence entries, part 129.
2266. gbpat13.seq - Patent sequence entries, part 13.
2267. gbpat130.seq - Patent sequence entries, part 130.
2268. gbpat131.seq - Patent sequence entries, part 131.
2269. gbpat132.seq - Patent sequence entries, part 132.
2270. gbpat133.seq - Patent sequence entries, part 133.
2271. gbpat134.seq - Patent sequence entries, part 134.
2272. gbpat135.seq - Patent sequence entries, part 135.
2273. gbpat136.seq - Patent sequence entries, part 136.
2274. gbpat137.seq - Patent sequence entries, part 137.
2275. gbpat138.seq - Patent sequence entries, part 138.
2276. gbpat139.seq - Patent sequence entries, part 139.
2277. gbpat14.seq - Patent sequence entries, part 14.
2278. gbpat140.seq - Patent sequence entries, part 140.
2279. gbpat141.seq - Patent sequence entries, part 141.
2280. gbpat142.seq - Patent sequence entries, part 142.
2281. gbpat143.seq - Patent sequence entries, part 143.
2282. gbpat144.seq - Patent sequence entries, part 144.
2283. gbpat145.seq - Patent sequence entries, part 145.
2284. gbpat146.seq - Patent sequence entries, part 146.
2285. gbpat147.seq - Patent sequence entries, part 147.
2286. gbpat148.seq - Patent sequence entries, part 148.
2287. gbpat149.seq - Patent sequence entries, part 149.
2288. gbpat15.seq - Patent sequence entries, part 15.
2289. gbpat150.seq - Patent sequence entries, part 150.
2290. gbpat151.seq - Patent sequence entries, part 151.
2291. gbpat152.seq - Patent sequence entries, part 152.
2292. gbpat153.seq - Patent sequence entries, part 153.
2293. gbpat154.seq - Patent sequence entries, part 154.
2294. gbpat155.seq - Patent sequence entries, part 155.
2295. gbpat156.seq - Patent sequence entries, part 156.
2296. gbpat157.seq - Patent sequence entries, part 157.
2297. gbpat158.seq - Patent sequence entries, part 158.
2298. gbpat159.seq - Patent sequence entries, part 159.
2299. gbpat16.seq - Patent sequence entries, part 16.
2300. gbpat160.seq - Patent sequence entries, part 160.
2301. gbpat161.seq - Patent sequence entries, part 161.
2302. gbpat162.seq - Patent sequence entries, part 162.
2303. gbpat163.seq - Patent sequence entries, part 163.
2304. gbpat164.seq - Patent sequence entries, part 164.
2305. gbpat165.seq - Patent sequence entries, part 165.
2306. gbpat166.seq - Patent sequence entries, part 166.
2307. gbpat167.seq - Patent sequence entries, part 167.
2308. gbpat168.seq - Patent sequence entries, part 168.
2309. gbpat169.seq - Patent sequence entries, part 169.
2310. gbpat17.seq - Patent sequence entries, part 17.
2311. gbpat170.seq - Patent sequence entries, part 170.
2312. gbpat171.seq - Patent sequence entries, part 171.
2313. gbpat172.seq - Patent sequence entries, part 172.
2314. gbpat173.seq - Patent sequence entries, part 173.
2315. gbpat174.seq - Patent sequence entries, part 174.
2316. gbpat175.seq - Patent sequence entries, part 175.
2317. gbpat176.seq - Patent sequence entries, part 176.
2318. gbpat177.seq - Patent sequence entries, part 177.
2319. gbpat178.seq - Patent sequence entries, part 178.
2320. gbpat179.seq - Patent sequence entries, part 179.
2321. gbpat18.seq - Patent sequence entries, part 18.
2322. gbpat180.seq - Patent sequence entries, part 180.
2323. gbpat181.seq - Patent sequence entries, part 181.
2324. gbpat182.seq - Patent sequence entries, part 182.
2325. gbpat183.seq - Patent sequence entries, part 183.
2326. gbpat184.seq - Patent sequence entries, part 184.
2327. gbpat185.seq - Patent sequence entries, part 185.
2328. gbpat186.seq - Patent sequence entries, part 186.
2329. gbpat187.seq - Patent sequence entries, part 187.
2330. gbpat188.seq - Patent sequence entries, part 188.
2331. gbpat189.seq - Patent sequence entries, part 189.
2332. gbpat19.seq - Patent sequence entries, part 19.
2333. gbpat190.seq - Patent sequence entries, part 190.
2334. gbpat191.seq - Patent sequence entries, part 191.
2335. gbpat192.seq - Patent sequence entries, part 192.
2336. gbpat193.seq - Patent sequence entries, part 193.
2337. gbpat194.seq - Patent sequence entries, part 194.
2338. gbpat195.seq - Patent sequence entries, part 195.
2339. gbpat196.seq - Patent sequence entries, part 196.
2340. gbpat197.seq - Patent sequence entries, part 197.
2341. gbpat198.seq - Patent sequence entries, part 198.
2342. gbpat199.seq - Patent sequence entries, part 199.
2343. gbpat2.seq - Patent sequence entries, part 2.
2344. gbpat20.seq - Patent sequence entries, part 20.
2345. gbpat200.seq - Patent sequence entries, part 200.
2346. gbpat201.seq - Patent sequence entries, part 201.
2347. gbpat202.seq - Patent sequence entries, part 202.
2348. gbpat203.seq - Patent sequence entries, part 203.
2349. gbpat204.seq - Patent sequence entries, part 204.
2350. gbpat205.seq - Patent sequence entries, part 205.
2351. gbpat206.seq - Patent sequence entries, part 206.
2352. gbpat207.seq - Patent sequence entries, part 207.
2353. gbpat208.seq - Patent sequence entries, part 208.
2354. gbpat209.seq - Patent sequence entries, part 209.
2355. gbpat21.seq - Patent sequence entries, part 21.
2356. gbpat210.seq - Patent sequence entries, part 210.
2357. gbpat211.seq - Patent sequence entries, part 211.
2358. gbpat212.seq - Patent sequence entries, part 212.
2359. gbpat213.seq - Patent sequence entries, part 213.
2360. gbpat214.seq - Patent sequence entries, part 214.
2361. gbpat215.seq - Patent sequence entries, part 215.
2362. gbpat216.seq - Patent sequence entries, part 216.
2363. gbpat217.seq - Patent sequence entries, part 217.
2364. gbpat218.seq - Patent sequence entries, part 218.
2365. gbpat219.seq - Patent sequence entries, part 219.
2366. gbpat22.seq - Patent sequence entries, part 22.
2367. gbpat220.seq - Patent sequence entries, part 220.
2368. gbpat221.seq - Patent sequence entries, part 221.
2369. gbpat222.seq - Patent sequence entries, part 222.
2370. gbpat223.seq - Patent sequence entries, part 223.
2371. gbpat224.seq - Patent sequence entries, part 224.
2372. gbpat225.seq - Patent sequence entries, part 225.
2373. gbpat226.seq - Patent sequence entries, part 226.
2374. gbpat227.seq - Patent sequence entries, part 227.
2375. gbpat228.seq - Patent sequence entries, part 228.
2376. gbpat229.seq - Patent sequence entries, part 229.
2377. gbpat23.seq - Patent sequence entries, part 23.
2378. gbpat230.seq - Patent sequence entries, part 230.
2379. gbpat24.seq - Patent sequence entries, part 24.
2380. gbpat25.seq - Patent sequence entries, part 25.
2381. gbpat26.seq - Patent sequence entries, part 26.
2382. gbpat27.seq - Patent sequence entries, part 27.
2383. gbpat28.seq - Patent sequence entries, part 28.
2384. gbpat29.seq - Patent sequence entries, part 29.
2385. gbpat3.seq - Patent sequence entries, part 3.
2386. gbpat30.seq - Patent sequence entries, part 30.
2387. gbpat31.seq - Patent sequence entries, part 31.
2388. gbpat32.seq - Patent sequence entries, part 32.
2389. gbpat33.seq - Patent sequence entries, part 33.
2390. gbpat34.seq - Patent sequence entries, part 34.
2391. gbpat35.seq - Patent sequence entries, part 35.
2392. gbpat36.seq - Patent sequence entries, part 36.
2393. gbpat37.seq - Patent sequence entries, part 37.
2394. gbpat38.seq - Patent sequence entries, part 38.
2395. gbpat39.seq - Patent sequence entries, part 39.
2396. gbpat4.seq - Patent sequence entries, part 4.
2397. gbpat40.seq - Patent sequence entries, part 40.
2398. gbpat41.seq - Patent sequence entries, part 41.
2399. gbpat42.seq - Patent sequence entries, part 42.
2400. gbpat43.seq - Patent sequence entries, part 43.
2401. gbpat44.seq - Patent sequence entries, part 44.
2402. gbpat45.seq - Patent sequence entries, part 45.
2403. gbpat46.seq - Patent sequence entries, part 46.
2404. gbpat47.seq - Patent sequence entries, part 47.
2405. gbpat48.seq - Patent sequence entries, part 48.
2406. gbpat49.seq - Patent sequence entries, part 49.
2407. gbpat5.seq - Patent sequence entries, part 5.
2408. gbpat50.seq - Patent sequence entries, part 50.
2409. gbpat51.seq - Patent sequence entries, part 51.
2410. gbpat52.seq - Patent sequence entries, part 52.
2411. gbpat53.seq - Patent sequence entries, part 53.
2412. gbpat54.seq - Patent sequence entries, part 54.
2413. gbpat55.seq - Patent sequence entries, part 55.
2414. gbpat56.seq - Patent sequence entries, part 56.
2415. gbpat57.seq - Patent sequence entries, part 57.
2416. gbpat58.seq - Patent sequence entries, part 58.
2417. gbpat59.seq - Patent sequence entries, part 59.
2418. gbpat6.seq - Patent sequence entries, part 6.
2419. gbpat60.seq - Patent sequence entries, part 60.
2420. gbpat61.seq - Patent sequence entries, part 61.
2421. gbpat62.seq - Patent sequence entries, part 62.
2422. gbpat63.seq - Patent sequence entries, part 63.
2423. gbpat64.seq - Patent sequence entries, part 64.
2424. gbpat65.seq - Patent sequence entries, part 65.
2425. gbpat66.seq - Patent sequence entries, part 66.
2426. gbpat67.seq - Patent sequence entries, part 67.
2427. gbpat68.seq - Patent sequence entries, part 68.
2428. gbpat69.seq - Patent sequence entries, part 69.
2429. gbpat7.seq - Patent sequence entries, part 7.
2430. gbpat70.seq - Patent sequence entries, part 70.
2431. gbpat71.seq - Patent sequence entries, part 71.
2432. gbpat72.seq - Patent sequence entries, part 72.
2433. gbpat73.seq - Patent sequence entries, part 73.
2434. gbpat74.seq - Patent sequence entries, part 74.
2435. gbpat75.seq - Patent sequence entries, part 75.
2436. gbpat76.seq - Patent sequence entries, part 76.
2437. gbpat77.seq - Patent sequence entries, part 77.
2438. gbpat78.seq - Patent sequence entries, part 78.
2439. gbpat79.seq - Patent sequence entries, part 79.
2440. gbpat8.seq - Patent sequence entries, part 8.
2441. gbpat80.seq - Patent sequence entries, part 80.
2442. gbpat81.seq - Patent sequence entries, part 81.
2443. gbpat82.seq - Patent sequence entries, part 82.
2444. gbpat83.seq - Patent sequence entries, part 83.
2445. gbpat84.seq - Patent sequence entries, part 84.
2446. gbpat85.seq - Patent sequence entries, part 85.
2447. gbpat86.seq - Patent sequence entries, part 86.
2448. gbpat87.seq - Patent sequence entries, part 87.
2449. gbpat88.seq - Patent sequence entries, part 88.
2450. gbpat89.seq - Patent sequence entries, part 89.
2451. gbpat9.seq - Patent sequence entries, part 9.
2452. gbpat90.seq - Patent sequence entries, part 90.
2453. gbpat91.seq - Patent sequence entries, part 91.
2454. gbpat92.seq - Patent sequence entries, part 92.
2455. gbpat93.seq - Patent sequence entries, part 93.
2456. gbpat94.seq - Patent sequence entries, part 94.
2457. gbpat95.seq - Patent sequence entries, part 95.
2458. gbpat96.seq - Patent sequence entries, part 96.
2459. gbpat97.seq - Patent sequence entries, part 97.
2460. gbpat98.seq - Patent sequence entries, part 98.
2461. gbpat99.seq - Patent sequence entries, part 99.
2462. gbphg1.seq - Phage sequence entries, part 1.
2463. gbphg2.seq - Phage sequence entries, part 2.
2464. gbphg3.seq - Phage sequence entries, part 3.
2465. gbphg4.seq - Phage sequence entries, part 4.
2466. gbphg5.seq - Phage sequence entries, part 5.
2467. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2468. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2469. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2470. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2471. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2472. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2473. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2474. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2475. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2476. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2477. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2478. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2479. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2480. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2481. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2482. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2483. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2484. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2485. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2486. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2487. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2488. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2489. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2490. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2491. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2492. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2493. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2494. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2495. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2496. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2497. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2498. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2499. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2500. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2501. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2502. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2503. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2504. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2505. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2506. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2507. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2508. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2509. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2510. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2511. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2512. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2513. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2514. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2515. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2516. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2517. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2518. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2519. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
2520. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
2521. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
2522. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
2523. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2524. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
2525. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
2526. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
2527. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
2528. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
2529. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
2530. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
2531. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
2532. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
2533. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
2534. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2535. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
2536. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
2537. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
2538. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
2539. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
2540. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
2541. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
2542. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
2543. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
2544. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
2545. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2546. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
2547. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
2548. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
2549. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
2550. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
2551. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
2552. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
2553. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
2554. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
2555. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
2556. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2557. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
2558. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
2559. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
2560. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
2561. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
2562. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
2563. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
2564. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
2565. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
2566. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
2567. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2568. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
2569. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
2570. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
2571. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
2572. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
2573. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
2574. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
2575. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
2576. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
2577. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
2578. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2579. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2580. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
2581. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
2582. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
2583. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
2584. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
2585. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
2586. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
2587. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
2588. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
2589. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
2590. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
2591. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
2592. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
2593. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
2594. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
2595. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
2596. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
2597. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
2598. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
2599. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
2600. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
2601. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
2602. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
2603. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
2604. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
2605. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
2606. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
2607. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
2608. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
2609. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
2610. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
2611. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
2612. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
2613. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
2614. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
2615. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
2616. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
2617. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
2618. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
2619. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
2620. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
2621. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
2622. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
2623. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
2624. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
2625. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
2626. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
2627. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
2628. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
2629. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
2630. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
2631. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
2632. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
2633. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
2634. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
2635. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
2636. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
2637. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
2638. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
2639. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
2640. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
2641. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
2642. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
2643. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
2644. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
2645. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
2646. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
2647. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
2648. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
2649. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
2650. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
2651. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
2652. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
2653. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
2654. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
2655. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
2656. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
2657. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
2658. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
2659. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
2660. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
2661. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
2662. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
2663. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
2664. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
2665. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
2666. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
2667. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
2668. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
2669. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
2670. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
2671. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
2672. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
2673. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
2674. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
2675. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
2676. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
2677. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
2678. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
2679. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
2680. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
2681. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
2682. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
2683. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
2684. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
2685. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
2686. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
2687. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
2688. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
2689. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
2690. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
2691. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
2692. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
2693. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
2694. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
2695. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
2696. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
2697. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
2698. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
2699. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
2700. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
2701. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
2702. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
2703. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
2704. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
2705. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
2706. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
2707. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
2708. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
2709. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
2710. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
2711. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
2712. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
2713. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
2714. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
2715. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
2716. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
2717. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
2718. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
2719. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
2720. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
2721. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
2722. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
2723. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
2724. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
2725. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
2726. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
2727. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
2728. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
2729. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
2730. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
2731. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
2732. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
2733. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
2734. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
2735. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
2736. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
2737. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
2738. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
2739. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
2740. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
2741. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
2742. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
2743. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
2744. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
2745. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
2746. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
2747. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
2748. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
2749. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
2750. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
2751. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
2752. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
2753. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
2754. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
2755. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
2756. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
2757. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
2758. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
2759. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
2760. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
2761. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
2762. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
2763. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
2764. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
2765. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
2766. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
2767. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
2768. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
2769. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
2770. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
2771. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
2772. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
2773. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
2774. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
2775. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
2776. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
2777. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
2778. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
2779. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
2780. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
2781. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
2782. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
2783. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
2784. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
2785. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
2786. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
2787. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
2788. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
2789. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
2790. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
2791. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
2792. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
2793. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
2794. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
2795. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
2796. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
2797. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
2798. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
2799. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
2800. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
2801. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
2802. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
2803. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
2804. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
2805. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
2806. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
2807. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
2808. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
2809. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
2810. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
2811. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
2812. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
2813. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
2814. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
2815. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
2816. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
2817. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
2818. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
2819. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
2820. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
2821. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
2822. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
2823. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
2824. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
2825. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
2826. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
2827. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
2828. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
2829. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
2830. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
2831. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
2832. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
2833. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
2834. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
2835. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
2836. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
2837. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
2838. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
2839. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
2840. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
2841. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
2842. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
2843. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
2844. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
2845. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
2846. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
2847. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
2848. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
2849. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
2850. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
2851. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
2852. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
2853. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
2854. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
2855. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
2856. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
2857. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
2858. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
2859. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
2860. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
2861. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
2862. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
2863. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
2864. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
2865. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
2866. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
2867. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
2868. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
2869. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
2870. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
2871. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
2872. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
2873. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
2874. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
2875. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
2876. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
2877. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
2878. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
2879. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
2880. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
2881. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
2882. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
2883. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
2884. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
2885. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
2886. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
2887. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
2888. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
2889. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
2890. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
2891. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
2892. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
2893. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
2894. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
2895. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
2896. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
2897. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
2898. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
2899. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
2900. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
2901. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
2902. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
2903. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
2904. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
2905. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
2906. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
2907. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
2908. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
2909. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
2910. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
2911. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
2912. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
2913. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
2914. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
2915. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
2916. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
2917. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
2918. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
2919. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
2920. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
2921. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
2922. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
2923. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
2924. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
2925. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
2926. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
2927. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
2928. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
2929. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
2930. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
2931. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
2932. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
2933. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
2934. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
2935. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
2936. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
2937. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
2938. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
2939. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
2940. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
2941. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
2942. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
2943. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
2944. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
2945. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
2946. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
2947. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
2948. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
2949. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
2950. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
2951. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
2952. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
2953. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
2954. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
2955. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
2956. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
2957. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
2958. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
2959. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
2960. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
2961. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
2962. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
2963. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
2964. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
2965. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548.
2966. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549.
2967. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
2968. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550.
2969. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551.
2970. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552.
2971. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553.
2972. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554.
2973. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555.
2974. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556.
2975. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557.
2976. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558.
2977. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559.
2978. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
2979. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560.
2980. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561.
2981. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562.
2982. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563.
2983. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564.
2984. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565.
2985. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566.
2986. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567.
2987. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568.
2988. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569.
2989. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
2990. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570.
2991. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571.
2992. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572.
2993. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573.
2994. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574.
2995. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575.
2996. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576.
2997. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577.
2998. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578.
2999. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579.
3000. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
3001. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580.
3002. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581.
3003. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582.
3004. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583.
3005. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584.
3006. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585.
3007. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586.
3008. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587.
3009. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588.
3010. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589.
3011. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
3012. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590.
3013. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591.
3014. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592.
3015. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593.
3016. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594.
3017. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595.
3018. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596.
3019. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597.
3020. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598.
3021. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599.
3022. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
3023. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
3024. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600.
3025. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601.
3026. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602.
3027. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603.
3028. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604.
3029. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605.
3030. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606.
3031. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607.
3032. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608.
3033. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609.
3034. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
3035. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610.
3036. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611.
3037. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612.
3038. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613.
3039. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614.
3040. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615.
3041. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616.
3042. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617.
3043. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618.
3044. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619.
3045. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
3046. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620.
3047. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621.
3048. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622.
3049. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623.
3050. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624.
3051. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625.
3052. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626.
3053. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627.
3054. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628.
3055. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629.
3056. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
3057. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630.
3058. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631.
3059. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632.
3060. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633.
3061. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634.
3062. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635.
3063. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636.
3064. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637.
3065. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638.
3066. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639.
3067. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
3068. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640.
3069. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641.
3070. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642.
3071. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643.
3072. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644.
3073. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645.
3074. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646.
3075. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647.
3076. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648.
3077. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649.
3078. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
3079. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650.
3080. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651.
3081. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652.
3082. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653.
3083. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654.
3084. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655.
3085. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656.
3086. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657.
3087. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658.
3088. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659.
3089. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
3090. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660.
3091. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661.
3092. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662.
3093. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663.
3094. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664.
3095. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
3096. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
3097. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
3098. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
3099. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
3100. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
3101. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
3102. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
3103. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
3104. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
3105. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
3106. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
3107. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
3108. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
3109. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
3110. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
3111. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
3112. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
3113. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
3114. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
3115. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
3116. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
3117. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
3118. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
3119. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
3120. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
3121. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
3122. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
3123. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
3124. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
3125. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
3126. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
3127. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
3128. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
3129. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
3130. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
3131. gbpri1.seq - Primate sequence entries, part 1.
3132. gbpri10.seq - Primate sequence entries, part 10.
3133. gbpri11.seq - Primate sequence entries, part 11.
3134. gbpri12.seq - Primate sequence entries, part 12.
3135. gbpri13.seq - Primate sequence entries, part 13.
3136. gbpri14.seq - Primate sequence entries, part 14.
3137. gbpri15.seq - Primate sequence entries, part 15.
3138. gbpri16.seq - Primate sequence entries, part 16.
3139. gbpri17.seq - Primate sequence entries, part 17.
3140. gbpri18.seq - Primate sequence entries, part 18.
3141. gbpri19.seq - Primate sequence entries, part 19.
3142. gbpri2.seq - Primate sequence entries, part 2.
3143. gbpri20.seq - Primate sequence entries, part 20.
3144. gbpri21.seq - Primate sequence entries, part 21.
3145. gbpri22.seq - Primate sequence entries, part 22.
3146. gbpri23.seq - Primate sequence entries, part 23.
3147. gbpri24.seq - Primate sequence entries, part 24.
3148. gbpri25.seq - Primate sequence entries, part 25.
3149. gbpri26.seq - Primate sequence entries, part 26.
3150. gbpri27.seq - Primate sequence entries, part 27.
3151. gbpri28.seq - Primate sequence entries, part 28.
3152. gbpri29.seq - Primate sequence entries, part 29.
3153. gbpri3.seq - Primate sequence entries, part 3.
3154. gbpri30.seq - Primate sequence entries, part 30.
3155. gbpri31.seq - Primate sequence entries, part 31.
3156. gbpri32.seq - Primate sequence entries, part 32.
3157. gbpri33.seq - Primate sequence entries, part 33.
3158. gbpri34.seq - Primate sequence entries, part 34.
3159. gbpri35.seq - Primate sequence entries, part 35.
3160. gbpri36.seq - Primate sequence entries, part 36.
3161. gbpri37.seq - Primate sequence entries, part 37.
3162. gbpri38.seq - Primate sequence entries, part 38.
3163. gbpri39.seq - Primate sequence entries, part 39.
3164. gbpri4.seq - Primate sequence entries, part 4.
3165. gbpri40.seq - Primate sequence entries, part 40.
3166. gbpri41.seq - Primate sequence entries, part 41.
3167. gbpri42.seq - Primate sequence entries, part 42.
3168. gbpri43.seq - Primate sequence entries, part 43.
3169. gbpri44.seq - Primate sequence entries, part 44.
3170. gbpri45.seq - Primate sequence entries, part 45.
3171. gbpri46.seq - Primate sequence entries, part 46.
3172. gbpri47.seq - Primate sequence entries, part 47.
3173. gbpri48.seq - Primate sequence entries, part 48.
3174. gbpri49.seq - Primate sequence entries, part 49.
3175. gbpri5.seq - Primate sequence entries, part 5.
3176. gbpri50.seq - Primate sequence entries, part 50.
3177. gbpri51.seq - Primate sequence entries, part 51.
3178. gbpri52.seq - Primate sequence entries, part 52.
3179. gbpri53.seq - Primate sequence entries, part 53.
3180. gbpri54.seq - Primate sequence entries, part 54.
3181. gbpri55.seq - Primate sequence entries, part 55.
3182. gbpri6.seq - Primate sequence entries, part 6.
3183. gbpri7.seq - Primate sequence entries, part 7.
3184. gbpri8.seq - Primate sequence entries, part 8.
3185. gbpri9.seq - Primate sequence entries, part 9.
3186. gbrel.txt - Release notes (this document).
3187. gbrod1.seq - Rodent sequence entries, part 1.
3188. gbrod10.seq - Rodent sequence entries, part 10.
3189. gbrod11.seq - Rodent sequence entries, part 11.
3190. gbrod12.seq - Rodent sequence entries, part 12.
3191. gbrod13.seq - Rodent sequence entries, part 13.
3192. gbrod14.seq - Rodent sequence entries, part 14.
3193. gbrod15.seq - Rodent sequence entries, part 15.
3194. gbrod16.seq - Rodent sequence entries, part 16.
3195. gbrod17.seq - Rodent sequence entries, part 17.
3196. gbrod18.seq - Rodent sequence entries, part 18.
3197. gbrod19.seq - Rodent sequence entries, part 19.
3198. gbrod2.seq - Rodent sequence entries, part 2.
3199. gbrod20.seq - Rodent sequence entries, part 20.
3200. gbrod21.seq - Rodent sequence entries, part 21.
3201. gbrod22.seq - Rodent sequence entries, part 22.
3202. gbrod23.seq - Rodent sequence entries, part 23.
3203. gbrod24.seq - Rodent sequence entries, part 24.
3204. gbrod25.seq - Rodent sequence entries, part 25.
3205. gbrod26.seq - Rodent sequence entries, part 26.
3206. gbrod27.seq - Rodent sequence entries, part 27.
3207. gbrod28.seq - Rodent sequence entries, part 28.
3208. gbrod29.seq - Rodent sequence entries, part 29.
3209. gbrod3.seq - Rodent sequence entries, part 3.
3210. gbrod30.seq - Rodent sequence entries, part 30.
3211. gbrod31.seq - Rodent sequence entries, part 31.
3212. gbrod32.seq - Rodent sequence entries, part 32.
3213. gbrod33.seq - Rodent sequence entries, part 33.
3214. gbrod34.seq - Rodent sequence entries, part 34.
3215. gbrod35.seq - Rodent sequence entries, part 35.
3216. gbrod36.seq - Rodent sequence entries, part 36.
3217. gbrod37.seq - Rodent sequence entries, part 37.
3218. gbrod38.seq - Rodent sequence entries, part 38.
3219. gbrod39.seq - Rodent sequence entries, part 39.
3220. gbrod4.seq - Rodent sequence entries, part 4.
3221. gbrod40.seq - Rodent sequence entries, part 40.
3222. gbrod41.seq - Rodent sequence entries, part 41.
3223. gbrod42.seq - Rodent sequence entries, part 42.
3224. gbrod43.seq - Rodent sequence entries, part 43.
3225. gbrod44.seq - Rodent sequence entries, part 44.
3226. gbrod45.seq - Rodent sequence entries, part 45.
3227. gbrod46.seq - Rodent sequence entries, part 46.
3228. gbrod47.seq - Rodent sequence entries, part 47.
3229. gbrod48.seq - Rodent sequence entries, part 48.
3230. gbrod49.seq - Rodent sequence entries, part 49.
3231. gbrod5.seq - Rodent sequence entries, part 5.
3232. gbrod50.seq - Rodent sequence entries, part 50.
3233. gbrod51.seq - Rodent sequence entries, part 51.
3234. gbrod52.seq - Rodent sequence entries, part 52.
3235. gbrod53.seq - Rodent sequence entries, part 53.
3236. gbrod54.seq - Rodent sequence entries, part 54.
3237. gbrod55.seq - Rodent sequence entries, part 55.
3238. gbrod56.seq - Rodent sequence entries, part 56.
3239. gbrod6.seq - Rodent sequence entries, part 6.
3240. gbrod7.seq - Rodent sequence entries, part 7.
3241. gbrod8.seq - Rodent sequence entries, part 8.
3242. gbrod9.seq - Rodent sequence entries, part 9.
3243. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
3244. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
3245. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
3246. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
3247. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
3248. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
3249. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
3250. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
3251. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
3252. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
3253. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
3254. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
3255. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
3256. gbsyn11.seq - Synthetic and chimeric sequence entries, part 11.
3257. gbsyn12.seq - Synthetic and chimeric sequence entries, part 12.
3258. gbsyn13.seq - Synthetic and chimeric sequence entries, part 13.
3259. gbsyn14.seq - Synthetic and chimeric sequence entries, part 14.
3260. gbsyn15.seq - Synthetic and chimeric sequence entries, part 15.
3261. gbsyn16.seq - Synthetic and chimeric sequence entries, part 16.
3262. gbsyn17.seq - Synthetic and chimeric sequence entries, part 17.
3263. gbsyn18.seq - Synthetic and chimeric sequence entries, part 18.
3264. gbsyn19.seq - Synthetic and chimeric sequence entries, part 19.
3265. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
3266. gbsyn20.seq - Synthetic and chimeric sequence entries, part 20.
3267. gbsyn21.seq - Synthetic and chimeric sequence entries, part 21.
3268. gbsyn22.seq - Synthetic and chimeric sequence entries, part 22.
3269. gbsyn23.seq - Synthetic and chimeric sequence entries, part 23.
3270. gbsyn24.seq - Synthetic and chimeric sequence entries, part 24.
3271. gbsyn25.seq - Synthetic and chimeric sequence entries, part 25.
3272. gbsyn26.seq - Synthetic and chimeric sequence entries, part 26.
3273. gbsyn27.seq - Synthetic and chimeric sequence entries, part 27.
3274. gbsyn28.seq - Synthetic and chimeric sequence entries, part 28.
3275. gbsyn29.seq - Synthetic and chimeric sequence entries, part 29.
3276. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
3277. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
3278. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
3279. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
3280. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
3281. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
3282. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
3283. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
3284. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
3285. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
3286. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
3287. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
3288. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
3289. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
3290. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
3291. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
3292. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
3293. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
3294. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
3295. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
3296. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
3297. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
3298. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
3299. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
3300. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
3301. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
3302. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
3303. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
3304. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
3305. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
3306. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
3307. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
3308. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
3309. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
3310. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
3311. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
3312. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
3313. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
3314. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
3315. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
3316. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
3317. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
3318. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
3319. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
3320. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
3321. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
3322. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
3323. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
3324. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
3325. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
3326. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
3327. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
3328. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
3329. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
3330. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
3331. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
3332. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
3333. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
3334. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
3335. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
3336. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
3337. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
3338. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
3339. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
3340. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
3341. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
3342. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
3343. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
3344. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
3345. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
3346. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
3347. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
3348. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
3349. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
3350. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
3351. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
3352. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
3353. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
3354. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
3355. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
3356. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
3357. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
3358. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
3359. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
3360. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
3361. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
3362. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
3363. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
3364. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
3365. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
3366. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
3367. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
3368. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
3369. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
3370. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
3371. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
3372. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
3373. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
3374. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
3375. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
3376. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
3377. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
3378. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
3379. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
3380. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
3381. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
3382. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
3383. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
3384. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
3385. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
3386. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
3387. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
3388. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
3389. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
3390. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
3391. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
3392. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
3393. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
3394. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
3395. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
3396. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
3397. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
3398. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
3399. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
3400. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
3401. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
3402. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
3403. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
3404. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
3405. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
3406. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
3407. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
3408. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
3409. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
3410. gbuna1.seq - Unannotated sequence entries, part 1.
3411. gbvrl1.seq - Viral sequence entries, part 1.
3412. gbvrl10.seq - Viral sequence entries, part 10.
3413. gbvrl100.seq - Viral sequence entries, part 100.
3414. gbvrl101.seq - Viral sequence entries, part 101.
3415. gbvrl102.seq - Viral sequence entries, part 102.
3416. gbvrl103.seq - Viral sequence entries, part 103.
3417. gbvrl104.seq - Viral sequence entries, part 104.
3418. gbvrl105.seq - Viral sequence entries, part 105.
3419. gbvrl106.seq - Viral sequence entries, part 106.
3420. gbvrl107.seq - Viral sequence entries, part 107.
3421. gbvrl108.seq - Viral sequence entries, part 108.
3422. gbvrl109.seq - Viral sequence entries, part 109.
3423. gbvrl11.seq - Viral sequence entries, part 11.
3424. gbvrl110.seq - Viral sequence entries, part 110.
3425. gbvrl111.seq - Viral sequence entries, part 111.
3426. gbvrl112.seq - Viral sequence entries, part 112.
3427. gbvrl113.seq - Viral sequence entries, part 113.
3428. gbvrl114.seq - Viral sequence entries, part 114.
3429. gbvrl115.seq - Viral sequence entries, part 115.
3430. gbvrl116.seq - Viral sequence entries, part 116.
3431. gbvrl117.seq - Viral sequence entries, part 117.
3432. gbvrl118.seq - Viral sequence entries, part 118.
3433. gbvrl119.seq - Viral sequence entries, part 119.
3434. gbvrl12.seq - Viral sequence entries, part 12.
3435. gbvrl120.seq - Viral sequence entries, part 120.
3436. gbvrl121.seq - Viral sequence entries, part 121.
3437. gbvrl122.seq - Viral sequence entries, part 122.
3438. gbvrl123.seq - Viral sequence entries, part 123.
3439. gbvrl124.seq - Viral sequence entries, part 124.
3440. gbvrl125.seq - Viral sequence entries, part 125.
3441. gbvrl126.seq - Viral sequence entries, part 126.
3442. gbvrl127.seq - Viral sequence entries, part 127.
3443. gbvrl128.seq - Viral sequence entries, part 128.
3444. gbvrl129.seq - Viral sequence entries, part 129.
3445. gbvrl13.seq - Viral sequence entries, part 13.
3446. gbvrl130.seq - Viral sequence entries, part 130.
3447. gbvrl14.seq - Viral sequence entries, part 14.
3448. gbvrl15.seq - Viral sequence entries, part 15.
3449. gbvrl16.seq - Viral sequence entries, part 16.
3450. gbvrl17.seq - Viral sequence entries, part 17.
3451. gbvrl18.seq - Viral sequence entries, part 18.
3452. gbvrl19.seq - Viral sequence entries, part 19.
3453. gbvrl2.seq - Viral sequence entries, part 2.
3454. gbvrl20.seq - Viral sequence entries, part 20.
3455. gbvrl21.seq - Viral sequence entries, part 21.
3456. gbvrl22.seq - Viral sequence entries, part 22.
3457. gbvrl23.seq - Viral sequence entries, part 23.
3458. gbvrl24.seq - Viral sequence entries, part 24.
3459. gbvrl25.seq - Viral sequence entries, part 25.
3460. gbvrl26.seq - Viral sequence entries, part 26.
3461. gbvrl27.seq - Viral sequence entries, part 27.
3462. gbvrl28.seq - Viral sequence entries, part 28.
3463. gbvrl29.seq - Viral sequence entries, part 29.
3464. gbvrl3.seq - Viral sequence entries, part 3.
3465. gbvrl30.seq - Viral sequence entries, part 30.
3466. gbvrl31.seq - Viral sequence entries, part 31.
3467. gbvrl32.seq - Viral sequence entries, part 32.
3468. gbvrl33.seq - Viral sequence entries, part 33.
3469. gbvrl34.seq - Viral sequence entries, part 34.
3470. gbvrl35.seq - Viral sequence entries, part 35.
3471. gbvrl36.seq - Viral sequence entries, part 36.
3472. gbvrl37.seq - Viral sequence entries, part 37.
3473. gbvrl38.seq - Viral sequence entries, part 38.
3474. gbvrl39.seq - Viral sequence entries, part 39.
3475. gbvrl4.seq - Viral sequence entries, part 4.
3476. gbvrl40.seq - Viral sequence entries, part 40.
3477. gbvrl41.seq - Viral sequence entries, part 41.
3478. gbvrl42.seq - Viral sequence entries, part 42.
3479. gbvrl43.seq - Viral sequence entries, part 43.
3480. gbvrl44.seq - Viral sequence entries, part 44.
3481. gbvrl45.seq - Viral sequence entries, part 45.
3482. gbvrl46.seq - Viral sequence entries, part 46.
3483. gbvrl47.seq - Viral sequence entries, part 47.
3484. gbvrl48.seq - Viral sequence entries, part 48.
3485. gbvrl49.seq - Viral sequence entries, part 49.
3486. gbvrl5.seq - Viral sequence entries, part 5.
3487. gbvrl50.seq - Viral sequence entries, part 50.
3488. gbvrl51.seq - Viral sequence entries, part 51.
3489. gbvrl52.seq - Viral sequence entries, part 52.
3490. gbvrl53.seq - Viral sequence entries, part 53.
3491. gbvrl54.seq - Viral sequence entries, part 54.
3492. gbvrl55.seq - Viral sequence entries, part 55.
3493. gbvrl56.seq - Viral sequence entries, part 56.
3494. gbvrl57.seq - Viral sequence entries, part 57.
3495. gbvrl58.seq - Viral sequence entries, part 58.
3496. gbvrl59.seq - Viral sequence entries, part 59.
3497. gbvrl6.seq - Viral sequence entries, part 6.
3498. gbvrl60.seq - Viral sequence entries, part 60.
3499. gbvrl61.seq - Viral sequence entries, part 61.
3500. gbvrl62.seq - Viral sequence entries, part 62.
3501. gbvrl63.seq - Viral sequence entries, part 63.
3502. gbvrl64.seq - Viral sequence entries, part 64.
3503. gbvrl65.seq - Viral sequence entries, part 65.
3504. gbvrl66.seq - Viral sequence entries, part 66.
3505. gbvrl67.seq - Viral sequence entries, part 67.
3506. gbvrl68.seq - Viral sequence entries, part 68.
3507. gbvrl69.seq - Viral sequence entries, part 69.
3508. gbvrl7.seq - Viral sequence entries, part 7.
3509. gbvrl70.seq - Viral sequence entries, part 70.
3510. gbvrl71.seq - Viral sequence entries, part 71.
3511. gbvrl72.seq - Viral sequence entries, part 72.
3512. gbvrl73.seq - Viral sequence entries, part 73.
3513. gbvrl74.seq - Viral sequence entries, part 74.
3514. gbvrl75.seq - Viral sequence entries, part 75.
3515. gbvrl76.seq - Viral sequence entries, part 76.
3516. gbvrl77.seq - Viral sequence entries, part 77.
3517. gbvrl78.seq - Viral sequence entries, part 78.
3518. gbvrl79.seq - Viral sequence entries, part 79.
3519. gbvrl8.seq - Viral sequence entries, part 8.
3520. gbvrl80.seq - Viral sequence entries, part 80.
3521. gbvrl81.seq - Viral sequence entries, part 81.
3522. gbvrl82.seq - Viral sequence entries, part 82.
3523. gbvrl83.seq - Viral sequence entries, part 83.
3524. gbvrl84.seq - Viral sequence entries, part 84.
3525. gbvrl85.seq - Viral sequence entries, part 85.
3526. gbvrl86.seq - Viral sequence entries, part 86.
3527. gbvrl87.seq - Viral sequence entries, part 87.
3528. gbvrl88.seq - Viral sequence entries, part 88.
3529. gbvrl89.seq - Viral sequence entries, part 89.
3530. gbvrl9.seq - Viral sequence entries, part 9.
3531. gbvrl90.seq - Viral sequence entries, part 90.
3532. gbvrl91.seq - Viral sequence entries, part 91.
3533. gbvrl92.seq - Viral sequence entries, part 92.
3534. gbvrl93.seq - Viral sequence entries, part 93.
3535. gbvrl94.seq - Viral sequence entries, part 94.
3536. gbvrl95.seq - Viral sequence entries, part 95.
3537. gbvrl96.seq - Viral sequence entries, part 96.
3538. gbvrl97.seq - Viral sequence entries, part 97.
3539. gbvrl98.seq - Viral sequence entries, part 98.
3540. gbvrl99.seq - Viral sequence entries, part 99.
3541. gbvrt1.seq - Other vertebrate sequence entries, part 1.
3542. gbvrt10.seq - Other vertebrate sequence entries, part 10.
3543. gbvrt100.seq - Other vertebrate sequence entries, part 100.
3544. gbvrt101.seq - Other vertebrate sequence entries, part 101.
3545. gbvrt102.seq - Other vertebrate sequence entries, part 102.
3546. gbvrt103.seq - Other vertebrate sequence entries, part 103.
3547. gbvrt104.seq - Other vertebrate sequence entries, part 104.
3548. gbvrt105.seq - Other vertebrate sequence entries, part 105.
3549. gbvrt106.seq - Other vertebrate sequence entries, part 106.
3550. gbvrt107.seq - Other vertebrate sequence entries, part 107.
3551. gbvrt108.seq - Other vertebrate sequence entries, part 108.
3552. gbvrt109.seq - Other vertebrate sequence entries, part 109.
3553. gbvrt11.seq - Other vertebrate sequence entries, part 11.
3554. gbvrt110.seq - Other vertebrate sequence entries, part 110.
3555. gbvrt111.seq - Other vertebrate sequence entries, part 111.
3556. gbvrt112.seq - Other vertebrate sequence entries, part 112.
3557. gbvrt113.seq - Other vertebrate sequence entries, part 113.
3558. gbvrt114.seq - Other vertebrate sequence entries, part 114.
3559. gbvrt115.seq - Other vertebrate sequence entries, part 115.
3560. gbvrt116.seq - Other vertebrate sequence entries, part 116.
3561. gbvrt117.seq - Other vertebrate sequence entries, part 117.
3562. gbvrt118.seq - Other vertebrate sequence entries, part 118.
3563. gbvrt119.seq - Other vertebrate sequence entries, part 119.
3564. gbvrt12.seq - Other vertebrate sequence entries, part 12.
3565. gbvrt120.seq - Other vertebrate sequence entries, part 120.
3566. gbvrt121.seq - Other vertebrate sequence entries, part 121.
3567. gbvrt122.seq - Other vertebrate sequence entries, part 122.
3568. gbvrt123.seq - Other vertebrate sequence entries, part 123.
3569. gbvrt124.seq - Other vertebrate sequence entries, part 124.
3570. gbvrt125.seq - Other vertebrate sequence entries, part 125.
3571. gbvrt126.seq - Other vertebrate sequence entries, part 126.
3572. gbvrt127.seq - Other vertebrate sequence entries, part 127.
3573. gbvrt128.seq - Other vertebrate sequence entries, part 128.
3574. gbvrt129.seq - Other vertebrate sequence entries, part 129.
3575. gbvrt13.seq - Other vertebrate sequence entries, part 13.
3576. gbvrt130.seq - Other vertebrate sequence entries, part 130.
3577. gbvrt131.seq - Other vertebrate sequence entries, part 131.
3578. gbvrt132.seq - Other vertebrate sequence entries, part 132.
3579. gbvrt133.seq - Other vertebrate sequence entries, part 133.
3580. gbvrt134.seq - Other vertebrate sequence entries, part 134.
3581. gbvrt135.seq - Other vertebrate sequence entries, part 135.
3582. gbvrt136.seq - Other vertebrate sequence entries, part 136.
3583. gbvrt137.seq - Other vertebrate sequence entries, part 137.
3584. gbvrt138.seq - Other vertebrate sequence entries, part 138.
3585. gbvrt139.seq - Other vertebrate sequence entries, part 139.
3586. gbvrt14.seq - Other vertebrate sequence entries, part 14.
3587. gbvrt140.seq - Other vertebrate sequence entries, part 140.
3588. gbvrt141.seq - Other vertebrate sequence entries, part 141.
3589. gbvrt142.seq - Other vertebrate sequence entries, part 142.
3590. gbvrt143.seq - Other vertebrate sequence entries, part 143.
3591. gbvrt144.seq - Other vertebrate sequence entries, part 144.
3592. gbvrt145.seq - Other vertebrate sequence entries, part 145.
3593. gbvrt146.seq - Other vertebrate sequence entries, part 146.
3594. gbvrt147.seq - Other vertebrate sequence entries, part 147.
3595. gbvrt148.seq - Other vertebrate sequence entries, part 148.
3596. gbvrt149.seq - Other vertebrate sequence entries, part 149.
3597. gbvrt15.seq - Other vertebrate sequence entries, part 15.
3598. gbvrt150.seq - Other vertebrate sequence entries, part 150.
3599. gbvrt151.seq - Other vertebrate sequence entries, part 151.
3600. gbvrt152.seq - Other vertebrate sequence entries, part 152.
3601. gbvrt153.seq - Other vertebrate sequence entries, part 153.
3602. gbvrt154.seq - Other vertebrate sequence entries, part 154.
3603. gbvrt155.seq - Other vertebrate sequence entries, part 155.
3604. gbvrt156.seq - Other vertebrate sequence entries, part 156.
3605. gbvrt157.seq - Other vertebrate sequence entries, part 157.
3606. gbvrt158.seq - Other vertebrate sequence entries, part 158.
3607. gbvrt159.seq - Other vertebrate sequence entries, part 159.
3608. gbvrt16.seq - Other vertebrate sequence entries, part 16.
3609. gbvrt160.seq - Other vertebrate sequence entries, part 160.
3610. gbvrt161.seq - Other vertebrate sequence entries, part 161.
3611. gbvrt162.seq - Other vertebrate sequence entries, part 162.
3612. gbvrt163.seq - Other vertebrate sequence entries, part 163.
3613. gbvrt164.seq - Other vertebrate sequence entries, part 164.
3614. gbvrt165.seq - Other vertebrate sequence entries, part 165.
3615. gbvrt166.seq - Other vertebrate sequence entries, part 166.
3616. gbvrt167.seq - Other vertebrate sequence entries, part 167.
3617. gbvrt168.seq - Other vertebrate sequence entries, part 168.
3618. gbvrt169.seq - Other vertebrate sequence entries, part 169.
3619. gbvrt17.seq - Other vertebrate sequence entries, part 17.
3620. gbvrt170.seq - Other vertebrate sequence entries, part 170.
3621. gbvrt171.seq - Other vertebrate sequence entries, part 171.
3622. gbvrt172.seq - Other vertebrate sequence entries, part 172.
3623. gbvrt173.seq - Other vertebrate sequence entries, part 173.
3624. gbvrt174.seq - Other vertebrate sequence entries, part 174.
3625. gbvrt175.seq - Other vertebrate sequence entries, part 175.
3626. gbvrt176.seq - Other vertebrate sequence entries, part 176.
3627. gbvrt177.seq - Other vertebrate sequence entries, part 177.
3628. gbvrt178.seq - Other vertebrate sequence entries, part 178.
3629. gbvrt179.seq - Other vertebrate sequence entries, part 179.
3630. gbvrt18.seq - Other vertebrate sequence entries, part 18.
3631. gbvrt180.seq - Other vertebrate sequence entries, part 180.
3632. gbvrt181.seq - Other vertebrate sequence entries, part 181.
3633. gbvrt182.seq - Other vertebrate sequence entries, part 182.
3634. gbvrt183.seq - Other vertebrate sequence entries, part 183.
3635. gbvrt184.seq - Other vertebrate sequence entries, part 184.
3636. gbvrt185.seq - Other vertebrate sequence entries, part 185.
3637. gbvrt186.seq - Other vertebrate sequence entries, part 186.
3638. gbvrt187.seq - Other vertebrate sequence entries, part 187.
3639. gbvrt188.seq - Other vertebrate sequence entries, part 188.
3640. gbvrt189.seq - Other vertebrate sequence entries, part 189.
3641. gbvrt19.seq - Other vertebrate sequence entries, part 19.
3642. gbvrt190.seq - Other vertebrate sequence entries, part 190.
3643. gbvrt191.seq - Other vertebrate sequence entries, part 191.
3644. gbvrt192.seq - Other vertebrate sequence entries, part 192.
3645. gbvrt193.seq - Other vertebrate sequence entries, part 193.
3646. gbvrt194.seq - Other vertebrate sequence entries, part 194.
3647. gbvrt195.seq - Other vertebrate sequence entries, part 195.
3648. gbvrt196.seq - Other vertebrate sequence entries, part 196.
3649. gbvrt197.seq - Other vertebrate sequence entries, part 197.
3650. gbvrt198.seq - Other vertebrate sequence entries, part 198.
3651. gbvrt199.seq - Other vertebrate sequence entries, part 199.
3652. gbvrt2.seq - Other vertebrate sequence entries, part 2.
3653. gbvrt20.seq - Other vertebrate sequence entries, part 20.
3654. gbvrt200.seq - Other vertebrate sequence entries, part 200.
3655. gbvrt201.seq - Other vertebrate sequence entries, part 201.
3656. gbvrt202.seq - Other vertebrate sequence entries, part 202.
3657. gbvrt203.seq - Other vertebrate sequence entries, part 203.
3658. gbvrt204.seq - Other vertebrate sequence entries, part 204.
3659. gbvrt205.seq - Other vertebrate sequence entries, part 205.
3660. gbvrt206.seq - Other vertebrate sequence entries, part 206.
3661. gbvrt207.seq - Other vertebrate sequence entries, part 207.
3662. gbvrt208.seq - Other vertebrate sequence entries, part 208.
3663. gbvrt209.seq - Other vertebrate sequence entries, part 209.
3664. gbvrt21.seq - Other vertebrate sequence entries, part 21.
3665. gbvrt210.seq - Other vertebrate sequence entries, part 210.
3666. gbvrt211.seq - Other vertebrate sequence entries, part 211.
3667. gbvrt212.seq - Other vertebrate sequence entries, part 212.
3668. gbvrt213.seq - Other vertebrate sequence entries, part 213.
3669. gbvrt214.seq - Other vertebrate sequence entries, part 214.
3670. gbvrt215.seq - Other vertebrate sequence entries, part 215.
3671. gbvrt216.seq - Other vertebrate sequence entries, part 216.
3672. gbvrt217.seq - Other vertebrate sequence entries, part 217.
3673. gbvrt218.seq - Other vertebrate sequence entries, part 218.
3674. gbvrt219.seq - Other vertebrate sequence entries, part 219.
3675. gbvrt22.seq - Other vertebrate sequence entries, part 22.
3676. gbvrt220.seq - Other vertebrate sequence entries, part 220.
3677. gbvrt221.seq - Other vertebrate sequence entries, part 221.
3678. gbvrt222.seq - Other vertebrate sequence entries, part 222.
3679. gbvrt223.seq - Other vertebrate sequence entries, part 223.
3680. gbvrt224.seq - Other vertebrate sequence entries, part 224.
3681. gbvrt225.seq - Other vertebrate sequence entries, part 225.
3682. gbvrt226.seq - Other vertebrate sequence entries, part 226.
3683. gbvrt227.seq - Other vertebrate sequence entries, part 227.
3684. gbvrt228.seq - Other vertebrate sequence entries, part 228.
3685. gbvrt229.seq - Other vertebrate sequence entries, part 229.
3686. gbvrt23.seq - Other vertebrate sequence entries, part 23.
3687. gbvrt230.seq - Other vertebrate sequence entries, part 230.
3688. gbvrt231.seq - Other vertebrate sequence entries, part 231.
3689. gbvrt232.seq - Other vertebrate sequence entries, part 232.
3690. gbvrt233.seq - Other vertebrate sequence entries, part 233.
3691. gbvrt234.seq - Other vertebrate sequence entries, part 234.
3692. gbvrt235.seq - Other vertebrate sequence entries, part 235.
3693. gbvrt236.seq - Other vertebrate sequence entries, part 236.
3694. gbvrt237.seq - Other vertebrate sequence entries, part 237.
3695. gbvrt238.seq - Other vertebrate sequence entries, part 238.
3696. gbvrt239.seq - Other vertebrate sequence entries, part 239.
3697. gbvrt24.seq - Other vertebrate sequence entries, part 24.
3698. gbvrt240.seq - Other vertebrate sequence entries, part 240.
3699. gbvrt241.seq - Other vertebrate sequence entries, part 241.
3700. gbvrt242.seq - Other vertebrate sequence entries, part 242.
3701. gbvrt243.seq - Other vertebrate sequence entries, part 243.
3702. gbvrt244.seq - Other vertebrate sequence entries, part 244.
3703. gbvrt245.seq - Other vertebrate sequence entries, part 245.
3704. gbvrt246.seq - Other vertebrate sequence entries, part 246.
3705. gbvrt247.seq - Other vertebrate sequence entries, part 247.
3706. gbvrt248.seq - Other vertebrate sequence entries, part 248.
3707. gbvrt249.seq - Other vertebrate sequence entries, part 249.
3708. gbvrt25.seq - Other vertebrate sequence entries, part 25.
3709. gbvrt250.seq - Other vertebrate sequence entries, part 250.
3710. gbvrt251.seq - Other vertebrate sequence entries, part 251.
3711. gbvrt252.seq - Other vertebrate sequence entries, part 252.
3712. gbvrt253.seq - Other vertebrate sequence entries, part 253.
3713. gbvrt254.seq - Other vertebrate sequence entries, part 254.
3714. gbvrt255.seq - Other vertebrate sequence entries, part 255.
3715. gbvrt256.seq - Other vertebrate sequence entries, part 256.
3716. gbvrt257.seq - Other vertebrate sequence entries, part 257.
3717. gbvrt258.seq - Other vertebrate sequence entries, part 258.
3718. gbvrt259.seq - Other vertebrate sequence entries, part 259.
3719. gbvrt26.seq - Other vertebrate sequence entries, part 26.
3720. gbvrt260.seq - Other vertebrate sequence entries, part 260.
3721. gbvrt261.seq - Other vertebrate sequence entries, part 261.
3722. gbvrt262.seq - Other vertebrate sequence entries, part 262.
3723. gbvrt263.seq - Other vertebrate sequence entries, part 263.
3724. gbvrt264.seq - Other vertebrate sequence entries, part 264.
3725. gbvrt265.seq - Other vertebrate sequence entries, part 265.
3726. gbvrt266.seq - Other vertebrate sequence entries, part 266.
3727. gbvrt27.seq - Other vertebrate sequence entries, part 27.
3728. gbvrt28.seq - Other vertebrate sequence entries, part 28.
3729. gbvrt29.seq - Other vertebrate sequence entries, part 29.
3730. gbvrt3.seq - Other vertebrate sequence entries, part 3.
3731. gbvrt30.seq - Other vertebrate sequence entries, part 30.
3732. gbvrt31.seq - Other vertebrate sequence entries, part 31.
3733. gbvrt32.seq - Other vertebrate sequence entries, part 32.
3734. gbvrt33.seq - Other vertebrate sequence entries, part 33.
3735. gbvrt34.seq - Other vertebrate sequence entries, part 34.
3736. gbvrt35.seq - Other vertebrate sequence entries, part 35.
3737. gbvrt36.seq - Other vertebrate sequence entries, part 36.
3738. gbvrt37.seq - Other vertebrate sequence entries, part 37.
3739. gbvrt38.seq - Other vertebrate sequence entries, part 38.
3740. gbvrt39.seq - Other vertebrate sequence entries, part 39.
3741. gbvrt4.seq - Other vertebrate sequence entries, part 4.
3742. gbvrt40.seq - Other vertebrate sequence entries, part 40.
3743. gbvrt41.seq - Other vertebrate sequence entries, part 41.
3744. gbvrt42.seq - Other vertebrate sequence entries, part 42.
3745. gbvrt43.seq - Other vertebrate sequence entries, part 43.
3746. gbvrt44.seq - Other vertebrate sequence entries, part 44.
3747. gbvrt45.seq - Other vertebrate sequence entries, part 45.
3748. gbvrt46.seq - Other vertebrate sequence entries, part 46.
3749. gbvrt47.seq - Other vertebrate sequence entries, part 47.
3750. gbvrt48.seq - Other vertebrate sequence entries, part 48.
3751. gbvrt49.seq - Other vertebrate sequence entries, part 49.
3752. gbvrt5.seq - Other vertebrate sequence entries, part 5.
3753. gbvrt50.seq - Other vertebrate sequence entries, part 50.
3754. gbvrt51.seq - Other vertebrate sequence entries, part 51.
3755. gbvrt52.seq - Other vertebrate sequence entries, part 52.
3756. gbvrt53.seq - Other vertebrate sequence entries, part 53.
3757. gbvrt54.seq - Other vertebrate sequence entries, part 54.
3758. gbvrt55.seq - Other vertebrate sequence entries, part 55.
3759. gbvrt56.seq - Other vertebrate sequence entries, part 56.
3760. gbvrt57.seq - Other vertebrate sequence entries, part 57.
3761. gbvrt58.seq - Other vertebrate sequence entries, part 58.
3762. gbvrt59.seq - Other vertebrate sequence entries, part 59.
3763. gbvrt6.seq - Other vertebrate sequence entries, part 6.
3764. gbvrt60.seq - Other vertebrate sequence entries, part 60.
3765. gbvrt61.seq - Other vertebrate sequence entries, part 61.
3766. gbvrt62.seq - Other vertebrate sequence entries, part 62.
3767. gbvrt63.seq - Other vertebrate sequence entries, part 63.
3768. gbvrt64.seq - Other vertebrate sequence entries, part 64.
3769. gbvrt65.seq - Other vertebrate sequence entries, part 65.
3770. gbvrt66.seq - Other vertebrate sequence entries, part 66.
3771. gbvrt67.seq - Other vertebrate sequence entries, part 67.
3772. gbvrt68.seq - Other vertebrate sequence entries, part 68.
3773. gbvrt69.seq - Other vertebrate sequence entries, part 69.
3774. gbvrt7.seq - Other vertebrate sequence entries, part 7.
3775. gbvrt70.seq - Other vertebrate sequence entries, part 70.
3776. gbvrt71.seq - Other vertebrate sequence entries, part 71.
3777. gbvrt72.seq - Other vertebrate sequence entries, part 72.
3778. gbvrt73.seq - Other vertebrate sequence entries, part 73.
3779. gbvrt74.seq - Other vertebrate sequence entries, part 74.
3780. gbvrt75.seq - Other vertebrate sequence entries, part 75.
3781. gbvrt76.seq - Other vertebrate sequence entries, part 76.
3782. gbvrt77.seq - Other vertebrate sequence entries, part 77.
3783. gbvrt78.seq - Other vertebrate sequence entries, part 78.
3784. gbvrt79.seq - Other vertebrate sequence entries, part 79.
3785. gbvrt8.seq - Other vertebrate sequence entries, part 8.
3786. gbvrt80.seq - Other vertebrate sequence entries, part 80.
3787. gbvrt81.seq - Other vertebrate sequence entries, part 81.
3788. gbvrt82.seq - Other vertebrate sequence entries, part 82.
3789. gbvrt83.seq - Other vertebrate sequence entries, part 83.
3790. gbvrt84.seq - Other vertebrate sequence entries, part 84.
3791. gbvrt85.seq - Other vertebrate sequence entries, part 85.
3792. gbvrt86.seq - Other vertebrate sequence entries, part 86.
3793. gbvrt87.seq - Other vertebrate sequence entries, part 87.
3794. gbvrt88.seq - Other vertebrate sequence entries, part 88.
3795. gbvrt89.seq - Other vertebrate sequence entries, part 89.
3796. gbvrt9.seq - Other vertebrate sequence entries, part 9.
3797. gbvrt90.seq - Other vertebrate sequence entries, part 90.
3798. gbvrt91.seq - Other vertebrate sequence entries, part 91.
3799. gbvrt92.seq - Other vertebrate sequence entries, part 92.
3800. gbvrt93.seq - Other vertebrate sequence entries, part 93.
3801. gbvrt94.seq - Other vertebrate sequence entries, part 94.
3802. gbvrt95.seq - Other vertebrate sequence entries, part 95.
3803. gbvrt96.seq - Other vertebrate sequence entries, part 96.
3804. gbvrt97.seq - Other vertebrate sequence entries, part 97.
3805. gbvrt98.seq - Other vertebrate sequence entries, part 98.
3806. gbvrt99.seq - Other vertebrate sequence entries, part 99.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 244.0 flatfiles require roughly 1780 GB, including the sequence files and the *.txt files.
The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
499951177 gbbct1.seq
496612880 gbbct10.seq
499932117 gbbct100.seq
389028332 gbbct101.seq
499874269 gbbct102.seq
498124362 gbbct103.seq
499292542 gbbct104.seq
491408177 gbbct105.seq
13752576 gbbct106.seq
493588642 gbbct107.seq
494745607 gbbct108.seq
495416641 gbbct109.seq
498136838 gbbct11.seq
491069732 gbbct110.seq
195549944 gbbct111.seq
494137174 gbbct112.seq
492528836 gbbct113.seq
493221919 gbbct114.seq
496768523 gbbct115.seq
99480363 gbbct116.seq
499009910 gbbct117.seq
494100520 gbbct118.seq
498830091 gbbct119.seq
498755983 gbbct12.seq
333298370 gbbct120.seq
499521931 gbbct121.seq
493010987 gbbct122.seq
496289589 gbbct123.seq
426871650 gbbct124.seq
491476188 gbbct125.seq
489083418 gbbct126.seq
487156063 gbbct127.seq
499722007 gbbct128.seq
497888474 gbbct129.seq
27848735 gbbct13.seq
487897338 gbbct130.seq
407731532 gbbct131.seq
498287339 gbbct132.seq
489448084 gbbct133.seq
499734618 gbbct134.seq
461301891 gbbct135.seq
495776392 gbbct136.seq
493829169 gbbct137.seq
491660857 gbbct138.seq
498684855 gbbct139.seq
499887487 gbbct14.seq
499805976 gbbct140.seq
147979239 gbbct141.seq
496896672 gbbct142.seq
497180557 gbbct143.seq
497090051 gbbct144.seq
488029244 gbbct145.seq
387663736 gbbct146.seq
489367441 gbbct147.seq
490446699 gbbct148.seq
498396046 gbbct149.seq
496454342 gbbct15.seq
497203756 gbbct150.seq
492635318 gbbct151.seq
341075950 gbbct152.seq
497655174 gbbct153.seq
494967432 gbbct154.seq
496738714 gbbct155.seq
489042935 gbbct156.seq
493287044 gbbct157.seq
496050890 gbbct158.seq
159717876 gbbct159.seq
496649064 gbbct16.seq
494730826 gbbct160.seq
491513943 gbbct161.seq
495159906 gbbct162.seq
475148282 gbbct163.seq
497456269 gbbct164.seq
493190155 gbbct165.seq
492198857 gbbct166.seq
490869904 gbbct167.seq
493968225 gbbct168.seq
489220293 gbbct169.seq
492261514 gbbct17.seq
497866283 gbbct170.seq
493958927 gbbct171.seq
185980561 gbbct172.seq
493674345 gbbct173.seq
491172767 gbbct174.seq
499374985 gbbct175.seq
273475546 gbbct176.seq
495005879 gbbct177.seq
495931225 gbbct178.seq
489789852 gbbct179.seq
10689912 gbbct18.seq
303707273 gbbct180.seq
499225441 gbbct181.seq
489058600 gbbct182.seq
495426614 gbbct183.seq
496021612 gbbct184.seq
67162117 gbbct185.seq
498035975 gbbct186.seq
497779142 gbbct187.seq
496082295 gbbct188.seq
496491370 gbbct189.seq
498897840 gbbct19.seq
498721269 gbbct190.seq
180648161 gbbct191.seq
497821026 gbbct192.seq
496360837 gbbct193.seq
494749422 gbbct194.seq
499580311 gbbct195.seq
264353262 gbbct196.seq
493932263 gbbct197.seq
495652740 gbbct198.seq
491948418 gbbct199.seq
496416260 gbbct2.seq
494173809 gbbct20.seq
492734062 gbbct200.seq
234727325 gbbct201.seq
499816748 gbbct202.seq
497425688 gbbct203.seq
499107541 gbbct204.seq
493006130 gbbct205.seq
412751586 gbbct206.seq
499900154 gbbct207.seq
496011463 gbbct208.seq
481292634 gbbct209.seq
499428738 gbbct21.seq
496168491 gbbct210.seq
495262198 gbbct211.seq
499946264 gbbct212.seq
318928575 gbbct213.seq
497109270 gbbct214.seq
493797184 gbbct215.seq
496714661 gbbct216.seq
378276688 gbbct217.seq
484833309 gbbct218.seq
495646128 gbbct219.seq
494261825 gbbct22.seq
499614873 gbbct220.seq
493022866 gbbct221.seq
228371517 gbbct222.seq
493986133 gbbct223.seq
489510100 gbbct224.seq
488961102 gbbct225.seq
166183440 gbbct226.seq
493892217 gbbct227.seq
487708683 gbbct228.seq
498455424 gbbct229.seq
65823481 gbbct23.seq
493394927 gbbct230.seq
120149680 gbbct231.seq
494063240 gbbct232.seq
488279901 gbbct233.seq
489824761 gbbct234.seq
489986041 gbbct235.seq
145652118 gbbct236.seq
495740612 gbbct237.seq
496790515 gbbct238.seq
489570461 gbbct239.seq
496047877 gbbct24.seq
446055765 gbbct240.seq
492193715 gbbct241.seq
487559480 gbbct242.seq
492443664 gbbct243.seq
457216254 gbbct244.seq
499715547 gbbct245.seq
495907353 gbbct246.seq
494166515 gbbct247.seq
494502476 gbbct248.seq
494779438 gbbct249.seq
493917482 gbbct25.seq
100302076 gbbct250.seq
491982962 gbbct251.seq
488305783 gbbct252.seq
484960307 gbbct253.seq
448261370 gbbct254.seq
496469952 gbbct255.seq
495798176 gbbct256.seq
499577408 gbbct257.seq
448624123 gbbct258.seq
496060833 gbbct259.seq
480860867 gbbct26.seq
499419637 gbbct260.seq
488827003 gbbct261.seq
496557018 gbbct262.seq
496528648 gbbct263.seq
497206068 gbbct264.seq
157062352 gbbct265.seq
491162801 gbbct266.seq
488408782 gbbct267.seq
498295718 gbbct268.seq
494252329 gbbct269.seq
498705973 gbbct27.seq
497548507 gbbct270.seq
497516571 gbbct271.seq
496630965 gbbct272.seq
377296971 gbbct273.seq
498861913 gbbct274.seq
494223261 gbbct275.seq
499608996 gbbct276.seq
473212537 gbbct277.seq
492090777 gbbct278.seq
498417520 gbbct279.seq
184589932 gbbct28.seq
498412079 gbbct280.seq
481644517 gbbct281.seq
496724996 gbbct282.seq
494175760 gbbct283.seq
499839707 gbbct284.seq
499792752 gbbct285.seq
493579240 gbbct286.seq
493866578 gbbct287.seq
202456000 gbbct288.seq
492626784 gbbct289.seq
497340219 gbbct29.seq
498721787 gbbct290.seq
496314451 gbbct291.seq
495823806 gbbct292.seq
358381782 gbbct293.seq
498732005 gbbct294.seq
495863990 gbbct295.seq
496227215 gbbct296.seq
496935580 gbbct297.seq
387482137 gbbct298.seq
494855595 gbbct299.seq
301426029 gbbct3.seq
497861348 gbbct30.seq
494740700 gbbct300.seq
499982679 gbbct301.seq
489769072 gbbct302.seq
413162579 gbbct303.seq
498783928 gbbct304.seq
492287586 gbbct305.seq
498541496 gbbct306.seq
496011534 gbbct307.seq
374916064 gbbct308.seq
491215065 gbbct309.seq
499974659 gbbct31.seq
497116126 gbbct310.seq
497052272 gbbct311.seq
494542362 gbbct312.seq
433978198 gbbct313.seq
499098483 gbbct314.seq
499112942 gbbct315.seq
496707509 gbbct316.seq
498319653 gbbct317.seq
204286560 gbbct318.seq
495594076 gbbct319.seq
491436827 gbbct32.seq
498469779 gbbct320.seq
497131168 gbbct321.seq
486190936 gbbct322.seq
402771140 gbbct323.seq
490874656 gbbct324.seq
499740524 gbbct325.seq
495156853 gbbct326.seq
491630362 gbbct327.seq
499426674 gbbct328.seq
499662486 gbbct329.seq
497176946 gbbct33.seq
499945409 gbbct330.seq
166620301 gbbct331.seq
488779573 gbbct332.seq
496209993 gbbct333.seq
492687566 gbbct334.seq
495895607 gbbct335.seq
492154954 gbbct336.seq
495701022 gbbct337.seq
192011388 gbbct338.seq
493830532 gbbct339.seq
446793858 gbbct34.seq
499619805 gbbct340.seq
488970225 gbbct341.seq
498666555 gbbct342.seq
305623148 gbbct343.seq
497565017 gbbct344.seq
499825713 gbbct345.seq
486385007 gbbct346.seq
493137884 gbbct347.seq
492262993 gbbct348.seq
499502515 gbbct349.seq
21415508 gbbct35.seq
481028154 gbbct350.seq
488617809 gbbct351.seq
488289413 gbbct352.seq
497016130 gbbct353.seq
495367389 gbbct354.seq
496591064 gbbct355.seq
496020279 gbbct356.seq
499426865 gbbct357.seq
405332294 gbbct358.seq
492034094 gbbct359.seq
38658675 gbbct36.seq
496395987 gbbct360.seq
492762524 gbbct361.seq
498390419 gbbct362.seq
493564444 gbbct363.seq
491470339 gbbct364.seq
78679756 gbbct365.seq
497084333 gbbct366.seq
496693501 gbbct367.seq
498025607 gbbct368.seq
494000922 gbbct369.seq
499474553 gbbct37.seq
492102525 gbbct370.seq
496483157 gbbct371.seq
183710056 gbbct372.seq
493995951 gbbct373.seq
498185478 gbbct374.seq
495871654 gbbct375.seq
499987841 gbbct376.seq
497634677 gbbct377.seq
166226684 gbbct378.seq
495692277 gbbct379.seq
498626133 gbbct38.seq
496978037 gbbct380.seq
498211210 gbbct381.seq
498823852 gbbct382.seq
492174659 gbbct383.seq
335328850 gbbct384.seq
496813488 gbbct385.seq
496528514 gbbct386.seq
487996853 gbbct387.seq
497522429 gbbct388.seq
493728620 gbbct389.seq
493047386 gbbct39.seq
488506405 gbbct390.seq
189545340 gbbct391.seq
495151633 gbbct392.seq
496864586 gbbct393.seq
497576758 gbbct394.seq
496959065 gbbct395.seq
62479842 gbbct396.seq
494370376 gbbct397.seq
498000782 gbbct398.seq
497686488 gbbct399.seq
394562767 gbbct4.seq
498804318 gbbct40.seq
494908712 gbbct400.seq
197843087 gbbct401.seq
497735363 gbbct402.seq
484493037 gbbct403.seq
498310697 gbbct404.seq
499378541 gbbct405.seq
163956920 gbbct406.seq
497090544 gbbct407.seq
493324370 gbbct408.seq
480917096 gbbct409.seq
140148090 gbbct41.seq
496616166 gbbct410.seq
114260257 gbbct411.seq
499863806 gbbct412.seq
493319153 gbbct413.seq
495788140 gbbct414.seq
497766976 gbbct415.seq
11509909 gbbct416.seq
494159441 gbbct417.seq
498759724 gbbct418.seq
498971423 gbbct419.seq
495707193 gbbct42.seq
487259151 gbbct420.seq
493426836 gbbct421.seq
489827055 gbbct422.seq
494413631 gbbct423.seq
493435065 gbbct424.seq
496974354 gbbct425.seq
169899697 gbbct426.seq
496499347 gbbct427.seq
497253582 gbbct428.seq
490426322 gbbct429.seq
495625759 gbbct43.seq
492330467 gbbct430.seq
395703215 gbbct431.seq
490073380 gbbct432.seq
495810096 gbbct433.seq
496581062 gbbct434.seq
496740437 gbbct435.seq
492761993 gbbct436.seq
490075835 gbbct437.seq
494893466 gbbct438.seq
494078251 gbbct439.seq
493145848 gbbct44.seq
497059308 gbbct440.seq
497396363 gbbct441.seq
495243357 gbbct442.seq
488504124 gbbct443.seq
104823772 gbbct444.seq
488323919 gbbct445.seq
497533445 gbbct446.seq
493548787 gbbct447.seq
499403246 gbbct448.seq
490775893 gbbct449.seq
488225291 gbbct45.seq
457647469 gbbct450.seq
494298014 gbbct451.seq
493347926 gbbct452.seq
495710628 gbbct453.seq
488826899 gbbct454.seq
90247486 gbbct455.seq
496590330 gbbct456.seq
497640525 gbbct457.seq
495928879 gbbct458.seq
494119345 gbbct459.seq
498591687 gbbct46.seq
497764568 gbbct460.seq
473687074 gbbct461.seq
479452057 gbbct462.seq
499305599 gbbct463.seq
499150289 gbbct464.seq
493161760 gbbct465.seq
494064748 gbbct466.seq
289440354 gbbct467.seq
493444106 gbbct468.seq
499037477 gbbct469.seq
498295820 gbbct47.seq
496213359 gbbct470.seq
498609539 gbbct471.seq
492505737 gbbct472.seq
189379808 gbbct473.seq
499685939 gbbct474.seq
487164058 gbbct475.seq
495032205 gbbct476.seq
494012133 gbbct477.seq
498360048 gbbct478.seq
493778975 gbbct479.seq
102630875 gbbct48.seq
36365470 gbbct480.seq
497264108 gbbct481.seq
496049812 gbbct482.seq
498612182 gbbct483.seq
493909149 gbbct484.seq
490677615 gbbct485.seq
126779199 gbbct486.seq
492118943 gbbct487.seq
492547439 gbbct488.seq
489646727 gbbct489.seq
498942406 gbbct49.seq
490772941 gbbct490.seq
494019679 gbbct491.seq
13327257 gbbct492.seq
497798561 gbbct493.seq
488396385 gbbct494.seq
496805453 gbbct495.seq
495127151 gbbct496.seq
155502998 gbbct497.seq
493707957 gbbct498.seq
499449523 gbbct499.seq
459622256 gbbct5.seq
483799848 gbbct50.seq
499607172 gbbct500.seq
493690736 gbbct501.seq
497911034 gbbct502.seq
149374173 gbbct503.seq
489343072 gbbct504.seq
499707012 gbbct505.seq
484992079 gbbct506.seq
491775955 gbbct507.seq
231227491 gbbct508.seq
495818350 gbbct509.seq
492232338 gbbct51.seq
494009730 gbbct510.seq
492317456 gbbct511.seq
497436360 gbbct512.seq
344063633 gbbct513.seq
497180145 gbbct514.seq
498982361 gbbct515.seq
493731627 gbbct516.seq
487186327 gbbct517.seq
349934983 gbbct518.seq
490256030 gbbct519.seq
498772234 gbbct52.seq
496357121 gbbct520.seq
498100306 gbbct521.seq
498923325 gbbct522.seq
396279109 gbbct523.seq
498401994 gbbct524.seq
495507769 gbbct525.seq
490363992 gbbct526.seq
495539656 gbbct527.seq
119024681 gbbct528.seq
496590256 gbbct529.seq
495960841 gbbct53.seq
498306248 gbbct530.seq
498490515 gbbct531.seq
484309651 gbbct532.seq
497758778 gbbct533.seq
489601837 gbbct534.seq
492065624 gbbct535.seq
490798869 gbbct536.seq
241155021 gbbct537.seq
490270521 gbbct538.seq
497556079 gbbct539.seq
487879897 gbbct54.seq
492047061 gbbct540.seq
494587513 gbbct541.seq
495205470 gbbct542.seq
493384646 gbbct543.seq
142739579 gbbct544.seq
305795019 gbbct545.seq
6889029 gbbct546.seq
14161861 gbbct547.seq
22785163 gbbct548.seq
44476995 gbbct549.seq
497649666 gbbct55.seq
86594208 gbbct550.seq
168508151 gbbct551.seq
499999126 gbbct552.seq
492534078 gbbct553.seq
499473891 gbbct554.seq
499962572 gbbct555.seq
498192984 gbbct556.seq
499994622 gbbct557.seq
130856653 gbbct558.seq
493333872 gbbct559.seq
491270036 gbbct56.seq
499337649 gbbct560.seq
493560504 gbbct561.seq
499999885 gbbct562.seq
109269415 gbbct563.seq
499998204 gbbct564.seq
290165760 gbbct565.seq
499998413 gbbct566.seq
85215275 gbbct567.seq
499998556 gbbct568.seq
124672762 gbbct569.seq
495404595 gbbct57.seq
499999370 gbbct570.seq
44659153 gbbct571.seq
146463170 gbbct572.seq
499582221 gbbct573.seq
491702865 gbbct574.seq
497107957 gbbct575.seq
489922672 gbbct576.seq
493049113 gbbct577.seq
497932954 gbbct578.seq
497254246 gbbct579.seq
497178412 gbbct58.seq
488463861 gbbct580.seq
305471094 gbbct581.seq
495496535 gbbct582.seq
498011043 gbbct583.seq
498173063 gbbct584.seq
168612663 gbbct585.seq
483003721 gbbct586.seq
495301322 gbbct587.seq
498721001 gbbct588.seq
497091996 gbbct589.seq
499945856 gbbct59.seq
77185132 gbbct590.seq
488256642 gbbct591.seq
495886198 gbbct592.seq
495751489 gbbct593.seq
330365855 gbbct594.seq
498499361 gbbct595.seq
497461802 gbbct596.seq
492958949 gbbct597.seq
325905521 gbbct598.seq
496306969 gbbct599.seq
102228351 gbbct6.seq
493025470 gbbct60.seq
497541958 gbbct600.seq
499034611 gbbct601.seq
243470066 gbbct602.seq
492624258 gbbct603.seq
496920887 gbbct604.seq
498725996 gbbct605.seq
498558432 gbbct606.seq
105681453 gbbct607.seq
496392303 gbbct608.seq
489823032 gbbct609.seq
218993383 gbbct61.seq
498850167 gbbct610.seq
457158429 gbbct611.seq
51222835 gbbct612.seq
107796330 gbbct613.seq
499998837 gbbct614.seq
499999162 gbbct615.seq
500000239 gbbct616.seq
499997576 gbbct617.seq
301769128 gbbct618.seq
498096179 gbbct62.seq
499071293 gbbct63.seq
496563592 gbbct64.seq
497566483 gbbct65.seq
499752421 gbbct66.seq
490382246 gbbct67.seq
257412822 gbbct68.seq
499969272 gbbct69.seq
282434293 gbbct7.seq
495193551 gbbct70.seq
486287178 gbbct71.seq
493006751 gbbct72.seq
475857508 gbbct73.seq
490138039 gbbct74.seq
485838353 gbbct75.seq
497985735 gbbct76.seq
498936847 gbbct77.seq
306897163 gbbct78.seq
491474038 gbbct79.seq
493056825 gbbct8.seq
494313903 gbbct80.seq
495819854 gbbct81.seq
498720135 gbbct82.seq
499103527 gbbct83.seq
261686723 gbbct84.seq
498131081 gbbct85.seq
499517772 gbbct86.seq
498962621 gbbct87.seq
488107727 gbbct88.seq
397950576 gbbct89.seq
493341555 gbbct9.seq
498261521 gbbct90.seq
492774286 gbbct91.seq
495523568 gbbct92.seq
300972590 gbbct93.seq
499885352 gbbct94.seq
495464442 gbbct95.seq
496856418 gbbct96.seq
74937857 gbbct97.seq
489628375 gbbct98.seq
499323615 gbbct99.seq
675387 gbchg.txt
499762870 gbcon1.seq
499629282 gbcon10.seq
499996593 gbcon100.seq
169080108 gbcon101.seq
499998086 gbcon102.seq
497560979 gbcon103.seq
499976409 gbcon104.seq
499892017 gbcon105.seq
300991461 gbcon106.seq
499996806 gbcon107.seq
499998885 gbcon108.seq
302126711 gbcon109.seq
497683545 gbcon11.seq
500000131 gbcon110.seq
499928283 gbcon111.seq
129931088 gbcon112.seq
499880060 gbcon113.seq
499996508 gbcon114.seq
499932521 gbcon115.seq
294158681 gbcon116.seq
499999876 gbcon117.seq
499999395 gbcon118.seq
222253215 gbcon119.seq
495319635 gbcon12.seq
45836617 gbcon120.seq
499942540 gbcon121.seq
499998578 gbcon122.seq
447237286 gbcon123.seq
499998894 gbcon124.seq
499998242 gbcon125.seq
499997115 gbcon126.seq
196800490 gbcon127.seq
499995599 gbcon128.seq
499998307 gbcon129.seq
498021242 gbcon13.seq
238753423 gbcon130.seq
499999643 gbcon131.seq
466847856 gbcon132.seq
499998236 gbcon133.seq
499998904 gbcon134.seq
268208226 gbcon135.seq
499998549 gbcon136.seq
499997703 gbcon137.seq
498203427 gbcon138.seq
499998287 gbcon139.seq
498607979 gbcon14.seq
500000230 gbcon140.seq
179146823 gbcon141.seq
499998502 gbcon142.seq
499999166 gbcon143.seq
22645865 gbcon144.seq
499889958 gbcon145.seq
499998779 gbcon146.seq
410626525 gbcon147.seq
499942654 gbcon148.seq
499908953 gbcon149.seq
496119602 gbcon15.seq
376962145 gbcon150.seq
499993470 gbcon151.seq
499946598 gbcon152.seq
264402168 gbcon153.seq
499999294 gbcon154.seq
499998024 gbcon155.seq
81972538 gbcon156.seq
499995459 gbcon157.seq
499964680 gbcon158.seq
499998699 gbcon159.seq
498098102 gbcon16.seq
140579838 gbcon160.seq
499830763 gbcon161.seq
499983832 gbcon162.seq
499968068 gbcon163.seq
336330029 gbcon164.seq
499999604 gbcon165.seq
499979048 gbcon166.seq
398551763 gbcon167.seq
499999531 gbcon168.seq
499999929 gbcon169.seq
494163711 gbcon17.seq
499997512 gbcon170.seq
271462479 gbcon171.seq
499999711 gbcon172.seq
499999650 gbcon173.seq
499386083 gbcon174.seq
499999570 gbcon175.seq
162078209 gbcon176.seq
500000098 gbcon177.seq
499997549 gbcon178.seq
137298577 gbcon179.seq
488812522 gbcon18.seq
499990878 gbcon180.seq
499997802 gbcon181.seq
499998661 gbcon182.seq
302177094 gbcon183.seq
499943322 gbcon184.seq
499999930 gbcon185.seq
454511749 gbcon186.seq
499998236 gbcon187.seq
499984254 gbcon188.seq
397731713 gbcon189.seq
499997687 gbcon19.seq
499934774 gbcon190.seq
499998615 gbcon191.seq
499997153 gbcon192.seq
156222236 gbcon193.seq
499998392 gbcon194.seq
499998372 gbcon195.seq
37871910 gbcon196.seq
499997011 gbcon197.seq
499999996 gbcon198.seq
499998161 gbcon199.seq
499999210 gbcon2.seq
499999250 gbcon20.seq
500000201 gbcon200.seq
499951703 gbcon201.seq
266851340 gbcon202.seq
499999224 gbcon203.seq
459576141 gbcon204.seq
499974997 gbcon205.seq
499998536 gbcon206.seq
480280543 gbcon207.seq
500000137 gbcon208.seq
499996880 gbcon209.seq
499998925 gbcon21.seq
499997199 gbcon210.seq
16855954 gbcon211.seq
499996328 gbcon212.seq
499971821 gbcon213.seq
499997531 gbcon214.seq
273368980 gbcon215.seq
499875089 gbcon216.seq
499922453 gbcon217.seq
499993552 gbcon218.seq
499949185 gbcon219.seq
81416614 gbcon22.seq
499998769 gbcon220.seq
378201330 gbcon221.seq
499998430 gbcon23.seq
499999681 gbcon24.seq
499414025 gbcon25.seq
286265985 gbcon26.seq
499486419 gbcon27.seq
125749326 gbcon28.seq
126436397 gbcon29.seq
499999976 gbcon3.seq
499924738 gbcon30.seq
499992465 gbcon31.seq
26152220 gbcon32.seq
499999414 gbcon33.seq
499998297 gbcon34.seq
443986309 gbcon35.seq
499999057 gbcon36.seq
499998568 gbcon37.seq
499999100 gbcon38.seq
41918782 gbcon39.seq
106301568 gbcon4.seq
500000081 gbcon40.seq
499998540 gbcon41.seq
277009775 gbcon42.seq
499996336 gbcon43.seq
499998469 gbcon44.seq
270612827 gbcon45.seq
499996532 gbcon46.seq
499996905 gbcon47.seq
385374935 gbcon48.seq
499997390 gbcon49.seq
499940282 gbcon5.seq
499999185 gbcon50.seq
176580283 gbcon51.seq
499999848 gbcon52.seq
499997718 gbcon53.seq
238773972 gbcon54.seq
499997628 gbcon55.seq
499995125 gbcon56.seq
335698760 gbcon57.seq
499996299 gbcon58.seq
499999132 gbcon59.seq
494453997 gbcon6.seq
298461041 gbcon60.seq
499995314 gbcon61.seq
499999014 gbcon62.seq
259899669 gbcon63.seq
499996880 gbcon64.seq
499997062 gbcon65.seq
187377116 gbcon66.seq
499996720 gbcon67.seq
499999826 gbcon68.seq
364586197 gbcon69.seq
494750151 gbcon7.seq
499993696 gbcon70.seq
499999904 gbcon71.seq
386119955 gbcon72.seq
499993762 gbcon73.seq
472811181 gbcon74.seq
174082386 gbcon75.seq
499939051 gbcon76.seq
23944933 gbcon77.seq
499987096 gbcon78.seq
203666963 gbcon79.seq
499683285 gbcon8.seq
199581356 gbcon80.seq
499473776 gbcon81.seq
499986264 gbcon82.seq
337640522 gbcon83.seq
499532057 gbcon84.seq
495874659 gbcon85.seq
499843567 gbcon86.seq
337572983 gbcon87.seq
499973687 gbcon88.seq
499999806 gbcon89.seq
65557835 gbcon9.seq
499924918 gbcon90.seq
167922692 gbcon91.seq
500000152 gbcon92.seq
499999534 gbcon93.seq
132733476 gbcon94.seq
499986934 gbcon95.seq
499999129 gbcon96.seq
499997430 gbcon97.seq
266007757 gbcon98.seq
499999925 gbcon99.seq
15660 gbdel.txt
500000195 gbenv1.seq
53787107 gbenv10.seq
499999374 gbenv11.seq
500000022 gbenv12.seq
499999628 gbenv13.seq
500000139 gbenv14.seq
3305328 gbenv15.seq
500000161 gbenv16.seq
499998621 gbenv17.seq
173623395 gbenv18.seq
499959717 gbenv19.seq
499999182 gbenv2.seq
499999109 gbenv20.seq
499998306 gbenv21.seq
82148566 gbenv22.seq
499998851 gbenv23.seq
499997379 gbenv24.seq
177809609 gbenv25.seq
499999328 gbenv26.seq
499997828 gbenv27.seq
499999049 gbenv28.seq
46351791 gbenv29.seq
345011122 gbenv3.seq
499999526 gbenv30.seq
499998927 gbenv31.seq
192725551 gbenv32.seq
499996411 gbenv33.seq
500000083 gbenv34.seq
334817116 gbenv35.seq
500000208 gbenv36.seq
499999826 gbenv37.seq
469309779 gbenv38.seq
499999763 gbenv39.seq
499576496 gbenv4.seq
499998886 gbenv40.seq
337872467 gbenv41.seq
499999814 gbenv42.seq
499998558 gbenv43.seq
394359917 gbenv44.seq
499998093 gbenv45.seq
499999177 gbenv46.seq
345182229 gbenv47.seq
499998817 gbenv48.seq
499998405 gbenv49.seq
497833339 gbenv5.seq
237930979 gbenv50.seq
499999862 gbenv51.seq
499997889 gbenv52.seq
390583495 gbenv53.seq
499998824 gbenv54.seq
499987903 gbenv55.seq
499999191 gbenv56.seq
70806545 gbenv57.seq
499971975 gbenv58.seq
499999567 gbenv59.seq
499997968 gbenv6.seq
500000095 gbenv60.seq
131301358 gbenv61.seq
499999394 gbenv62.seq
499998271 gbenv63.seq
499963152 gbenv64.seq
487059227 gbenv65.seq
473862979 gbenv7.seq
499999099 gbenv8.seq
499999887 gbenv9.seq
499998581 gbest1.seq
499999733 gbest10.seq
499999220 gbest100.seq
500000099 gbest101.seq
499997479 gbest102.seq
499998343 gbest103.seq
26182198 gbest104.seq
499996643 gbest105.seq
499999938 gbest106.seq
499997872 gbest107.seq
499998727 gbest108.seq
9363761 gbest109.seq
499998473 gbest11.seq
500000077 gbest110.seq
499997483 gbest111.seq
499998955 gbest112.seq
499998225 gbest113.seq
19921978 gbest114.seq
500000014 gbest115.seq
499998435 gbest116.seq
499999531 gbest117.seq
9147880 gbest118.seq
499998004 gbest119.seq
474272653 gbest12.seq
499998752 gbest120.seq
499997835 gbest121.seq
69022439 gbest122.seq
499996892 gbest123.seq
499998214 gbest124.seq
223712939 gbest125.seq
499997461 gbest126.seq
499998633 gbest127.seq
195307357 gbest128.seq
499997173 gbest129.seq
499999189 gbest13.seq
499998792 gbest130.seq
499995025 gbest131.seq
499996839 gbest132.seq
85321549 gbest133.seq
499999011 gbest134.seq
499996610 gbest135.seq
500000110 gbest136.seq
499999122 gbest137.seq
98779968 gbest138.seq
500000018 gbest139.seq
249784262 gbest14.seq
499999232 gbest140.seq
499998394 gbest141.seq
499998221 gbest142.seq
24988211 gbest143.seq
499996807 gbest144.seq
499996789 gbest145.seq
499998576 gbest146.seq
499998795 gbest147.seq
30469535 gbest148.seq
499998561 gbest149.seq
500000131 gbest15.seq
499999358 gbest150.seq
499998219 gbest151.seq
322722212 gbest152.seq
499996387 gbest153.seq
499998779 gbest154.seq
499995778 gbest155.seq
499998742 gbest156.seq
22334741 gbest157.seq
500000171 gbest158.seq
499999919 gbest159.seq
499998336 gbest16.seq
499996596 gbest160.seq
499998368 gbest161.seq
10327640 gbest162.seq
499999757 gbest163.seq
499997629 gbest164.seq
499999067 gbest165.seq
499996901 gbest166.seq
83685503 gbest167.seq
500000180 gbest168.seq
499996624 gbest169.seq
420938933 gbest17.seq
499997982 gbest170.seq
499996832 gbest171.seq
120388331 gbest172.seq
499998796 gbest173.seq
499996875 gbest174.seq
499998096 gbest175.seq
500000066 gbest176.seq
66109540 gbest177.seq
499999609 gbest178.seq
403619645 gbest179.seq
499999173 gbest18.seq
500000063 gbest180.seq
499999705 gbest181.seq
499997986 gbest182.seq
499999873 gbest183.seq
42448093 gbest184.seq
499999170 gbest185.seq
499998375 gbest186.seq
499998599 gbest187.seq
499997969 gbest188.seq
41300119 gbest189.seq
499996805 gbest19.seq
499998332 gbest190.seq
499997812 gbest191.seq
499998689 gbest192.seq
500000232 gbest193.seq
10891288 gbest194.seq
499999221 gbest195.seq
499998819 gbest196.seq
500000021 gbest197.seq
499998814 gbest198.seq
27086967 gbest199.seq
499998769 gbest2.seq
262051360 gbest20.seq
499998833 gbest200.seq
499997633 gbest201.seq
499998589 gbest202.seq
499999311 gbest203.seq
32042635 gbest204.seq
13610371 gbest205.seq
500000009 gbest206.seq
499999777 gbest207.seq
328407486 gbest208.seq
499998412 gbest209.seq
500000121 gbest21.seq
499996653 gbest210.seq
317123453 gbest211.seq
499997880 gbest212.seq
499998827 gbest213.seq
265786933 gbest214.seq
499996413 gbest215.seq
500000158 gbest216.seq
269693487 gbest217.seq
499997149 gbest218.seq
499999560 gbest219.seq
499998661 gbest22.seq
499999631 gbest220.seq
500000163 gbest221.seq
49197565 gbest222.seq
499999284 gbest223.seq
499999484 gbest224.seq
499998195 gbest225.seq
500000115 gbest226.seq
46767660 gbest227.seq
499999291 gbest228.seq
499998484 gbest229.seq
243557231 gbest23.seq
175247860 gbest230.seq
499998729 gbest231.seq
499999681 gbest232.seq
499999475 gbest233.seq
478347570 gbest234.seq
499997785 gbest235.seq
499999603 gbest236.seq
499997429 gbest237.seq
462328784 gbest238.seq
499999067 gbest239.seq
499999963 gbest24.seq
499999466 gbest240.seq
499999877 gbest241.seq
494650973 gbest242.seq
499998531 gbest243.seq
499998185 gbest244.seq
499997969 gbest245.seq
499998635 gbest246.seq
24311445 gbest247.seq
499998408 gbest248.seq
499998480 gbest249.seq
499996714 gbest25.seq
497223296 gbest250.seq
499999018 gbest251.seq
499998363 gbest252.seq
499999589 gbest253.seq
499995954 gbest254.seq
21377068 gbest255.seq
499998685 gbest256.seq
499999456 gbest257.seq
499992679 gbest258.seq
499999776 gbest259.seq
499999785 gbest26.seq
75121353 gbest260.seq
499999841 gbest261.seq
499999232 gbest262.seq
499998456 gbest263.seq
499999062 gbest264.seq
14352516 gbest265.seq
499996812 gbest266.seq
500000012 gbest267.seq
499995965 gbest268.seq
500000130 gbest269.seq
499998083 gbest27.seq
53596469 gbest270.seq
499999104 gbest271.seq
499998969 gbest272.seq
499998846 gbest273.seq
119014253 gbest274.seq
499996151 gbest275.seq
499997199 gbest276.seq
499999053 gbest277.seq
499998565 gbest278.seq
53630504 gbest279.seq
48817270 gbest28.seq
499999317 gbest280.seq
499997549 gbest281.seq
499997631 gbest282.seq
499998870 gbest283.seq
56086801 gbest284.seq
499999854 gbest285.seq
499999427 gbest286.seq
499998420 gbest287.seq
499999297 gbest288.seq
11817252 gbest289.seq
499999934 gbest29.seq
499997241 gbest290.seq
499998774 gbest291.seq
499999597 gbest292.seq
499998527 gbest293.seq
25245147 gbest294.seq
499999944 gbest295.seq
499996255 gbest296.seq
485857148 gbest297.seq
499996746 gbest298.seq
499998061 gbest299.seq
499998416 gbest3.seq
500000238 gbest30.seq
499999666 gbest300.seq
499998500 gbest301.seq
5577915 gbest302.seq
499998622 gbest303.seq
499999578 gbest304.seq
499997985 gbest305.seq
499998280 gbest306.seq
8353862 gbest307.seq
499999018 gbest308.seq
500000027 gbest309.seq
499998758 gbest31.seq
499998037 gbest310.seq
421694602 gbest311.seq
500000066 gbest312.seq
499998272 gbest313.seq
499999108 gbest314.seq
496147533 gbest315.seq
499997885 gbest316.seq
499997415 gbest317.seq
468073576 gbest318.seq
499999035 gbest319.seq
486152246 gbest32.seq
499999387 gbest320.seq
500000238 gbest321.seq
499998922 gbest322.seq
39560997 gbest323.seq
500000256 gbest324.seq
499998824 gbest325.seq
499998042 gbest326.seq
493136865 gbest327.seq
499998749 gbest328.seq
499997759 gbest329.seq
499997679 gbest33.seq
499999540 gbest330.seq
499997029 gbest331.seq
55168282 gbest332.seq
499999943 gbest333.seq
499999960 gbest334.seq
499998379 gbest335.seq
469196415 gbest336.seq
499998299 gbest337.seq
499999395 gbest338.seq
500000050 gbest339.seq
499999122 gbest34.seq
500000223 gbest340.seq
18186152 gbest341.seq
499998023 gbest342.seq
491618868 gbest343.seq
499998746 gbest344.seq
499999937 gbest345.seq
499999493 gbest346.seq
499999913 gbest347.seq
5664451 gbest348.seq
499996833 gbest349.seq
499998204 gbest35.seq
499998440 gbest350.seq
499998762 gbest351.seq
445260919 gbest352.seq
499998629 gbest353.seq
500000207 gbest354.seq
499999612 gbest355.seq
387623893 gbest356.seq
499999012 gbest357.seq
499996946 gbest358.seq
499998298 gbest359.seq
464993332 gbest36.seq
499998840 gbest360.seq
21213467 gbest361.seq
499997139 gbest362.seq
500000037 gbest363.seq
499998204 gbest364.seq
499998663 gbest365.seq
56149185 gbest366.seq
166258344 gbest367.seq
499997707 gbest368.seq
499998882 gbest369.seq
499999414 gbest37.seq
499998160 gbest370.seq
499999199 gbest371.seq
86045134 gbest372.seq
499997252 gbest373.seq
499998118 gbest374.seq
499999892 gbest375.seq
499998855 gbest376.seq
166666388 gbest377.seq
499996810 gbest378.seq
499996558 gbest379.seq
499997253 gbest38.seq
499998375 gbest380.seq
500000151 gbest381.seq
151580674 gbest382.seq
499997221 gbest383.seq
499999329 gbest384.seq
499997189 gbest385.seq
497175622 gbest386.seq
499997498 gbest387.seq
499998709 gbest388.seq
499998596 gbest389.seq
499996751 gbest39.seq
64052070 gbest390.seq
499998385 gbest391.seq
499999008 gbest392.seq
499996496 gbest393.seq
499997691 gbest394.seq
83414510 gbest395.seq
499996944 gbest396.seq
499997015 gbest397.seq
499998040 gbest398.seq
499999190 gbest399.seq
434664907 gbest4.seq
499996416 gbest40.seq
85820972 gbest400.seq
499999952 gbest401.seq
499998092 gbest402.seq
499999582 gbest403.seq
499998501 gbest404.seq
49032427 gbest405.seq
499998825 gbest406.seq
500000004 gbest407.seq
499999158 gbest408.seq
499997814 gbest409.seq
191408304 gbest41.seq
88068152 gbest410.seq
499999741 gbest411.seq
499998374 gbest412.seq
499993677 gbest413.seq
499993201 gbest414.seq
124851254 gbest415.seq
499999918 gbest416.seq
327382356 gbest417.seq
499998194 gbest418.seq
499997992 gbest419.seq
499997364 gbest42.seq
499999615 gbest420.seq
499998742 gbest421.seq
53760245 gbest422.seq
499999330 gbest423.seq
499999774 gbest424.seq
499998374 gbest425.seq
410322262 gbest426.seq
499997260 gbest427.seq
499999283 gbest428.seq
335979604 gbest429.seq
499997237 gbest43.seq
499999961 gbest430.seq
499999304 gbest431.seq
262197966 gbest432.seq
499999061 gbest433.seq
499998847 gbest434.seq
458912468 gbest435.seq
499997775 gbest436.seq
499995081 gbest437.seq
307806619 gbest438.seq
499996212 gbest439.seq
499997245 gbest44.seq
499998800 gbest440.seq
333974609 gbest441.seq
499999460 gbest442.seq
499997354 gbest443.seq
187029956 gbest444.seq
500000126 gbest445.seq
499999505 gbest446.seq
119005290 gbest447.seq
499998841 gbest448.seq
499999145 gbest449.seq
499996431 gbest45.seq
142065868 gbest450.seq
499999879 gbest451.seq
499998318 gbest452.seq
146708639 gbest453.seq
500000202 gbest454.seq
499999189 gbest455.seq
499998072 gbest456.seq
486290213 gbest457.seq
499999523 gbest458.seq
499997276 gbest459.seq
189558363 gbest46.seq
500000217 gbest460.seq
500000093 gbest461.seq
20448393 gbest462.seq
170019681 gbest463.seq
499998234 gbest464.seq
499997948 gbest465.seq
499996964 gbest466.seq
499998273 gbest467.seq
23774165 gbest468.seq
499999458 gbest469.seq
499999058 gbest47.seq
499999208 gbest470.seq
499999217 gbest471.seq
499998573 gbest472.seq
59936590 gbest473.seq
499999631 gbest474.seq
499998519 gbest475.seq
499997128 gbest476.seq
499997420 gbest477.seq
58001517 gbest478.seq
499998110 gbest479.seq
499997398 gbest48.seq
499998435 gbest480.seq
499997613 gbest481.seq
499997252 gbest482.seq
37726327 gbest483.seq
499997371 gbest484.seq
499999307 gbest485.seq
499999821 gbest486.seq
499999786 gbest487.seq
73826772 gbest488.seq
499997662 gbest489.seq
499998871 gbest49.seq
499999130 gbest490.seq
500000163 gbest491.seq
206731273 gbest492.seq
499996334 gbest493.seq
499997901 gbest494.seq
499998899 gbest495.seq
499999214 gbest496.seq
89546328 gbest497.seq
499998125 gbest498.seq
499997888 gbest499.seq
499998500 gbest5.seq
475083605 gbest50.seq
499999252 gbest500.seq
499998905 gbest501.seq
53856249 gbest502.seq
499994065 gbest503.seq
499997608 gbest504.seq
499995938 gbest505.seq
499999200 gbest506.seq
143190346 gbest507.seq
500000066 gbest508.seq
499996463 gbest509.seq
499997701 gbest51.seq
499996495 gbest510.seq
499999935 gbest511.seq
140397485 gbest512.seq
499997833 gbest513.seq
499996770 gbest514.seq
499999160 gbest515.seq
499999361 gbest516.seq
17223581 gbest517.seq
174254470 gbest518.seq
499997829 gbest519.seq
355950520 gbest52.seq
500000018 gbest520.seq
83958051 gbest521.seq
499997944 gbest522.seq
499998345 gbest523.seq
75364218 gbest524.seq
499999451 gbest525.seq
499999095 gbest526.seq
499997240 gbest527.seq
500000018 gbest528.seq
99290674 gbest529.seq
499998564 gbest53.seq
499999697 gbest530.seq
499998036 gbest531.seq
499998181 gbest532.seq
499997524 gbest533.seq
9341136 gbest534.seq
499999430 gbest535.seq
499999910 gbest536.seq
499998159 gbest537.seq
477178951 gbest538.seq
499998765 gbest539.seq
499999062 gbest54.seq
499998373 gbest540.seq
499998370 gbest541.seq
413051455 gbest542.seq
499998900 gbest543.seq
499999161 gbest544.seq
499999901 gbest545.seq
500000090 gbest546.seq
82655201 gbest547.seq
499998013 gbest548.seq
500000188 gbest549.seq
499997809 gbest55.seq
499998067 gbest550.seq
499999132 gbest551.seq
33919554 gbest552.seq
499998664 gbest553.seq
499997885 gbest554.seq
499997388 gbest555.seq
499999535 gbest556.seq
44487956 gbest557.seq
499996142 gbest558.seq
499999065 gbest559.seq
483409497 gbest56.seq
499997398 gbest560.seq
499999667 gbest561.seq
9675043 gbest562.seq
499998309 gbest563.seq
499999967 gbest564.seq
392784153 gbest565.seq
500000181 gbest566.seq
499999869 gbest567.seq
99109982 gbest568.seq
499998740 gbest569.seq
499999963 gbest57.seq
499998382 gbest570.seq
50523126 gbest571.seq
499999830 gbest572.seq
499999346 gbest573.seq
499999384 gbest574.seq
255770732 gbest575.seq
499999250 gbest58.seq
499998894 gbest59.seq
499999229 gbest6.seq
464091191 gbest60.seq
499999088 gbest61.seq
499999098 gbest62.seq
499999769 gbest63.seq
499999090 gbest64.seq
6844852 gbest65.seq
499998831 gbest66.seq
499998783 gbest67.seq
499998482 gbest68.seq
483712503 gbest69.seq
499999606 gbest7.seq
499998717 gbest70.seq
499998674 gbest71.seq
499999921 gbest72.seq
499999569 gbest73.seq
8367902 gbest74.seq
123216343 gbest75.seq
499998883 gbest76.seq
499999229 gbest77.seq
500000011 gbest78.seq
499998569 gbest79.seq
469350324 gbest8.seq
5383905 gbest80.seq
499998041 gbest81.seq
499996972 gbest82.seq
499996950 gbest83.seq
499995253 gbest84.seq
46010588 gbest85.seq
499998457 gbest86.seq
500000099 gbest87.seq
499997463 gbest88.seq
499999606 gbest89.seq
499998998 gbest9.seq
53088986 gbest90.seq
500000263 gbest91.seq
499997907 gbest92.seq
499996978 gbest93.seq
472029655 gbest94.seq
500000196 gbest95.seq
499998714 gbest96.seq
499998281 gbest97.seq
498677804 gbest98.seq
35234983 gbest99.seq
499998103 gbgss1.seq
55614458 gbgss10.seq
499999207 gbgss100.seq
500000257 gbgss101.seq
500000134 gbgss102.seq
468268660 gbgss103.seq
499997065 gbgss104.seq
499999692 gbgss105.seq
499997757 gbgss106.seq
499998352 gbgss107.seq
40402012 gbgss108.seq
499999314 gbgss109.seq
499997403 gbgss11.seq
499999661 gbgss110.seq
499997830 gbgss111.seq
316916941 gbgss112.seq
499998412 gbgss113.seq
499997321 gbgss114.seq
499999598 gbgss115.seq
499998006 gbgss116.seq
104211862 gbgss117.seq
499998179 gbgss118.seq
499999331 gbgss119.seq
499999261 gbgss12.seq
499997853 gbgss120.seq
499999736 gbgss121.seq
6537142 gbgss122.seq
499998633 gbgss123.seq
499999968 gbgss124.seq
499998799 gbgss125.seq
449734063 gbgss126.seq
499998381 gbgss127.seq
499999211 gbgss128.seq
499997711 gbgss129.seq
499999723 gbgss13.seq
499998622 gbgss130.seq
29785783 gbgss131.seq
499997877 gbgss132.seq
209679641 gbgss133.seq
500000110 gbgss134.seq
499999602 gbgss135.seq
499997969 gbgss136.seq
500000125 gbgss137.seq
14831686 gbgss138.seq
499996726 gbgss139.seq
498704470 gbgss14.seq
499997951 gbgss140.seq
499999528 gbgss141.seq
499997001 gbgss142.seq
16786266 gbgss143.seq
499997786 gbgss144.seq
499996974 gbgss145.seq
499999546 gbgss146.seq
499996547 gbgss147.seq
2045398 gbgss148.seq
499997382 gbgss149.seq
499997425 gbgss15.seq
499998165 gbgss150.seq
499998480 gbgss151.seq
499997367 gbgss152.seq
6835799 gbgss153.seq
373479550 gbgss154.seq
499998497 gbgss155.seq
499999520 gbgss156.seq
499998987 gbgss157.seq
452015031 gbgss158.seq
499999674 gbgss159.seq
499997738 gbgss16.seq
499998566 gbgss160.seq
499998516 gbgss161.seq
454413234 gbgss162.seq
499997998 gbgss163.seq
499999955 gbgss164.seq
499997965 gbgss165.seq
456856217 gbgss166.seq
499997805 gbgss167.seq
499999559 gbgss168.seq
499999924 gbgss169.seq
499999295 gbgss17.seq
362956480 gbgss170.seq
499999614 gbgss171.seq
499999108 gbgss172.seq
215505908 gbgss173.seq
499998415 gbgss174.seq
499998134 gbgss175.seq
67002892 gbgss176.seq
499999079 gbgss177.seq
499999336 gbgss178.seq
499998518 gbgss179.seq
480471778 gbgss18.seq
499999975 gbgss180.seq
49671428 gbgss181.seq
500000175 gbgss182.seq
499999211 gbgss183.seq
500000209 gbgss184.seq
499999501 gbgss185.seq
39656212 gbgss186.seq
499999015 gbgss187.seq
499999023 gbgss188.seq
23241200 gbgss189.seq
499998975 gbgss19.seq
499998791 gbgss190.seq
499996639 gbgss191.seq
499998774 gbgss192.seq
495024971 gbgss193.seq
499999000 gbgss194.seq
499999717 gbgss195.seq
499999860 gbgss196.seq
499999901 gbgss197.seq
53998378 gbgss198.seq
499998820 gbgss199.seq
499999269 gbgss2.seq
325856321 gbgss20.seq
499999274 gbgss200.seq
499999819 gbgss201.seq
479851147 gbgss202.seq
499997737 gbgss203.seq
499997752 gbgss204.seq
56421213 gbgss205.seq
499997703 gbgss206.seq
500000150 gbgss207.seq
499999163 gbgss208.seq
481466169 gbgss209.seq
499999364 gbgss21.seq
499996771 gbgss210.seq
499999404 gbgss211.seq
499997241 gbgss212.seq
488372551 gbgss213.seq
499999175 gbgss214.seq
499999239 gbgss215.seq
499999176 gbgss216.seq
467990953 gbgss217.seq
499999749 gbgss218.seq
499999749 gbgss219.seq
499997480 gbgss22.seq
499997938 gbgss220.seq
6989681 gbgss221.seq
499999723 gbgss222.seq
499999684 gbgss223.seq
499998774 gbgss224.seq
264582471 gbgss225.seq
499998308 gbgss226.seq
499997919 gbgss227.seq
499999547 gbgss228.seq
429737750 gbgss229.seq
499997001 gbgss23.seq
499998680 gbgss230.seq
499997412 gbgss231.seq
499999464 gbgss232.seq
468539336 gbgss233.seq
499999119 gbgss234.seq
500000083 gbgss235.seq
499999330 gbgss236.seq
418145094 gbgss237.seq
499998654 gbgss238.seq
499999983 gbgss239.seq
499999217 gbgss24.seq
499998793 gbgss240.seq
499998625 gbgss241.seq
16537478 gbgss242.seq
315572447 gbgss243.seq
499997744 gbgss244.seq
499999895 gbgss245.seq
499998432 gbgss246.seq
467293763 gbgss247.seq
499998755 gbgss248.seq
499999780 gbgss249.seq
47915040 gbgss25.seq
499999818 gbgss250.seq
499997858 gbgss251.seq
36102519 gbgss252.seq
499998608 gbgss253.seq
499997686 gbgss254.seq
499998198 gbgss255.seq
499999134 gbgss256.seq
19020583 gbgss257.seq
499998709 gbgss258.seq
499997285 gbgss259.seq
499998203 gbgss26.seq
499998938 gbgss260.seq
1409124 gbgss261.seq
500000180 gbgss262.seq
499999092 gbgss263.seq
499998857 gbgss264.seq
480468608 gbgss265.seq
499999638 gbgss266.seq
499998584 gbgss267.seq
472104844 gbgss268.seq
499999289 gbgss27.seq
499996970 gbgss28.seq
499998293 gbgss29.seq
499999955 gbgss3.seq
28371252 gbgss30.seq
499999620 gbgss31.seq
499999369 gbgss32.seq
499997779 gbgss33.seq
474354474 gbgss34.seq
499997672 gbgss35.seq
499999711 gbgss36.seq
499998458 gbgss37.seq
499998787 gbgss38.seq
10244239 gbgss39.seq
499997976 gbgss4.seq
499998123 gbgss40.seq
500000104 gbgss41.seq
168816398 gbgss42.seq
499998707 gbgss43.seq
499999529 gbgss44.seq
500000062 gbgss45.seq
487188150 gbgss46.seq
500000097 gbgss47.seq
500000175 gbgss48.seq
499999771 gbgss49.seq
37756294 gbgss5.seq
444022212 gbgss50.seq
499998446 gbgss51.seq
500000163 gbgss52.seq
499998853 gbgss53.seq
420972611 gbgss54.seq
499998235 gbgss55.seq
500000088 gbgss56.seq
500000162 gbgss57.seq
427769194 gbgss58.seq
67685650 gbgss59.seq
499999011 gbgss6.seq
500000215 gbgss60.seq
499997984 gbgss61.seq
500000021 gbgss62.seq
492676767 gbgss63.seq
499999178 gbgss64.seq
499998668 gbgss65.seq
500000003 gbgss66.seq
495011791 gbgss67.seq
499998492 gbgss68.seq
499999132 gbgss69.seq
499998063 gbgss7.seq
499999264 gbgss70.seq
419358340 gbgss71.seq
499999747 gbgss72.seq
499998402 gbgss73.seq
499998080 gbgss74.seq
33896316 gbgss75.seq
499997046 gbgss76.seq
499999706 gbgss77.seq
499999836 gbgss78.seq
490829495 gbgss79.seq
499999507 gbgss8.seq
499997550 gbgss80.seq
499998791 gbgss81.seq
499998121 gbgss82.seq
499997910 gbgss83.seq
6352079 gbgss84.seq
499999761 gbgss85.seq
499996907 gbgss86.seq
499999311 gbgss87.seq
499997750 gbgss88.seq
28277451 gbgss89.seq
499997757 gbgss9.seq
499998289 gbgss90.seq
500000231 gbgss91.seq
499998914 gbgss92.seq
463167513 gbgss93.seq
244248654 gbgss94.seq
499999492 gbgss95.seq
499998457 gbgss96.seq
500000176 gbgss97.seq
499997669 gbgss98.seq
45242083 gbgss99.seq
499991077 gbhtc1.seq
499994049 gbhtc2.seq
499986002 gbhtc3.seq
330777725 gbhtc4.seq
499997968 gbhtc5.seq
438151816 gbhtc6.seq
499999221 gbhtc7.seq
202969568 gbhtc8.seq
499944811 gbhtg1.seq
499980257 gbhtg10.seq
485099546 gbhtg11.seq
499977093 gbhtg12.seq
499847932 gbhtg13.seq
499963690 gbhtg14.seq
499701367 gbhtg15.seq
474637756 gbhtg16.seq
499709351 gbhtg17.seq
499810399 gbhtg18.seq
499965464 gbhtg19.seq
499847283 gbhtg2.seq
499990521 gbhtg20.seq
473197906 gbhtg21.seq
499917665 gbhtg22.seq
499967590 gbhtg23.seq
499096861 gbhtg24.seq
499960118 gbhtg25.seq
484456062 gbhtg26.seq
499961905 gbhtg27.seq
499870392 gbhtg28.seq
268060905 gbhtg29.seq
499869170 gbhtg3.seq
499926220 gbhtg30.seq
499809717 gbhtg31.seq
224936220 gbhtg32.seq
499949653 gbhtg33.seq
499926474 gbhtg34.seq
265477168 gbhtg35.seq
499867371 gbhtg36.seq
499973632 gbhtg37.seq
223152909 gbhtg38.seq
499807323 gbhtg39.seq
499846457 gbhtg4.seq
499973486 gbhtg40.seq
234952784 gbhtg41.seq
499825428 gbhtg42.seq
499886028 gbhtg43.seq
202125596 gbhtg44.seq
499794710 gbhtg45.seq
499925955 gbhtg46.seq
205797151 gbhtg47.seq
499976374 gbhtg48.seq
499930130 gbhtg49.seq
499934498 gbhtg5.seq
193865027 gbhtg50.seq
499926863 gbhtg51.seq
499937126 gbhtg52.seq
161358165 gbhtg53.seq
499996939 gbhtg54.seq
499996869 gbhtg55.seq
252726190 gbhtg56.seq
499940545 gbhtg57.seq
499966721 gbhtg58.seq
499998091 gbhtg59.seq
507366 gbhtg6.seq
167066142 gbhtg60.seq
499929757 gbhtg61.seq
499926029 gbhtg62.seq
499877376 gbhtg63.seq
468570824 gbhtg64.seq
499882387 gbhtg65.seq
499975194 gbhtg66.seq
499952380 gbhtg67.seq
499930799 gbhtg68.seq
499787258 gbhtg69.seq
499821242 gbhtg7.seq
417841927 gbhtg70.seq
499651339 gbhtg71.seq
499807557 gbhtg72.seq
385409482 gbhtg73.seq
499951671 gbhtg74.seq
499970875 gbhtg75.seq
383567862 gbhtg76.seq
499964642 gbhtg77.seq
499988333 gbhtg78.seq
499994565 gbhtg79.seq
499933798 gbhtg8.seq
499991192 gbhtg80.seq
499928589 gbhtg81.seq
273544563 gbhtg82.seq
499899409 gbhtg9.seq
499859735 gbinv1.seq
490451253 gbinv10.seq
499997911 gbinv100.seq
499998998 gbinv101.seq
403992764 gbinv102.seq
499999549 gbinv103.seq
499999010 gbinv104.seq
177736123 gbinv105.seq
499998403 gbinv106.seq
499997304 gbinv107.seq
117715589 gbinv108.seq
499997640 gbinv109.seq
491062219 gbinv11.seq
499998337 gbinv110.seq
148245765 gbinv111.seq
499999406 gbinv112.seq
499997023 gbinv113.seq
156872142 gbinv114.seq
499999876 gbinv115.seq
500000065 gbinv116.seq
193678172 gbinv117.seq
500000063 gbinv118.seq
499998877 gbinv119.seq
469835270 gbinv12.seq
247089138 gbinv120.seq
500000116 gbinv121.seq
499998689 gbinv122.seq
499998127 gbinv123.seq
495770920 gbinv124.seq
499998875 gbinv125.seq
445991559 gbinv126.seq
288065217 gbinv127.seq
54947887 gbinv128.seq
52917687 gbinv129.seq
485518597 gbinv13.seq
156817630 gbinv130.seq
499990822 gbinv131.seq
266436256 gbinv132.seq
499998557 gbinv133.seq
499997694 gbinv134.seq
172341792 gbinv135.seq
499362318 gbinv136.seq
498177153 gbinv137.seq
499656507 gbinv138.seq
128976204 gbinv139.seq
174155802 gbinv14.seq
496439268 gbinv140.seq
51960557 gbinv141.seq
466467344 gbinv142.seq
479577598 gbinv143.seq
450391165 gbinv144.seq
482003105 gbinv145.seq
121049467 gbinv146.seq
494590358 gbinv147.seq
499152824 gbinv148.seq
498616205 gbinv149.seq
486730694 gbinv15.seq
70591482 gbinv150.seq
872662073 gbinv151.seq
815663159 gbinv152.seq
813528097 gbinv153.seq
780491774 gbinv154.seq
734904723 gbinv155.seq
816941878 gbinv156.seq
452809204 gbinv157.seq
480839037 gbinv158.seq
375796220 gbinv159.seq
498986369 gbinv16.seq
499932212 gbinv160.seq
485386314 gbinv161.seq
485283938 gbinv162.seq
498294953 gbinv163.seq
414580638 gbinv164.seq
498679440 gbinv165.seq
494998502 gbinv166.seq
486081098 gbinv167.seq
483986740 gbinv168.seq
479014607 gbinv169.seq
433578405 gbinv17.seq
377175188 gbinv170.seq
491311809 gbinv171.seq
482991950 gbinv172.seq
495169229 gbinv173.seq
493741890 gbinv174.seq
495500028 gbinv175.seq
371035005 gbinv176.seq
470288952 gbinv177.seq
496245676 gbinv178.seq
496281402 gbinv179.seq
319196831 gbinv18.seq
472368883 gbinv180.seq
493439367 gbinv181.seq
418565417 gbinv182.seq
493150902 gbinv183.seq
491114236 gbinv184.seq
465654555 gbinv185.seq
490888106 gbinv186.seq
459577508 gbinv187.seq
406075632 gbinv188.seq
476897550 gbinv189.seq
305989097 gbinv19.seq
481841162 gbinv190.seq
496741571 gbinv191.seq
492742184 gbinv192.seq
496271174 gbinv193.seq
392139815 gbinv194.seq
496951694 gbinv195.seq
492317100 gbinv196.seq
475955596 gbinv197.seq
498243704 gbinv198.seq
496662010 gbinv199.seq
455878756 gbinv2.seq
499447601 gbinv20.seq
351267284 gbinv200.seq
454436392 gbinv201.seq
490104712 gbinv202.seq
477768949 gbinv203.seq
497117087 gbinv204.seq
273421111 gbinv205.seq
484546259 gbinv206.seq
486200140 gbinv207.seq
489013669 gbinv208.seq
499882158 gbinv209.seq
331575178 gbinv21.seq
389958867 gbinv210.seq
230763287 gbinv211.seq
433765668 gbinv212.seq
341801067 gbinv213.seq
488708469 gbinv214.seq
442221874 gbinv215.seq
499270336 gbinv216.seq
498804227 gbinv217.seq
192259264 gbinv218.seq
500000135 gbinv219.seq
409329256 gbinv22.seq
499998911 gbinv220.seq
264620669 gbinv221.seq
499997350 gbinv222.seq
499998206 gbinv223.seq
200081758 gbinv224.seq
499999369 gbinv225.seq
499997824 gbinv226.seq
499998269 gbinv227.seq
499999773 gbinv228.seq
435549642 gbinv229.seq
337324220 gbinv23.seq
499985955 gbinv230.seq
499933714 gbinv231.seq
499959526 gbinv232.seq
499999288 gbinv233.seq
499969114 gbinv234.seq
292405292 gbinv235.seq
499999746 gbinv236.seq
499862404 gbinv237.seq
499942773 gbinv238.seq
261894712 gbinv239.seq
416902989 gbinv24.seq
499489044 gbinv240.seq
499984461 gbinv241.seq
499999178 gbinv242.seq
219010924 gbinv243.seq
499665286 gbinv244.seq
499954794 gbinv245.seq
499986274 gbinv246.seq
349517342 gbinv247.seq
500000137 gbinv248.seq
499979428 gbinv249.seq
480340526 gbinv25.seq
499915813 gbinv250.seq
499990759 gbinv251.seq
499998437 gbinv252.seq
7826534 gbinv253.seq
499999636 gbinv254.seq
499704487 gbinv255.seq
499897338 gbinv256.seq
499999895 gbinv257.seq
68002970 gbinv258.seq
499929858 gbinv259.seq
470719972 gbinv26.seq
499904157 gbinv260.seq
499970007 gbinv261.seq
499999529 gbinv262.seq
499940074 gbinv263.seq
122380920 gbinv264.seq
500000224 gbinv265.seq
499999552 gbinv266.seq
468683478 gbinv267.seq
499670167 gbinv268.seq
499934229 gbinv269.seq
478012779 gbinv27.seq
499999149 gbinv270.seq
498226051 gbinv271.seq
135154452 gbinv272.seq
481046566 gbinv273.seq
450037909 gbinv274.seq
303709221 gbinv275.seq
293452060 gbinv276.seq
280090041 gbinv277.seq
279807726 gbinv278.seq
274554532 gbinv279.seq
372274412 gbinv28.seq
266890122 gbinv280.seq
491295946 gbinv281.seq
418047779 gbinv282.seq
383074444 gbinv283.seq
489267373 gbinv284.seq
393039367 gbinv285.seq
484538369 gbinv286.seq
482310364 gbinv287.seq
491415359 gbinv288.seq
494998202 gbinv289.seq
473605830 gbinv29.seq
482289018 gbinv290.seq
495670320 gbinv291.seq
40846857 gbinv292.seq
492571202 gbinv293.seq
490206006 gbinv294.seq
445709424 gbinv295.seq
207302902 gbinv296.seq
370283947 gbinv297.seq
414867956 gbinv298.seq
499970000 gbinv299.seq
499999381 gbinv3.seq
499998353 gbinv30.seq
52949032 gbinv300.seq
436437029 gbinv31.seq
499995350 gbinv32.seq
405380703 gbinv33.seq
497333628 gbinv34.seq
491591120 gbinv35.seq
468886272 gbinv36.seq
480484367 gbinv37.seq
96954549 gbinv38.seq
495716316 gbinv39.seq
499583125 gbinv4.seq
459725126 gbinv40.seq
481987024 gbinv41.seq
494130818 gbinv42.seq
170883604 gbinv43.seq
473738127 gbinv44.seq
489724528 gbinv45.seq
481851091 gbinv46.seq
480570465 gbinv47.seq
175801402 gbinv48.seq
495890984 gbinv49.seq
185087563 gbinv5.seq
496714825 gbinv50.seq
484081852 gbinv51.seq
472135201 gbinv52.seq
487970520 gbinv53.seq
473212643 gbinv54.seq
119585423 gbinv55.seq
483414567 gbinv56.seq
490353662 gbinv57.seq
487639364 gbinv58.seq
482729413 gbinv59.seq
496736369 gbinv6.seq
500000064 gbinv60.seq
420306631 gbinv61.seq
492550351 gbinv62.seq
489797146 gbinv63.seq
492958460 gbinv64.seq
490500378 gbinv65.seq
433610653 gbinv66.seq
495477837 gbinv67.seq
496723738 gbinv68.seq
492757167 gbinv69.seq
476450800 gbinv7.seq
483897094 gbinv70.seq
478248908 gbinv71.seq
492778641 gbinv72.seq
499970626 gbinv73.seq
498315478 gbinv74.seq
483551082 gbinv75.seq
444438685 gbinv76.seq
483768717 gbinv77.seq
493574813 gbinv78.seq
498159916 gbinv79.seq
422530821 gbinv8.seq
461241054 gbinv80.seq
429126368 gbinv81.seq
472248120 gbinv82.seq
487381580 gbinv83.seq
488615859 gbinv84.seq
492386441 gbinv85.seq
410012641 gbinv86.seq
489753781 gbinv87.seq
486903937 gbinv88.seq
475269344 gbinv89.seq
173964300 gbinv9.seq
499301158 gbinv90.seq
356776193 gbinv91.seq
461767421 gbinv92.seq
479421334 gbinv93.seq
494639844 gbinv94.seq
328489972 gbinv95.seq
484117250 gbinv96.seq
499999505 gbinv97.seq
499999172 gbinv98.seq
114808267 gbinv99.seq
499997743 gbmam1.seq
82813116 gbmam10.seq
71296598 gbmam11.seq
22570876 gbmam12.seq
1268606 gbmam13.seq
378312073 gbmam14.seq
338653931 gbmam15.seq
477859990 gbmam16.seq
445458574 gbmam17.seq
122412955 gbmam18.seq
451114203 gbmam19.seq
399238033 gbmam2.seq
418062948 gbmam20.seq
499818197 gbmam21.seq
462376363 gbmam22.seq
370510653 gbmam23.seq
446296425 gbmam24.seq
431104447 gbmam25.seq
480602957 gbmam26.seq
479109873 gbmam27.seq
483903297 gbmam28.seq
483307008 gbmam29.seq
400559326 gbmam3.seq
48405032 gbmam30.seq
363174382 gbmam31.seq
437246747 gbmam32.seq
470828962 gbmam33.seq
402408906 gbmam34.seq
304109928 gbmam35.seq
452443739 gbmam36.seq
451303958 gbmam37.seq
495648598 gbmam38.seq
405636626 gbmam39.seq
477148353 gbmam4.seq
410457734 gbmam40.seq
441553748 gbmam41.seq
367146984 gbmam42.seq
478421809 gbmam43.seq
316388332 gbmam44.seq
352226884 gbmam45.seq
195247700 gbmam46.seq
474022452 gbmam47.seq
378020853 gbmam48.seq
450136561 gbmam49.seq
374653134 gbmam5.seq
450750944 gbmam50.seq
468132660 gbmam51.seq
374896622 gbmam52.seq
9943517 gbmam53.seq
43989127 gbmam54.seq
91322474 gbmam55.seq
88811460 gbmam56.seq
6364730 gbmam57.seq
20917981 gbmam58.seq
449541843 gbmam59.seq
487713568 gbmam6.seq
423138199 gbmam60.seq
453840584 gbmam61.seq
491149506 gbmam62.seq
425479852 gbmam63.seq
461110029 gbmam64.seq
385606603 gbmam65.seq
489901313 gbmam66.seq
499999496 gbmam67.seq
499998155 gbmam68.seq
15279709 gbmam69.seq
401181424 gbmam7.seq
907465328 gbmam70.seq
839494897 gbmam71.seq
774395849 gbmam72.seq
588873740 gbmam73.seq
364960392 gbmam74.seq
428298067 gbmam75.seq
283039896 gbmam76.seq
266822121 gbmam77.seq
255007049 gbmam78.seq
250435254 gbmam79.seq
435129139 gbmam8.seq
405637142 gbmam80.seq
372091504 gbmam81.seq
465555603 gbmam82.seq
444923782 gbmam83.seq
341578443 gbmam84.seq
257946240 gbmam85.seq
485829704 gbmam86.seq
486026993 gbmam87.seq
483298905 gbmam88.seq
499999827 gbmam89.seq
275778936 gbmam9.seq
499873693 gbmam90.seq
246788369 gbmam91.seq
12683784 gbnew.txt
499999543 gbpat1.seq
499999978 gbpat10.seq
499999036 gbpat100.seq
499999497 gbpat101.seq
499997525 gbpat102.seq
228719622 gbpat103.seq
500000251 gbpat104.seq
500000174 gbpat105.seq
499999692 gbpat106.seq
335264518 gbpat107.seq
499999623 gbpat108.seq
499999494 gbpat109.seq
500000253 gbpat11.seq
208433612 gbpat110.seq
499897030 gbpat111.seq
499996523 gbpat112.seq
174096269 gbpat113.seq
499998633 gbpat114.seq
499998698 gbpat115.seq
499997279 gbpat116.seq
8662512 gbpat117.seq
499711856 gbpat118.seq
382784746 gbpat119.seq
179174676 gbpat12.seq
499997656 gbpat120.seq
499993004 gbpat121.seq
499992686 gbpat122.seq
499999296 gbpat123.seq
56308815 gbpat124.seq
499968107 gbpat125.seq
499998919 gbpat126.seq
208432510 gbpat127.seq
500000057 gbpat128.seq
499998589 gbpat129.seq
499888954 gbpat13.seq
57395697 gbpat130.seq
499998318 gbpat131.seq
499999875 gbpat132.seq
487399623 gbpat133.seq
499995092 gbpat134.seq
499999513 gbpat135.seq
26292453 gbpat136.seq
499991072 gbpat137.seq
385133606 gbpat138.seq
499999347 gbpat139.seq
499999480 gbpat14.seq
500000185 gbpat140.seq
148486141 gbpat141.seq
499995846 gbpat142.seq
314466624 gbpat143.seq
499988381 gbpat144.seq
499980283 gbpat145.seq
409538104 gbpat146.seq
500000154 gbpat147.seq
499999446 gbpat148.seq
125948196 gbpat149.seq
62646503 gbpat15.seq
499989559 gbpat150.seq
499996036 gbpat151.seq
499998857 gbpat152.seq
499997730 gbpat153.seq
169829429 gbpat154.seq
499999534 gbpat155.seq
425319484 gbpat156.seq
499999799 gbpat157.seq
500000072 gbpat158.seq
499883750 gbpat159.seq
499998552 gbpat16.seq
353518705 gbpat160.seq
499992701 gbpat161.seq
499999246 gbpat162.seq
289626204 gbpat163.seq
499999075 gbpat164.seq
499999530 gbpat165.seq
499998928 gbpat166.seq
101539058 gbpat167.seq
499994714 gbpat168.seq
499997500 gbpat169.seq
499997940 gbpat17.seq
499998487 gbpat170.seq
499998725 gbpat171.seq
301680889 gbpat172.seq
500000036 gbpat173.seq
499997984 gbpat174.seq
499999259 gbpat175.seq
318436829 gbpat176.seq
499602139 gbpat177.seq
500000131 gbpat178.seq
499999721 gbpat179.seq
421911288 gbpat18.seq
13195145 gbpat180.seq
497266528 gbpat181.seq
499997540 gbpat182.seq
499999013 gbpat183.seq
86829619 gbpat184.seq
499923480 gbpat185.seq
499999973 gbpat186.seq
499996819 gbpat187.seq
39745949 gbpat188.seq
499254825 gbpat189.seq
499849358 gbpat19.seq
499999349 gbpat190.seq
499999947 gbpat191.seq
499999763 gbpat192.seq
96565312 gbpat193.seq
499880230 gbpat194.seq
499998147 gbpat195.seq
499999338 gbpat196.seq
499999249 gbpat197.seq
90172127 gbpat198.seq
499993118 gbpat199.seq
500000047 gbpat2.seq
499998148 gbpat20.seq
499994277 gbpat200.seq
499998512 gbpat201.seq
499999457 gbpat202.seq
4092526 gbpat203.seq
499999756 gbpat204.seq
499999459 gbpat205.seq
500000244 gbpat206.seq
478202129 gbpat207.seq
500000054 gbpat208.seq
499999577 gbpat209.seq
499998516 gbpat21.seq
321705067 gbpat210.seq
499991396 gbpat211.seq
499963719 gbpat212.seq
350635988 gbpat213.seq
497506292 gbpat214.seq
499869540 gbpat215.seq
421452571 gbpat216.seq
499425936 gbpat217.seq
499999361 gbpat218.seq
336263474 gbpat219.seq
347575557 gbpat22.seq
499998549 gbpat220.seq
499999732 gbpat221.seq
499993995 gbpat222.seq
235983990 gbpat223.seq
499999662 gbpat224.seq
494515367 gbpat225.seq
341868206 gbpat226.seq
499999744 gbpat227.seq
500000159 gbpat228.seq
500000163 gbpat229.seq
499878940 gbpat23.seq
204065998 gbpat230.seq
499999985 gbpat24.seq
499998020 gbpat25.seq
499929715 gbpat26.seq
165909393 gbpat27.seq
499998459 gbpat28.seq
500000116 gbpat29.seq
61221846 gbpat3.seq
213213665 gbpat30.seq
499999775 gbpat31.seq
406023815 gbpat32.seq
499999551 gbpat33.seq
499998847 gbpat34.seq
125443143 gbpat35.seq
499999299 gbpat36.seq
499999218 gbpat37.seq
499999570 gbpat38.seq
140142486 gbpat39.seq
499999531 gbpat4.seq
500000235 gbpat40.seq
493971399 gbpat41.seq
494767254 gbpat42.seq
499999068 gbpat43.seq
149226143 gbpat44.seq
499999126 gbpat45.seq
499999712 gbpat46.seq
499999412 gbpat47.seq
87820907 gbpat48.seq
500000117 gbpat49.seq
499999881 gbpat5.seq
499999132 gbpat50.seq
499999448 gbpat51.seq
130944871 gbpat52.seq
499999307 gbpat53.seq
499999084 gbpat54.seq
184982482 gbpat55.seq
499999726 gbpat56.seq
499999154 gbpat57.seq
137265710 gbpat58.seq
499998902 gbpat59.seq
418801944 gbpat6.seq
499638184 gbpat60.seq
429853204 gbpat61.seq
499999966 gbpat62.seq
320983976 gbpat63.seq
499999908 gbpat64.seq
499999287 gbpat65.seq
306067079 gbpat66.seq
499999595 gbpat67.seq
499997159 gbpat68.seq
144919043 gbpat69.seq
499999141 gbpat7.seq
499999495 gbpat70.seq
226235202 gbpat71.seq
499942763 gbpat72.seq
500000257 gbpat73.seq
309555677 gbpat74.seq
499990988 gbpat75.seq
499996904 gbpat76.seq
259606120 gbpat77.seq
499998418 gbpat78.seq
499997914 gbpat79.seq
499997827 gbpat8.seq
36785301 gbpat80.seq
500000256 gbpat81.seq
474123180 gbpat82.seq
499999508 gbpat83.seq
331587194 gbpat84.seq
499997072 gbpat85.seq
312116299 gbpat86.seq
499997412 gbpat87.seq
499999533 gbpat88.seq
499998501 gbpat89.seq
317197632 gbpat9.seq
203696088 gbpat90.seq
499999444 gbpat91.seq
455869832 gbpat92.seq
499989179 gbpat93.seq
252183668 gbpat94.seq
499999120 gbpat95.seq
499999714 gbpat96.seq
82093336 gbpat97.seq
499999689 gbpat98.seq
498236426 gbpat99.seq
499884314 gbphg1.seq
499971031 gbphg2.seq
499873588 gbphg3.seq
499954783 gbphg4.seq
53350424 gbphg5.seq
499999212 gbpln1.seq
268695070 gbpln10.seq
499349862 gbpln100.seq
453105795 gbpln101.seq
445429529 gbpln102.seq
387853287 gbpln103.seq
496158394 gbpln104.seq
499300460 gbpln105.seq
497522140 gbpln106.seq
232632713 gbpln107.seq
489314534 gbpln108.seq
492955583 gbpln109.seq
499944135 gbpln11.seq
485011441 gbpln110.seq
396998299 gbpln111.seq
86085 gbpln112.seq
360410 gbpln113.seq
164960914 gbpln114.seq
40081561 gbpln115.seq
74904960 gbpln116.seq
499999650 gbpln117.seq
357042599 gbpln118.seq
499997352 gbpln119.seq
498196555 gbpln12.seq
499999633 gbpln120.seq
140513196 gbpln121.seq
499876002 gbpln122.seq
498655836 gbpln123.seq
499989614 gbpln124.seq
286839004 gbpln125.seq
298393416 gbpln126.seq
211259633 gbpln127.seq
248504259 gbpln128.seq
185644600 gbpln129.seq
469735020 gbpln13.seq
997331398 gbpln130.seq
56505309 gbpln131.seq
487346847 gbpln132.seq
473525516 gbpln133.seq
473209377 gbpln134.seq
467870557 gbpln135.seq
168324921 gbpln136.seq
441968896 gbpln137.seq
460425795 gbpln138.seq
479222672 gbpln139.seq
170594776 gbpln14.seq
92564056 gbpln140.seq
609356119 gbpln141.seq
786074578 gbpln142.seq
733167229 gbpln143.seq
736239733 gbpln144.seq
691575746 gbpln145.seq
660133963 gbpln146.seq
739031764 gbpln147.seq
457873913 gbpln148.seq
215054955 gbpln149.seq
496172088 gbpln15.seq
500000092 gbpln150.seq
63664163 gbpln151.seq
499998729 gbpln152.seq
499999308 gbpln153.seq
269558199 gbpln154.seq
499997475 gbpln155.seq
499999174 gbpln156.seq
89167395 gbpln157.seq
499996722 gbpln158.seq
479238312 gbpln159.seq
478225238 gbpln16.seq
499996808 gbpln160.seq
419076427 gbpln161.seq
499998682 gbpln162.seq
388212108 gbpln163.seq
499998358 gbpln164.seq
499996649 gbpln165.seq
499998271 gbpln166.seq
66642797 gbpln167.seq
500000190 gbpln168.seq
499992243 gbpln169.seq
335223965 gbpln17.seq
420237847 gbpln170.seq
499998052 gbpln171.seq
498828529 gbpln172.seq
496124076 gbpln173.seq
255919036 gbpln174.seq
499803810 gbpln175.seq
491540803 gbpln176.seq
402785639 gbpln177.seq
445924319 gbpln178.seq
499941013 gbpln179.seq
418823303 gbpln18.seq
3781263 gbpln180.seq
492212326 gbpln181.seq
226945063 gbpln182.seq
314340961 gbpln183.seq
665291577 gbpln184.seq
860028189 gbpln185.seq
800605872 gbpln186.seq
794469115 gbpln187.seq
762933697 gbpln188.seq
729969959 gbpln189.seq
499938071 gbpln19.seq
808217924 gbpln190.seq
209124374 gbpln191.seq
924325157 gbpln192.seq
1201978654 gbpln193.seq
1227268207 gbpln194.seq
1152253241 gbpln195.seq
1115248374 gbpln196.seq
1125506105 gbpln197.seq
1145303472 gbpln198.seq
695608615 gbpln199.seq
499971490 gbpln2.seq
92155218 gbpln20.seq
494608315 gbpln200.seq
460644363 gbpln201.seq
152680390 gbpln202.seq
463010274 gbpln203.seq
480459234 gbpln204.seq
494737040 gbpln205.seq
446439114 gbpln206.seq
417743779 gbpln207.seq
250838119 gbpln208.seq
364689197 gbpln209.seq
345796970 gbpln21.seq
339196729 gbpln210.seq
386320509 gbpln211.seq
311828079 gbpln212.seq
213907446 gbpln213.seq
547058897 gbpln214.seq
117075549 gbpln215.seq
485280656 gbpln216.seq
153216303 gbpln217.seq
689933987 gbpln218.seq
887561680 gbpln219.seq
384454870 gbpln22.seq
834970472 gbpln220.seq
826391913 gbpln221.seq
792513917 gbpln222.seq
743209872 gbpln223.seq
833073712 gbpln224.seq
564051 gbpln225.seq
665291577 gbpln226.seq
860028189 gbpln227.seq
800605872 gbpln228.seq
794469115 gbpln229.seq
204140270 gbpln23.seq
762933697 gbpln230.seq
729969959 gbpln231.seq
808217924 gbpln232.seq
189117573 gbpln233.seq
663098252 gbpln234.seq
855592604 gbpln235.seq
807031053 gbpln236.seq
793905039 gbpln237.seq
773303164 gbpln238.seq
718153248 gbpln239.seq
84616321 gbpln24.seq
804870210 gbpln240.seq
661762125 gbpln241.seq
840180304 gbpln242.seq
796430245 gbpln243.seq
779180715 gbpln244.seq
761224530 gbpln245.seq
725380245 gbpln246.seq
792983451 gbpln247.seq
652402241 gbpln248.seq
831209396 gbpln249.seq
477735094 gbpln25.seq
783682955 gbpln250.seq
775938782 gbpln251.seq
741958804 gbpln252.seq
700440901 gbpln253.seq
788705159 gbpln254.seq
665885380 gbpln255.seq
854365289 gbpln256.seq
802776370 gbpln257.seq
793295936 gbpln258.seq
769246264 gbpln259.seq
499901688 gbpln26.seq
710912943 gbpln260.seq
799876839 gbpln261.seq
635039454 gbpln262.seq
824184474 gbpln263.seq
768070182 gbpln264.seq
758956882 gbpln265.seq
732189331 gbpln266.seq
706311232 gbpln267.seq
766293442 gbpln268.seq
651415133 gbpln269.seq
498817745 gbpln27.seq
830082304 gbpln270.seq
783385752 gbpln271.seq
770520351 gbpln272.seq
753421970 gbpln273.seq
699441547 gbpln274.seq
784443196 gbpln275.seq
702337808 gbpln276.seq
906907390 gbpln277.seq
844110716 gbpln278.seq
841780855 gbpln279.seq
323729344 gbpln28.seq
805270043 gbpln280.seq
764396863 gbpln281.seq
841492595 gbpln282.seq
714482811 gbpln283.seq
916127997 gbpln284.seq
858459407 gbpln285.seq
848936990 gbpln286.seq
813129213 gbpln287.seq
765593150 gbpln288.seq
862731158 gbpln289.seq
499081327 gbpln29.seq
665885340 gbpln290.seq
629668050 gbpln291.seq
814320946 gbpln292.seq
759349720 gbpln293.seq
762512207 gbpln294.seq
724647884 gbpln295.seq
679679449 gbpln296.seq
784312844 gbpln297.seq
684180819 gbpln298.seq
873292213 gbpln299.seq
499979993 gbpln3.seq
497392106 gbpln30.seq
827422505 gbpln300.seq
815925825 gbpln301.seq
779009585 gbpln302.seq
739747654 gbpln303.seq
834950434 gbpln304.seq
663096073 gbpln305.seq
849628701 gbpln306.seq
803882830 gbpln307.seq
794420470 gbpln308.seq
760127459 gbpln309.seq
499424594 gbpln31.seq
714663802 gbpln310.seq
801095950 gbpln311.seq
668869887 gbpln312.seq
854770002 gbpln313.seq
805931576 gbpln314.seq
798923954 gbpln315.seq
766411223 gbpln316.seq
723133936 gbpln317.seq
803351408 gbpln318.seq
664176987 gbpln319.seq
103293547 gbpln32.seq
854339916 gbpln320.seq
803900400 gbpln321.seq
791449620 gbpln322.seq
761145205 gbpln323.seq
715062603 gbpln324.seq
806379176 gbpln325.seq
668964953 gbpln326.seq
870939392 gbpln327.seq
809408813 gbpln328.seq
801514137 gbpln329.seq
496565850 gbpln33.seq
768794024 gbpln330.seq
723644689 gbpln331.seq
815153418 gbpln332.seq
661177159 gbpln333.seq
846934671 gbpln334.seq
794708793 gbpln335.seq
789781753 gbpln336.seq
764576068 gbpln337.seq
711115451 gbpln338.seq
797517245 gbpln339.seq
498203430 gbpln34.seq
691953899 gbpln340.seq
888406351 gbpln341.seq
835271741 gbpln342.seq
823533989 gbpln343.seq
787819193 gbpln344.seq
748786657 gbpln345.seq
838184652 gbpln346.seq
488183272 gbpln347.seq
439661491 gbpln348.seq
155752105 gbpln349.seq
349198346 gbpln35.seq
758806100 gbpln350.seq
898446949 gbpln351.seq
628489896 gbpln352.seq
1024113089 gbpln353.seq
1032878661 gbpln354.seq
858694781 gbpln355.seq
960391204 gbpln356.seq
1090094606 gbpln357.seq
781959143 gbpln358.seq
946995961 gbpln359.seq
454048044 gbpln36.seq
857542781 gbpln360.seq
656405285 gbpln361.seq
907889097 gbpln362.seq
896386890 gbpln363.seq
726432335 gbpln364.seq
798296822 gbpln365.seq
918393750 gbpln366.seq
584961784 gbpln367.seq
948865971 gbpln368.seq
954536271 gbpln369.seq
495221716 gbpln37.seq
819735731 gbpln370.seq
756588093 gbpln371.seq
876067119 gbpln372.seq
625446321 gbpln373.seq
977801494 gbpln374.seq
854357980 gbpln375.seq
807732556 gbpln376.seq
947696453 gbpln377.seq
1067629605 gbpln378.seq
822222048 gbpln379.seq
382012980 gbpln38.seq
950272996 gbpln380.seq
845138843 gbpln381.seq
643846993 gbpln382.seq
894745096 gbpln383.seq
893352134 gbpln384.seq
722578984 gbpln385.seq
776227316 gbpln386.seq
899750467 gbpln387.seq
592059964 gbpln388.seq
933986451 gbpln389.seq
498975616 gbpln39.seq
939527664 gbpln390.seq
810117922 gbpln391.seq
765938558 gbpln392.seq
886537018 gbpln393.seq
623519964 gbpln394.seq
996940649 gbpln395.seq
1030190034 gbpln396.seq
832828033 gbpln397.seq
956342979 gbpln398.seq
1134286144 gbpln399.seq
499836712 gbpln4.seq
472855786 gbpln40.seq
790513299 gbpln400.seq
944161893 gbpln401.seq
860035788 gbpln402.seq
647268685 gbpln403.seq
902239623 gbpln404.seq
611029440 gbpln405.seq
734907577 gbpln406.seq
787834228 gbpln407.seq
910724363 gbpln408.seq
606016896 gbpln409.seq
496785962 gbpln41.seq
961485234 gbpln410.seq
1242775191 gbpln411.seq
816670128 gbpln412.seq
636658925 gbpln413.seq
818591771 gbpln414.seq
766580884 gbpln415.seq
752100829 gbpln416.seq
724519993 gbpln417.seq
690955648 gbpln418.seq
769738288 gbpln419.seq
429867937 gbpln42.seq
750738544 gbpln420.seq
872184389 gbpln421.seq
624480879 gbpln422.seq
995069022 gbpln423.seq
1012956234 gbpln424.seq
827074347 gbpln425.seq
940621783 gbpln426.seq
1079418810 gbpln427.seq
776922106 gbpln428.seq
938380968 gbpln429.seq
478648725 gbpln43.seq
848757671 gbpln430.seq
643572913 gbpln431.seq
891714442 gbpln432.seq
878638403 gbpln433.seq
721632671 gbpln434.seq
779156122 gbpln435.seq
895553446 gbpln436.seq
604678568 gbpln437.seq
931006295 gbpln438.seq
933660027 gbpln439.seq
83738349 gbpln44.seq
810459540 gbpln440.seq
761872100 gbpln441.seq
878702815 gbpln442.seq
627081460 gbpln443.seq
994320235 gbpln444.seq
999434327 gbpln445.seq
823789349 gbpln446.seq
945629782 gbpln447.seq
1062113821 gbpln448.seq
792298939 gbpln449.seq
494333229 gbpln45.seq
941851700 gbpln450.seq
850142413 gbpln451.seq
656955691 gbpln452.seq
904094753 gbpln453.seq
900193903 gbpln454.seq
728906821 gbpln455.seq
741172650 gbpln456.seq
898719079 gbpln457.seq
599002526 gbpln458.seq
937117048 gbpln459.seq
475215142 gbpln46.seq
936021119 gbpln460.seq
812696702 gbpln461.seq
746628212 gbpln462.seq
897168807 gbpln463.seq
626698501 gbpln464.seq
1007072101 gbpln465.seq
1000831797 gbpln466.seq
841918855 gbpln467.seq
963426816 gbpln468.seq
1093654114 gbpln469.seq
468208544 gbpln47.seq
791118382 gbpln470.seq
959940756 gbpln471.seq
853263842 gbpln472.seq
648051398 gbpln473.seq
901282075 gbpln474.seq
923491092 gbpln475.seq
732477869 gbpln476.seq
789987733 gbpln477.seq
926022053 gbpln478.seq
610840579 gbpln479.seq
486857567 gbpln48.seq
949759032 gbpln480.seq
955444559 gbpln481.seq
818480442 gbpln482.seq
752251380 gbpln483.seq
897893149 gbpln484.seq
631111272 gbpln485.seq
1022032953 gbpln486.seq
1006306956 gbpln487.seq
837035085 gbpln488.seq
966140819 gbpln489.seq
272302955 gbpln49.seq
1090560006 gbpln490.seq
800164754 gbpln491.seq
959884028 gbpln492.seq
886916735 gbpln493.seq
641540050 gbpln494.seq
910168783 gbpln495.seq
908785549 gbpln496.seq
729527181 gbpln497.seq
797552105 gbpln498.seq
910975470 gbpln499.seq
465749065 gbpln5.seq
172902191 gbpln50.seq
616026199 gbpln500.seq
945685366 gbpln501.seq
953145956 gbpln502.seq
820081609 gbpln503.seq
763165947 gbpln504.seq
870898266 gbpln505.seq
618200825 gbpln506.seq
1009123187 gbpln507.seq
1016689515 gbpln508.seq
832912303 gbpln509.seq
471233536 gbpln51.seq
952656374 gbpln510.seq
1065835283 gbpln511.seq
776075044 gbpln512.seq
935940025 gbpln513.seq
846831932 gbpln514.seq
641399988 gbpln515.seq
892709705 gbpln516.seq
594848385 gbpln517.seq
720169483 gbpln518.seq
780564861 gbpln519.seq
455042321 gbpln52.seq
888344689 gbpln520.seq
610800072 gbpln521.seq
934713391 gbpln522.seq
1233388213 gbpln523.seq
807523234 gbpln524.seq
19542 gbpln525.seq
757881986 gbpln526.seq
889760627 gbpln527.seq
635890046 gbpln528.seq
1007873898 gbpln529.seq
488809223 gbpln53.seq
1015524558 gbpln530.seq
836625022 gbpln531.seq
959076059 gbpln532.seq
1077416379 gbpln533.seq
789416089 gbpln534.seq
958430056 gbpln535.seq
877922843 gbpln536.seq
648665455 gbpln537.seq
907513209 gbpln538.seq
904978028 gbpln539.seq
355272263 gbpln54.seq
727024880 gbpln540.seq
789120540 gbpln541.seq
898507915 gbpln542.seq
617229811 gbpln543.seq
942711764 gbpln544.seq
964780021 gbpln545.seq
818917331 gbpln546.seq
755294557 gbpln547.seq
882064051 gbpln548.seq
627203691 gbpln549.seq
200538454 gbpln55.seq
993595919 gbpln550.seq
1021497440 gbpln551.seq
827286497 gbpln552.seq
962451301 gbpln553.seq
1082256067 gbpln554.seq
781463827 gbpln555.seq
919665368 gbpln556.seq
852133929 gbpln557.seq
645388382 gbpln558.seq
905574854 gbpln559.seq
377219536 gbpln56.seq
906714977 gbpln560.seq
718743537 gbpln561.seq
787529633 gbpln562.seq
910251919 gbpln563.seq
608518276 gbpln564.seq
934541265 gbpln565.seq
954054955 gbpln566.seq
806443717 gbpln567.seq
253168278 gbpln568.seq
654245898 gbpln569.seq
375192640 gbpln57.seq
843080362 gbpln570.seq
787261705 gbpln571.seq
773098599 gbpln572.seq
745082094 gbpln573.seq
711612756 gbpln574.seq
801222610 gbpln575.seq
271464 gbpln576.seq
398651709 gbpln577.seq
315170317 gbpln578.seq
306732013 gbpln579.seq
386441749 gbpln58.seq
319872292 gbpln580.seq
286450423 gbpln581.seq
220883441 gbpln582.seq
470283415 gbpln583.seq
475850186 gbpln584.seq
499124836 gbpln585.seq
460644363 gbpln586.seq
359155255 gbpln587.seq
399402445 gbpln588.seq
501115666 gbpln589.seq
482478614 gbpln59.seq
413826113 gbpln590.seq
367000227 gbpln591.seq
238050627 gbpln592.seq
352241749 gbpln593.seq
298781185 gbpln594.seq
490716477 gbpln595.seq
86105130 gbpln596.seq
9838016 gbpln597.seq
10182293 gbpln598.seq
766528189 gbpln599.seq
499996649 gbpln6.seq
473293925 gbpln60.seq
11369437 gbpln600.seq
756143249 gbpln601.seq
878426054 gbpln602.seq
631056251 gbpln603.seq
993852367 gbpln604.seq
1020132695 gbpln605.seq
830166807 gbpln606.seq
955723315 gbpln607.seq
1057964328 gbpln608.seq
784007552 gbpln609.seq
476593700 gbpln61.seq
947940191 gbpln610.seq
857511193 gbpln611.seq
649137171 gbpln612.seq
903393879 gbpln613.seq
908180396 gbpln614.seq
721135945 gbpln615.seq
786739709 gbpln616.seq
918070756 gbpln617.seq
603192844 gbpln618.seq
938102555 gbpln619.seq
434249982 gbpln62.seq
955978436 gbpln620.seq
813787878 gbpln621.seq
639701128 gbpln622.seq
468518590 gbpln623.seq
499438787 gbpln624.seq
498564916 gbpln625.seq
20791137 gbpln626.seq
768129678 gbpln627.seq
891209633 gbpln628.seq
1017177961 gbpln629.seq
440487400 gbpln63.seq
1036708108 gbpln630.seq
980496603 gbpln631.seq
1096870510 gbpln632.seq
964601805 gbpln633.seq
883690282 gbpln634.seq
879367269 gbpln635.seq
922136688 gbpln636.seq
805432021 gbpln637.seq
912345991 gbpln638.seq
954500353 gbpln639.seq
444203819 gbpln64.seq
944560088 gbpln640.seq
29543150 gbpln641.seq
400704923 gbpln642.seq
499998570 gbpln643.seq
499999953 gbpln644.seq
463913505 gbpln645.seq
499997888 gbpln646.seq
499998959 gbpln647.seq
499997625 gbpln648.seq
32266666 gbpln649.seq
189178941 gbpln65.seq
499854455 gbpln650.seq
499867554 gbpln651.seq
499768997 gbpln652.seq
124161966 gbpln653.seq
499999893 gbpln654.seq
499947378 gbpln655.seq
499999924 gbpln656.seq
498941935 gbpln657.seq
194526314 gbpln658.seq
499944994 gbpln659.seq
460468033 gbpln66.seq
490767999 gbpln660.seq
453022433 gbpln661.seq
455514995 gbpln662.seq
499995935 gbpln663.seq
12378762 gbpln664.seq
440542307 gbpln67.seq
452992006 gbpln68.seq
497916786 gbpln69.seq
499982650 gbpln7.seq
480376128 gbpln70.seq
71745252 gbpln71.seq
470915914 gbpln72.seq
472129613 gbpln73.seq
477884160 gbpln74.seq
460004048 gbpln75.seq
430418757 gbpln76.seq
441540696 gbpln77.seq
433637010 gbpln78.seq
498225038 gbpln79.seq
225389258 gbpln8.seq
107501131 gbpln80.seq
449964742 gbpln81.seq
422837725 gbpln82.seq
383453843 gbpln83.seq
376172115 gbpln84.seq
326317072 gbpln85.seq
320571252 gbpln86.seq
286199716 gbpln87.seq
277716231 gbpln88.seq
499733063 gbpln89.seq
499990067 gbpln9.seq
63743689 gbpln90.seq
391026515 gbpln91.seq
362500946 gbpln92.seq
390024684 gbpln93.seq
341773034 gbpln94.seq
199854530 gbpln95.seq
483137313 gbpln96.seq
493806535 gbpln97.seq
495462120 gbpln98.seq
349088447 gbpln99.seq
148373728 gbpri1.seq
499825465 gbpri10.seq
499966274 gbpri11.seq
248882813 gbpri12.seq
499849548 gbpri13.seq
352965842 gbpri14.seq
162640989 gbpri15.seq
494717100 gbpri16.seq
499956353 gbpri17.seq
499952905 gbpri18.seq
499962231 gbpri19.seq
499841773 gbpri2.seq
254317986 gbpri20.seq
317623183 gbpri21.seq
301998886 gbpri22.seq
491209604 gbpri23.seq
445784104 gbpri24.seq
381563743 gbpri25.seq
343179555 gbpri26.seq
476586505 gbpri27.seq
474070691 gbpri28.seq
368091958 gbpri29.seq
499891257 gbpri3.seq
499999987 gbpri30.seq
73662383 gbpri31.seq
499936200 gbpri32.seq
445708926 gbpri33.seq
427945376 gbpri34.seq
376528667 gbpri35.seq
483909000 gbpri36.seq
361487740 gbpri37.seq
388659484 gbpri38.seq
448630212 gbpri39.seq
499855390 gbpri4.seq
499941391 gbpri40.seq
307422144 gbpri41.seq
499999213 gbpri42.seq
499997343 gbpri43.seq
253494046 gbpri44.seq
499996228 gbpri45.seq
499999245 gbpri46.seq
316320970 gbpri47.seq
499974927 gbpri48.seq
493577427 gbpri49.seq
499729136 gbpri5.seq
314294173 gbpri50.seq
258775295 gbpri51.seq
499996589 gbpri52.seq
499998813 gbpri53.seq
499997047 gbpri54.seq
160134108 gbpri55.seq
393528728 gbpri6.seq
499802910 gbpri7.seq
499984899 gbpri8.seq
499967070 gbpri9.seq
579562 gbrel.txt
499981989 gbrod1.seq
499996924 gbrod10.seq
6033878 gbrod11.seq
499808129 gbrod12.seq
203924668 gbrod13.seq
499994294 gbrod14.seq
499997569 gbrod15.seq
499997953 gbrod16.seq
294660569 gbrod17.seq
402682445 gbrod18.seq
485622431 gbrod19.seq
499802341 gbrod2.seq
447177606 gbrod20.seq
401874104 gbrod21.seq
366906621 gbrod22.seq
178573599 gbrod23.seq
488460696 gbrod24.seq
424418862 gbrod25.seq
451727059 gbrod26.seq
499112036 gbrod27.seq
467946548 gbrod28.seq
425428799 gbrod29.seq
499880319 gbrod3.seq
380509124 gbrod30.seq
359291146 gbrod31.seq
441031541 gbrod32.seq
489661762 gbrod33.seq
301541840 gbrod34.seq
245696968 gbrod35.seq
444533522 gbrod36.seq
404901396 gbrod37.seq
350079181 gbrod38.seq
484303888 gbrod39.seq
499702715 gbrod4.seq
464197213 gbrod40.seq
311443008 gbrod41.seq
441713729 gbrod42.seq
398906813 gbrod43.seq
493373336 gbrod44.seq
407105696 gbrod45.seq
117842878 gbrod46.seq
488265022 gbrod47.seq
434197329 gbrod48.seq
412800312 gbrod49.seq
499960342 gbrod5.seq
454365663 gbrod50.seq
382748472 gbrod51.seq
428038719 gbrod52.seq
487918369 gbrod53.seq
440586747 gbrod54.seq
359290553 gbrod55.seq
462954406 gbrod56.seq
80291490 gbrod6.seq
499846851 gbrod7.seq
499742719 gbrod8.seq
499945822 gbrod9.seq
499998599 gbsts1.seq
499997636 gbsts10.seq
433283954 gbsts11.seq
499997185 gbsts2.seq
38079720 gbsts3.seq
499998792 gbsts4.seq
499996883 gbsts5.seq
456729482 gbsts6.seq
499997388 gbsts7.seq
499998906 gbsts8.seq
21538013 gbsts9.seq
300833275 gbsyn1.seq
484840372 gbsyn10.seq
420813753 gbsyn11.seq
490139440 gbsyn12.seq
343340422 gbsyn13.seq
372527348 gbsyn14.seq
417861289 gbsyn15.seq
448312981 gbsyn16.seq
416378132 gbsyn17.seq
453065790 gbsyn18.seq
263307032 gbsyn19.seq
343340424 gbsyn2.seq
484840366 gbsyn20.seq
420813747 gbsyn21.seq
498979310 gbsyn22.seq
497716054 gbsyn23.seq
29381216 gbsyn24.seq
499993129 gbsyn25.seq
499996365 gbsyn26.seq
499995456 gbsyn27.seq
244071349 gbsyn28.seq
325470021 gbsyn29.seq
372527353 gbsyn3.seq
417861297 gbsyn4.seq
448312992 gbsyn5.seq
81377357 gbsyn6.seq
470781602 gbsyn7.seq
317285242 gbsyn8.seq
263307034 gbsyn9.seq
499999476 gbtsa1.seq
500000000 gbtsa10.seq
499997439 gbtsa100.seq
499999811 gbtsa101.seq
499996108 gbtsa102.seq
404671505 gbtsa103.seq
499996434 gbtsa104.seq
499998444 gbtsa105.seq
499998535 gbtsa106.seq
473627173 gbtsa107.seq
499999949 gbtsa108.seq
499998832 gbtsa109.seq
499997424 gbtsa11.seq
236669988 gbtsa110.seq
499991596 gbtsa111.seq
499999834 gbtsa112.seq
499999770 gbtsa113.seq
499998939 gbtsa114.seq
34150369 gbtsa115.seq
499995781 gbtsa116.seq
499999069 gbtsa117.seq
499994937 gbtsa118.seq
470659755 gbtsa119.seq
280130073 gbtsa12.seq
499998218 gbtsa120.seq
499998672 gbtsa121.seq
499999924 gbtsa122.seq
280313902 gbtsa123.seq
499999116 gbtsa124.seq
499998111 gbtsa125.seq
499999818 gbtsa126.seq
423256101 gbtsa127.seq
499996235 gbtsa13.seq
499998198 gbtsa14.seq
152208041 gbtsa15.seq
499999603 gbtsa16.seq
499997193 gbtsa17.seq
258373800 gbtsa18.seq
499998168 gbtsa19.seq
499998745 gbtsa2.seq
499999213 gbtsa20.seq
500000233 gbtsa21.seq
67592738 gbtsa22.seq
499998052 gbtsa23.seq
499999856 gbtsa24.seq
499998098 gbtsa25.seq
277251866 gbtsa26.seq
499999635 gbtsa27.seq
499999791 gbtsa28.seq
71311344 gbtsa29.seq
146901025 gbtsa3.seq
499999538 gbtsa30.seq
499999007 gbtsa31.seq
158252503 gbtsa32.seq
499998095 gbtsa33.seq
499999071 gbtsa34.seq
499998984 gbtsa35.seq
489509289 gbtsa36.seq
499999807 gbtsa37.seq
499998500 gbtsa38.seq
499999107 gbtsa39.seq
499998574 gbtsa4.seq
227191517 gbtsa40.seq
499999675 gbtsa41.seq
499991892 gbtsa42.seq
500000238 gbtsa43.seq
175111340 gbtsa44.seq
499998997 gbtsa45.seq
499999560 gbtsa46.seq
354820880 gbtsa47.seq
499999373 gbtsa48.seq
499997080 gbtsa49.seq
499999957 gbtsa5.seq
292181365 gbtsa50.seq
499999724 gbtsa51.seq
499991820 gbtsa52.seq
394986405 gbtsa53.seq
499997625 gbtsa54.seq
499998684 gbtsa55.seq
500000232 gbtsa56.seq
350652541 gbtsa57.seq
499999428 gbtsa58.seq
499998841 gbtsa59.seq
50314975 gbtsa6.seq
499998177 gbtsa60.seq
224353812 gbtsa61.seq
499999722 gbtsa62.seq
500000157 gbtsa63.seq
259943701 gbtsa64.seq
499999212 gbtsa65.seq
465402653 gbtsa66.seq
499998493 gbtsa67.seq
499999436 gbtsa68.seq
499996902 gbtsa69.seq
499997923 gbtsa7.seq
165103829 gbtsa70.seq
499997567 gbtsa71.seq
500000162 gbtsa72.seq
499998185 gbtsa73.seq
2512297 gbtsa74.seq
499998773 gbtsa75.seq
499998780 gbtsa76.seq
131409934 gbtsa77.seq
500000012 gbtsa78.seq
500000259 gbtsa79.seq
499999246 gbtsa8.seq
33928768 gbtsa80.seq
499999375 gbtsa81.seq
499997084 gbtsa82.seq
499997050 gbtsa83.seq
499998886 gbtsa84.seq
45829472 gbtsa85.seq
499997106 gbtsa86.seq
499998546 gbtsa87.seq
499998356 gbtsa88.seq
81426641 gbtsa89.seq
270158740 gbtsa9.seq
499999824 gbtsa90.seq
389215892 gbtsa91.seq
499998191 gbtsa92.seq
499994249 gbtsa93.seq
499998640 gbtsa94.seq
208350764 gbtsa95.seq
499999734 gbtsa96.seq
499998253 gbtsa97.seq
499996332 gbtsa98.seq
230879944 gbtsa99.seq
6976723 gbuna1.seq
499996560 gbvrl1.seq
499997048 gbvrl10.seq
499965728 gbvrl100.seq
499976578 gbvrl101.seq
225739938 gbvrl102.seq
499977611 gbvrl103.seq
499973738 gbvrl104.seq
499972748 gbvrl105.seq
322559158 gbvrl106.seq
499982106 gbvrl107.seq
499975547 gbvrl108.seq
499968141 gbvrl109.seq
499997385 gbvrl11.seq
209207583 gbvrl110.seq
490193585 gbvrl111.seq
499992500 gbvrl112.seq
237102188 gbvrl113.seq
76688277 gbvrl114.seq
499975735 gbvrl115.seq
499966691 gbvrl116.seq
499992117 gbvrl117.seq
249286668 gbvrl118.seq
499997356 gbvrl119.seq
163061263 gbvrl12.seq
499968021 gbvrl120.seq
499975157 gbvrl121.seq
277362516 gbvrl122.seq
499986328 gbvrl123.seq
499980027 gbvrl124.seq
499964886 gbvrl125.seq
168594316 gbvrl126.seq
499975370 gbvrl127.seq
499965186 gbvrl128.seq
499975646 gbvrl129.seq
500000145 gbvrl13.seq
128062679 gbvrl130.seq
499998178 gbvrl14.seq
134073015 gbvrl15.seq
499997315 gbvrl16.seq
499999993 gbvrl17.seq
315342324 gbvrl18.seq
499999546 gbvrl19.seq
499978798 gbvrl2.seq
499999766 gbvrl20.seq
345412768 gbvrl21.seq
499998581 gbvrl22.seq
499995950 gbvrl23.seq
368961913 gbvrl24.seq
499999815 gbvrl25.seq
499996928 gbvrl26.seq
313277032 gbvrl27.seq
499919436 gbvrl28.seq
499999403 gbvrl29.seq
403617992 gbvrl3.seq
499999516 gbvrl30.seq
215798745 gbvrl31.seq
500000223 gbvrl32.seq
499995109 gbvrl33.seq
418139995 gbvrl34.seq
499999903 gbvrl35.seq
499988612 gbvrl36.seq
411173992 gbvrl37.seq
500000223 gbvrl38.seq
499968998 gbvrl39.seq
499997372 gbvrl4.seq
499990259 gbvrl40.seq
217570095 gbvrl41.seq
499982339 gbvrl42.seq
499960267 gbvrl43.seq
499955039 gbvrl44.seq
195360949 gbvrl45.seq
499935851 gbvrl46.seq
499986634 gbvrl47.seq
499990912 gbvrl48.seq
219941431 gbvrl49.seq
499999386 gbvrl5.seq
499993595 gbvrl50.seq
499938576 gbvrl51.seq
499939218 gbvrl52.seq
221447205 gbvrl53.seq
499965897 gbvrl54.seq
499977538 gbvrl55.seq
499951999 gbvrl56.seq
499974910 gbvrl57.seq
128436862 gbvrl58.seq
499991164 gbvrl59.seq
499998023 gbvrl6.seq
499970540 gbvrl60.seq
499962967 gbvrl61.seq
499987886 gbvrl62.seq
107001926 gbvrl63.seq
499934498 gbvrl64.seq
499986865 gbvrl65.seq
499972951 gbvrl66.seq
499953580 gbvrl67.seq
84033847 gbvrl68.seq
499970779 gbvrl69.seq
499996119 gbvrl7.seq
499982816 gbvrl70.seq
499984376 gbvrl71.seq
398213358 gbvrl72.seq
499961285 gbvrl73.seq
499939826 gbvrl74.seq
499970095 gbvrl75.seq
344486826 gbvrl76.seq
499991207 gbvrl77.seq
499954366 gbvrl78.seq
499990766 gbvrl79.seq
301465032 gbvrl8.seq
281023199 gbvrl80.seq
499937220 gbvrl81.seq
499977925 gbvrl82.seq
499942746 gbvrl83.seq
142468007 gbvrl84.seq
499968572 gbvrl85.seq
499956315 gbvrl86.seq
499978935 gbvrl87.seq
179529284 gbvrl88.seq
499961561 gbvrl89.seq
499998377 gbvrl9.seq
499990245 gbvrl90.seq
499996070 gbvrl91.seq
160685753 gbvrl92.seq
499963378 gbvrl93.seq
499954992 gbvrl94.seq
499962616 gbvrl95.seq
376087996 gbvrl96.seq
499962057 gbvrl97.seq
499975521 gbvrl98.seq
499984932 gbvrl99.seq
499954942 gbvrt1.seq
289935612 gbvrt10.seq
1045817456 gbvrt100.seq
754876698 gbvrt101.seq
616753988 gbvrt102.seq
490283916 gbvrt103.seq
470651151 gbvrt104.seq
397152890 gbvrt105.seq
351566814 gbvrt106.seq
339881554 gbvrt107.seq
404716166 gbvrt108.seq
489465929 gbvrt109.seq
87348314 gbvrt11.seq
499108511 gbvrt110.seq
486719349 gbvrt111.seq
58362562 gbvrt112.seq
436489699 gbvrt113.seq
486735687 gbvrt114.seq
492786702 gbvrt115.seq
424170309 gbvrt116.seq
281367593 gbvrt117.seq
478264522 gbvrt118.seq
485840122 gbvrt119.seq
499776413 gbvrt12.seq
493662272 gbvrt120.seq
75046811 gbvrt121.seq
979125221 gbvrt122.seq
838606764 gbvrt123.seq
678362247 gbvrt124.seq
476490051 gbvrt125.seq
461393141 gbvrt126.seq
438814149 gbvrt127.seq
394334276 gbvrt128.seq
313818221 gbvrt129.seq
284656236 gbvrt13.seq
288999697 gbvrt130.seq
280186115 gbvrt131.seq
407765043 gbvrt132.seq
421856869 gbvrt133.seq
478932645 gbvrt134.seq
480028007 gbvrt135.seq
438022009 gbvrt136.seq
174441466 gbvrt137.seq
487902327 gbvrt138.seq
456814552 gbvrt139.seq
15637437 gbvrt14.seq
462308829 gbvrt140.seq
168813991 gbvrt141.seq
455915969 gbvrt142.seq
469542169 gbvrt143.seq
479148432 gbvrt144.seq
211438035 gbvrt145.seq
481255007 gbvrt146.seq
475910668 gbvrt147.seq
366785231 gbvrt148.seq
464881586 gbvrt149.seq
36032850 gbvrt15.seq
474452025 gbvrt150.seq
234874130 gbvrt151.seq
697335450 gbvrt152.seq
670835803 gbvrt153.seq
524090553 gbvrt154.seq
413420126 gbvrt155.seq
345317144 gbvrt156.seq
329841089 gbvrt157.seq
250750417 gbvrt158.seq
486600390 gbvrt159.seq
18507952 gbvrt16.seq
364885711 gbvrt160.seq
448395879 gbvrt161.seq
471789671 gbvrt162.seq
393642536 gbvrt163.seq
355134416 gbvrt164.seq
470602746 gbvrt165.seq
448657488 gbvrt166.seq
384724558 gbvrt167.seq
432320923 gbvrt168.seq
470227916 gbvrt169.seq
497676663 gbvrt17.seq
497676594 gbvrt170.seq
207882210 gbvrt171.seq
397267013 gbvrt172.seq
366771863 gbvrt173.seq
351249970 gbvrt174.seq
309532358 gbvrt175.seq
296271444 gbvrt176.seq
286321426 gbvrt177.seq
268164730 gbvrt178.seq
253329800 gbvrt179.seq
497173924 gbvrt18.seq
494939336 gbvrt180.seq
424426418 gbvrt181.seq
410896883 gbvrt182.seq
369957025 gbvrt183.seq
169574120 gbvrt184.seq
426847158 gbvrt185.seq
496824508 gbvrt186.seq
434394791 gbvrt187.seq
494363156 gbvrt188.seq
61896426 gbvrt189.seq
481350583 gbvrt19.seq
431425246 gbvrt190.seq
474666330 gbvrt191.seq
479195821 gbvrt192.seq
352877651 gbvrt193.seq
479851070 gbvrt194.seq
497038176 gbvrt195.seq
432867963 gbvrt196.seq
439843808 gbvrt197.seq
469531790 gbvrt198.seq
496015817 gbvrt199.seq
499845382 gbvrt2.seq
400795564 gbvrt20.seq
488626307 gbvrt200.seq
432135676 gbvrt201.seq
70119528 gbvrt202.seq
491056051 gbvrt203.seq
328508705 gbvrt204.seq
497328806 gbvrt205.seq
499238966 gbvrt206.seq
187508760 gbvrt207.seq
490842556 gbvrt208.seq
463385772 gbvrt209.seq
488197715 gbvrt21.seq
446788975 gbvrt210.seq
438416202 gbvrt211.seq
170595769 gbvrt212.seq
451342688 gbvrt213.seq
474563355 gbvrt214.seq
461335548 gbvrt215.seq
436658187 gbvrt216.seq
154682616 gbvrt217.seq
456837606 gbvrt218.seq
488930196 gbvrt219.seq
479291185 gbvrt22.seq
466502331 gbvrt220.seq
455725140 gbvrt221.seq
453475816 gbvrt222.seq
462276007 gbvrt223.seq
497473221 gbvrt224.seq
499283767 gbvrt225.seq
481742871 gbvrt226.seq
54779872 gbvrt227.seq
477445338 gbvrt228.seq
495314515 gbvrt229.seq
480798341 gbvrt23.seq
486008997 gbvrt230.seq
489184435 gbvrt231.seq
499533927 gbvrt232.seq
347467755 gbvrt233.seq
1068402516 gbvrt234.seq
1067356333 gbvrt235.seq
896844819 gbvrt236.seq
805318347 gbvrt237.seq
718662677 gbvrt238.seq
556944666 gbvrt239.seq
499274554 gbvrt24.seq
299728838 gbvrt240.seq
293507186 gbvrt241.seq
484357811 gbvrt242.seq
130768604 gbvrt243.seq
874873715 gbvrt244.seq
685858825 gbvrt245.seq
627564227 gbvrt246.seq
610271897 gbvrt247.seq
543871783 gbvrt248.seq
284797667 gbvrt249.seq
483255170 gbvrt25.seq
269299175 gbvrt250.seq
474717664 gbvrt251.seq
402979396 gbvrt252.seq
343318350 gbvrt253.seq
450550965 gbvrt254.seq
494368803 gbvrt255.seq
470715963 gbvrt256.seq
470514883 gbvrt257.seq
229630846 gbvrt258.seq
499997924 gbvrt259.seq
484153821 gbvrt26.seq
499999927 gbvrt260.seq
449153583 gbvrt261.seq
375312804 gbvrt262.seq
445682876 gbvrt263.seq
474231618 gbvrt264.seq
490948606 gbvrt265.seq
113823882 gbvrt266.seq
65325604 gbvrt27.seq
437233554 gbvrt28.seq
488520688 gbvrt29.seq
466371212 gbvrt3.seq
456456384 gbvrt30.seq
341830592 gbvrt31.seq
14151693 gbvrt32.seq
21383246 gbvrt33.seq
90967413 gbvrt34.seq
499915959 gbvrt35.seq
499998757 gbvrt36.seq
499997732 gbvrt37.seq
55658718 gbvrt38.seq
499999734 gbvrt39.seq
179100370 gbvrt4.seq
269604282 gbvrt40.seq
385151455 gbvrt41.seq
490595601 gbvrt42.seq
386502843 gbvrt43.seq
499999056 gbvrt44.seq
114200369 gbvrt45.seq
499997695 gbvrt46.seq
444638874 gbvrt47.seq
499999087 gbvrt48.seq
28723297 gbvrt49.seq
448778544 gbvrt5.seq
444164538 gbvrt50.seq
499999607 gbvrt51.seq
388614756 gbvrt52.seq
499999369 gbvrt53.seq
279643818 gbvrt54.seq
500000012 gbvrt55.seq
498243359 gbvrt56.seq
499671084 gbvrt57.seq
498538269 gbvrt58.seq
499446397 gbvrt59.seq
490703641 gbvrt6.seq
407274913 gbvrt60.seq
202128841 gbvrt61.seq
123737443 gbvrt62.seq
483315203 gbvrt63.seq
481925504 gbvrt64.seq
499999199 gbvrt65.seq
499926681 gbvrt66.seq
296494910 gbvrt67.seq
492115651 gbvrt68.seq
492375887 gbvrt69.seq
499120716 gbvrt7.seq
479677491 gbvrt70.seq
480814553 gbvrt71.seq
362168611 gbvrt72.seq
490950275 gbvrt73.seq
475405574 gbvrt74.seq
489430322 gbvrt75.seq
352376975 gbvrt76.seq
465372186 gbvrt77.seq
488788789 gbvrt78.seq
189348250 gbvrt79.seq
483670944 gbvrt8.seq
443537150 gbvrt80.seq
421192057 gbvrt81.seq
391877236 gbvrt82.seq
372306206 gbvrt83.seq
293995905 gbvrt84.seq
265966202 gbvrt85.seq
252407302 gbvrt86.seq
496928204 gbvrt87.seq
428781240 gbvrt88.seq
385785859 gbvrt89.seq
263691222 gbvrt9.seq
401948280 gbvrt90.seq
480037651 gbvrt91.seq
474827267 gbvrt92.seq
480710662 gbvrt93.seq
89576280 gbvrt94.seq
435880706 gbvrt95.seq
487966705 gbvrt96.seq
497561523 gbvrt97.seq
468911724 gbvrt98.seq
1063697372 gbvrt99.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 101753 186126331
BCT10 101 247874669
BCT100 127 232212861
BCT101 90 178403076
BCT102 114 212138354
BCT103 75 222053892
BCT104 112 225347102
BCT105 124 217786851
BCT106 3 5977905
BCT107 246 222256023
BCT108 104 221252195
BCT109 100 224644129
BCT11 145 242443173
BCT110 83 222703364
BCT111 21 86233168
BCT112 68 221578114
BCT113 87 219795379
BCT114 87 223588406
BCT115 80 226287962
BCT116 20 45564131
BCT117 124 217933644
BCT118 53 217706139
BCT119 90 227492926
BCT12 167 262397135
BCT120 57 149506400
BCT121 93 227745457
BCT122 73 219469130
BCT123 112 221134503
BCT124 78 197436829
BCT125 156 218173209
BCT126 84 220629983
BCT127 79 216070642
BCT128 128 225808884
BCT129 104 223973141
BCT13 6 12749856
BCT130 83 220906248
BCT131 87 188328214
BCT132 115 225967887
BCT133 92 220409897
BCT134 158 214217907
BCT135 88 207032597
BCT136 140 220978157
BCT137 63 217844098
BCT138 90 215013764
BCT139 125 217101319
BCT14 170 237845538
BCT140 88 223616604
BCT141 21 65066945
BCT142 174 220602790
BCT143 128 223129487
BCT144 119 218291799
BCT145 170 217503816
BCT146 51 169537907
BCT147 104 218683705
BCT148 113 217389079
BCT149 138 222247056
BCT15 151 240481452
BCT150 109 220993944
BCT151 101 223667628
BCT152 118 156232056
BCT153 95 229134325
BCT154 104 222093509
BCT155 97 225368543
BCT156 116 220401677
BCT157 94 219188969
BCT158 134 220654115
BCT159 36 70525291
BCT16 199 252481270
BCT160 169 220902023
BCT161 100 223727909
BCT162 94 222167747
BCT163 94 214484227
BCT164 71 223304376
BCT165 123 228309968
BCT166 150 228808455
BCT167 80 212882661
BCT168 100 233591727
BCT169 96 224405035
BCT17 206 229349878
BCT170 134 223606319
BCT171 84 220876356
BCT172 24 84218657
BCT173 119 222185746
BCT174 151 231715107
BCT175 72 216080650
BCT176 81 120955479
BCT177 111 216184725
BCT178 156 227708035
BCT179 111 220250972
BCT18 2 4770723
BCT180 89 136614524
BCT181 133 229717687
BCT182 111 208992481
BCT183 108 219925553
BCT184 77 222877345
BCT185 18 29103391
BCT186 98 220152536
BCT187 133 227333368
BCT188 125 230906352
BCT189 118 245874590
BCT19 136 236547259
BCT190 116 233244770
BCT191 29 81157459
BCT192 138 219191771
BCT193 86 222769161
BCT194 108 224413134
BCT195 118 222428501
BCT196 62 117266902
BCT197 130 225454497
BCT198 136 257970110
BCT199 98 224808111
BCT2 106 226909535
BCT20 113 230295403
BCT200 159 214896641
BCT201 66 106598168
BCT202 123 222422665
BCT203 115 218469346
BCT204 89 220134021
BCT205 102 229896253
BCT206 100 195303665
BCT207 97 234475408
BCT208 102 220656832
BCT209 100 218053674
BCT21 140 223708984
BCT210 94 224743372
BCT211 104 226992367
BCT212 107 231904945
BCT213 70 148112573
BCT214 104 221826114
BCT215 108 221051727
BCT216 98 226007841
BCT217 76 270744187
BCT218 75 254647899
BCT219 106 225376718
BCT22 200 220359484
BCT220 176 219971681
BCT221 135 224766311
BCT222 55 106489903
BCT223 324 275336670
BCT224 116 218712797
BCT225 118 218047051
BCT226 44 70966813
BCT227 89 220099828
BCT228 85 224231671
BCT229 85 236035678
BCT23 24 29385563
BCT230 102 222275339
BCT231 22 53037104
BCT232 60 216868170
BCT233 120 221119124
BCT234 86 223426276
BCT235 85 217995381
BCT236 30 67668948
BCT237 160 280339359
BCT238 87 234185848
BCT239 96 219765338
BCT24 185 221418071
BCT240 135 191926241
BCT241 109 262921422
BCT242 72 217635148
BCT243 100 214909619
BCT244 76 205489624
BCT245 139 302417525
BCT246 68 237086992
BCT247 89 216490270
BCT248 136 225170875
BCT249 143 277240703
BCT25 141 219750001
BCT250 36 65426533
BCT251 146 273570514
BCT252 109 252612008
BCT253 35 229012536
BCT254 56 209847636
BCT255 110 218761905
BCT256 130 219578217
BCT257 90 250893937
BCT258 80 203207828
BCT259 124 215159011
BCT26 50 214169296
BCT260 113 223367533
BCT261 144 228597181
BCT262 114 228439247
BCT263 114 231113225
BCT264 120 228230620
BCT265 26 74228471
BCT266 106 218843831
BCT267 82 215186387
BCT268 94 233476721
BCT269 119 218573604
BCT27 114 237685124
BCT270 82 238698827
BCT271 104 235168331
BCT272 76 224105236
BCT273 81 169302861
BCT274 119 217748117
BCT275 165 223999933
BCT276 162 212752925
BCT277 130 226241415
BCT278 100 227626264
BCT279 123 231590590
BCT28 42 89988985
BCT280 160 251320587
BCT281 101 227802166
BCT282 134 225854181
BCT283 101 213999186
BCT284 104 229487878
BCT285 122 224709347
BCT286 173 221884168
BCT287 146 221031050
BCT288 55 93388142
BCT289 130 226536352
BCT29 81 239594577
BCT290 105 224013789
BCT291 83 219368049
BCT292 81 216493682
BCT293 103 168153425
BCT294 88 244048892
BCT295 107 228886299
BCT296 83 221517737
BCT297 61 216100377
BCT298 75 170636859
BCT299 115 219540003
BCT3 37541 123332243
BCT30 100 222853857
BCT300 101 218974130
BCT301 124 216924787
BCT302 90 217527347
BCT303 140 185056878
BCT304 124 248813935
BCT305 107 220439447
BCT306 81 229044933
BCT307 63 220852533
BCT308 85 172696049
BCT309 128 238885544
BCT31 93 229359543
BCT310 197 234044756
BCT311 149 219659340
BCT312 120 215711231
BCT313 119 190631862
BCT314 141 247118611
BCT315 169 281740780
BCT316 171 215470089
BCT317 127 221445658
BCT318 13 96796690
BCT319 72 228738867
BCT32 120 229088367
BCT320 128 242193459
BCT321 1238 225671715
BCT322 114 220825009
BCT323 72 184135953
BCT324 101 222185425
BCT325 126 217279454
BCT326 105 212886231
BCT327 130 220969217
BCT328 225 225358873
BCT329 177 225175223
BCT33 102 223758941
BCT330 114 219348480
BCT331 37 71172806
BCT332 123 216507866
BCT333 144 220140457
BCT334 146 218600953
BCT335 124 227417343
BCT336 149 234265173
BCT337 91 238304642
BCT338 43 82535468
BCT339 111 224832352
BCT34 464 212683169
BCT340 159 237328168
BCT341 114 218095822
BCT342 132 231047558
BCT343 56 137043274
BCT344 125 234008897
BCT345 122 226223828
BCT346 75 218630771
BCT347 86 222585796
BCT348 53 215843787
BCT349 50 220940514
BCT35 5200 7533877
BCT350 169 218203594
BCT351 195 229604129
BCT352 130 250400642
BCT353 142 222978469
BCT354 143 239930821
BCT355 87 243628374
BCT356 84 229185665
BCT357 50 217139038
BCT358 44 175383202
BCT359 92 217200838
BCT36 10402 13141863
BCT360 90 231500758
BCT361 117 246538204
BCT362 203 232314981
BCT363 92 220627220
BCT364 120 214832865
BCT365 22 48955354
BCT366 166 261984346
BCT367 180 236857563
BCT368 477 233890189
BCT369 138 241924534
BCT37 53922 202025650
BCT370 146 236514918
BCT371 97 227313934
BCT372 51 84843705
BCT373 110 230934388
BCT374 85 220353169
BCT375 90 219172744
BCT376 107 233477655
BCT377 161 222802606
BCT378 39 72325844
BCT379 88 219801256
BCT38 189 216139113
BCT380 103 227271083
BCT381 161 319166332
BCT382 106 240801862
BCT383 104 283180268
BCT384 66 154284155
BCT385 114 227850421
BCT386 144 219838434
BCT387 103 222430085
BCT388 148 223405170
BCT389 120 225492649
BCT39 103 228704622
BCT390 107 223091813
BCT391 79 81949757
BCT392 106 227510186
BCT393 144 229471900
BCT394 167 228478844
BCT395 123 219178441
BCT396 15 26867029
BCT397 124 236917018
BCT398 150 218797450
BCT399 137 220098659
BCT4 41293 139254430
BCT40 118 231551515
BCT400 98 225870897
BCT401 23 86146145
BCT402 108 234695862
BCT403 137 236204721
BCT404 84 307724043
BCT405 115 215690342
BCT406 42 75589311
BCT407 123 223159133
BCT408 121 215910438
BCT409 83 215669918
BCT41 25 63062813
BCT410 97 260240312
BCT411 21 54104590
BCT412 121 215033983
BCT413 119 228238463
BCT414 123 217422526
BCT415 111 222449052
BCT416 2 9083541
BCT417 144 219919128
BCT418 107 252494589
BCT419 165 214214629
BCT42 103 220877412
BCT420 157 206720897
BCT421 238 214458452
BCT422 127 212981778
BCT423 106 217490106
BCT424 108 253574665
BCT425 135 258087076
BCT426 39 90424267
BCT427 104 232354566
BCT428 134 236542205
BCT429 110 216989788
BCT43 131 225261716
BCT430 114 226322790
BCT431 86 179120235
BCT432 154 212391501
BCT433 111 223196059
BCT434 152 219197548
BCT435 106 227460401
BCT436 94 221175972
BCT437 311 210496348
BCT438 364 210657095
BCT439 110 214726128
BCT44 119 219809790
BCT440 142 213119125
BCT441 158 217105943
BCT442 168 218983591
BCT443 174 208501241
BCT444 24 45926834
BCT445 161 208257957
BCT446 162 212193463
BCT447 114 210605338
BCT448 157 213126972
BCT449 132 209356669
BCT45 125 219253793
BCT450 131 195243107
BCT451 183 210687290
BCT452 116 210811583
BCT453 136 211510245
BCT454 161 217802986
BCT455 26 41179232
BCT456 168 242619762
BCT457 120 224143618
BCT458 140 223227621
BCT459 142 233386142
BCT46 128 223087901
BCT460 108 219004386
BCT461 198 223725573
BCT462 104 227232366
BCT463 107 221562442
BCT464 79 230177249
BCT465 102 246248911
BCT466 114 267363617
BCT467 67 129553088
BCT468 124 231663912
BCT469 125 221735346
BCT47 195 224497881
BCT470 137 220409858
BCT471 179 228213198
BCT472 142 221439571
BCT473 41 92919193
BCT474 107 258533348
BCT475 89 212143620
BCT476 158 216707113
BCT477 140 219163286
BCT478 111 223674475
BCT479 141 221323166
BCT48 26 45760778
BCT480 4 17573080
BCT481 157 265076949
BCT482 117 314001827
BCT483 159 256390930
BCT484 160 234401772
BCT485 102 222435792
BCT486 15 57262837
BCT487 100 224074038
BCT488 72 217220036
BCT489 118 218376301
BCT49 255 228290103
BCT490 109 212843726
BCT491 150 215018722
BCT492 5 5685062
BCT493 109 216262070
BCT494 123 212777048
BCT495 142 226042883
BCT496 290 224271509
BCT497 44 68314153
BCT498 134 223575162
BCT499 147 216767418
BCT5 20648 169648440
BCT50 96 216108910
BCT500 106 252019363
BCT501 151 215927265
BCT502 162 220870090
BCT503 20 66148192
BCT504 122 220953968
BCT505 179 215918393
BCT506 143 229779363
BCT507 126 217931429
BCT508 63 100370812
BCT509 148 251704567
BCT51 102 220149568
BCT510 174 237850274
BCT511 191 210225765
BCT512 121 249972207
BCT513 51 188275016
BCT514 123 232775461
BCT515 144 226495192
BCT516 123 229272920
BCT517 106 222535936
BCT518 60 150663143
BCT519 115 216604435
BCT52 139 223017390
BCT520 126 225350593
BCT521 97 220288479
BCT522 120 231023669
BCT523 63 176425871
BCT524 135 230968993
BCT525 155 220437411
BCT526 166 224123627
BCT527 113 237840814
BCT528 44 64490279
BCT529 111 240900448
BCT53 106 222031667
BCT530 168 227406012
BCT531 130 220121167
BCT532 97 219545580
BCT533 73 217027539
BCT534 61 209051334
BCT535 57 216931731
BCT536 69 211972395
BCT537 34 102883675
BCT538 62 210249218
BCT539 77 212901126
BCT54 161 220965710
BCT540 164 264564101
BCT541 163 233196815
BCT542 106 228487256
BCT543 96 219341035
BCT544 73 57729608
BCT545 528 115589384
BCT546 1589 2511957
BCT547 3172 5268484
BCT548 6338 7796395
BCT549 12613 14997690
BCT55 133 221316823
BCT550 25523 27672494
BCT551 50567 54073229
BCT552 148910 156737316
BCT553 14173 193495849
BCT554 3297 203942569
BCT555 2509 213411401
BCT556 7215 212675624
BCT557 215 248991489
BCT558 39876 39651493
BCT559 75102 180239641
BCT56 113 217939824
BCT560 11057 202910557
BCT561 6086 209707664
BCT562 130151 172503895
BCT563 31131 35388332
BCT564 149235 156925263
BCT565 84467 88060472
BCT566 144606 151117404
BCT567 25872 25525886
BCT568 132644 167578783
BCT569 31385 43465785
BCT57 121 223996906
BCT570 116114 178860010
BCT571 7964 17327788
BCT572 32958 53337698
BCT573 29077 252921674
BCT574 6323 285363026
BCT575 5035 225442726
BCT576 3847 224092509
BCT577 1442 273316652
BCT578 109 222593498
BCT579 55 216844860
BCT58 131 218725866
BCT580 70 213822191
BCT581 34 137765382
BCT582 69 224394912
BCT583 364 238323955
BCT584 889 289911825
BCT585 316 85816731
BCT586 1274 200945958
BCT587 525 236859667
BCT588 334 385008990
BCT589 885 295045042
BCT59 108 235209053
BCT590 246 48263407
BCT591 3553 247610579
BCT592 264 301412541
BCT593 334 391121871
BCT594 277 260588329
BCT595 362 393266490
BCT596 364 392445913
BCT597 2040 261413840
BCT598 63 145106063
BCT599 86 222746849
BCT6 2600 37759883
BCT60 128 222344558
BCT600 78 227354684
BCT601 3023 245927078
BCT602 1230 124242115
BCT603 1412 261424764
BCT604 47 241352896
BCT605 45 243003094
BCT606 2180 269716913
BCT607 945 54278114
BCT608 2288 268994820
BCT609 83 274582043
BCT61 66 100806997
BCT610 422 283036369
BCT611 3015 248690235
BCT612 11940 19905132
BCT613 25214 42009145
BCT614 118387 188938630
BCT615 116332 190655157
BCT616 113738 195893591
BCT617 108345 201256356
BCT618 33872 148328153
BCT62 95 230912422
BCT63 117 227983621
BCT64 160 232898310
BCT65 154 221704284
BCT66 128 238275556
BCT67 114 230664549
BCT68 54 123393656
BCT69 300 239582260
BCT7 1310 133308362
BCT70 142 231562727
BCT71 354 225466658
BCT72 111 222896198
BCT73 121 213352666
BCT74 120 227473574
BCT75 98 224926366
BCT76 90 224039666
BCT77 98 225070223
BCT78 58 138528232
BCT79 53 211054879
BCT8 191 234251938
BCT80 45 210584326
BCT81 45 210864282
BCT82 45 212727898
BCT83 76 222861078
BCT84 40 115080869
BCT85 112 227959956
BCT86 129 231316827
BCT87 99 245428056
BCT88 87 223381451
BCT89 59 181990919
BCT9 133 236750743
BCT90 93 237302287
BCT91 103 223843089
BCT92 62 225168570
BCT93 64 140507059
BCT94 97 233623581
BCT95 82 229505918
BCT96 100 238937572
BCT97 24 34605217
BCT98 94 226656782
BCT99 118 229172914
ENV1 189982 141874265
ENV10 19545 17056270
ENV11 204709 124203712
ENV12 186255 146037835
ENV13 209749 130993778
ENV14 180095 144864691
ENV15 792 1061104
ENV16 155460 156526877
ENV17 250294 68810689
ENV18 87156 20071142
ENV19 220965 118700470
ENV2 151517 160013605
ENV20 255779 108833506
ENV21 205134 126660193
ENV22 26671 25205291
ENV23 152294 158746707
ENV24 201147 103382836
ENV25 68253 51341212
ENV26 213319 108924688
ENV27 170956 153787270
ENV28 135008 163683788
ENV29 11531 15710178
ENV3 63439 140667822
ENV30 179951 128304888
ENV31 218066 118482267
ENV32 78472 41726558
ENV33 143993 98017210
ENV34 100658 112291332
ENV35 130549 80386839
ENV36 173945 138872013
ENV37 163506 139639669
ENV38 179124 113959266
ENV39 200966 107312873
ENV4 124 289309588
ENV40 196347 109592401
ENV41 111367 97690861
ENV42 158076 134833905
ENV43 145099 136814475
ENV44 169087 47785088
ENV45 172204 133130908
ENV46 211025 100432240
ENV47 142295 62175813
ENV48 216483 84261105
ENV49 212756 92647921
ENV5 83 221848788
ENV50 108055 43420083
ENV51 224552 98849082
ENV52 224717 91777419
ENV53 142730 92374344
ENV54 198722 110748981
ENV55 182670 90470304
ENV56 194577 111272936
ENV57 27197 16625907
ENV58 127189 186414833
ENV59 217515 132308964
ENV6 56726 201204787
ENV60 227587 99194621
ENV61 56072 24240932
ENV62 194717 112088673
ENV63 125807 173613028
ENV64 66432 229074434
ENV65 112405 148998971
ENV7 182419 143439503
ENV8 218987 102585490
ENV9 176385 159892300
EST1 152690 59075604
EST10 155841 67142647
EST100 152899 76533320
EST101 145152 99334952
EST102 145149 85361933
EST103 148986 93016088
EST104 7162 4190279
EST105 149699 109471588
EST106 135201 99323570
EST107 136256 97451624
EST108 136283 94853528
EST109 2282 1508697
EST11 163597 69202569
EST110 136926 77329920
EST111 176681 106048692
EST112 194369 119409911
EST113 236609 141475405
EST114 6067 3721593
EST115 229453 127643708
EST116 182810 103717899
EST117 191453 94556126
EST118 2649 2084299
EST119 148614 100292951
EST12 150681 64736406
EST120 154741 119123989
EST121 166284 97913480
EST122 21991 15414601
EST123 130039 82535239
EST124 83544 30919856
EST125 36757 12481811
EST126 84106 31034635
EST127 84264 34515269
EST128 33711 11378339
EST129 85031 32709177
EST13 186777 83515959
EST130 82017 34968192
EST131 83454 35266094
EST132 84118 32965334
EST133 14468 5903340
EST134 83460 51063090
EST135 173570 87539089
EST136 170431 77673475
EST137 146496 92416736
EST138 28531 18072078
EST139 141393 87640071
EST14 104664 47795518
EST140 149171 98036966
EST141 157770 78489735
EST142 180951 92631117
EST143 7823 4576718
EST144 141648 76086537
EST145 151601 73213835
EST146 148400 87045489
EST147 155869 83629515
EST148 11556 6814398
EST149 166186 102136895
EST15 197334 111632923
EST150 202211 107329025
EST151 158885 93296243
EST152 102216 51071043
EST153 156473 79478757
EST154 135311 80239330
EST155 141446 88012873
EST156 166518 86082889
EST157 7780 4492262
EST158 179041 104197304
EST159 218733 94431044
EST16 147209 104729060
EST160 145808 85870166
EST161 161461 87658539
EST162 2839 1376204
EST163 140929 82622383
EST164 133075 84139784
EST165 147192 88180032
EST166 146328 80496361
EST167 20005 10132383
EST168 117769 61073260
EST169 115690 61941713
EST17 156572 83431034
EST170 122419 54128062
EST171 121107 48630686
EST172 29423 11431564
EST173 122215 48678047
EST174 125703 48478095
EST175 165762 83297665
EST176 172200 75566620
EST177 24701 15540946
EST178 147743 104364925
EST179 163429 99358064
EST18 191194 116947343
EST180 205284 116217156
EST181 167204 93396394
EST182 154071 103341968
EST183 134240 92949965
EST184 10672 5956502
EST185 146716 94194269
EST186 155040 80987234
EST187 132019 71137821
EST188 160896 90605458
EST189 13087 8271088
EST19 177368 113036622
EST190 148885 87668246
EST191 153770 95507815
EST192 175569 99208167
EST193 140566 77270225
EST194 4786 3936423
EST195 124062 64332278
EST196 163007 91013981
EST197 172951 99439738
EST198 149782 92961023
EST199 5889 3712675
EST2 157294 60515133
EST20 70789 55560490
EST200 165375 79342395
EST201 122406 84452488
EST202 163682 96504049
EST203 163929 95970518
EST204 13454 6450723
EST205 5847 2580354
EST206 111210 63109502
EST207 151265 87144715
EST208 107039 63439290
EST209 164594 101000156
EST21 194467 109200353
EST210 168495 124867785
EST211 82140 66769831
EST212 186419 95122119
EST213 145760 90549919
EST214 86890 65299213
EST215 141968 85245983
EST216 138009 75166331
EST217 95439 30642625
EST218 146951 86298614
EST219 149234 82714699
EST22 179952 92464056
EST220 141191 94332052
EST221 156023 90298582
EST222 8574 6134787
EST223 162088 99653428
EST224 153953 93687394
EST225 123359 88331915
EST226 145963 90179428
EST227 6829 4133477
EST228 129038 82162969
EST229 127971 89758735
EST23 107158 50417911
EST230 44140 31719653
EST231 156430 83332027
EST232 167399 92029681
EST233 166930 92691512
EST234 158124 88082424
EST235 163896 91508682
EST236 163228 92242200
EST237 166033 91294921
EST238 154891 85088026
EST239 168030 90687163
EST24 191027 61406814
EST240 187909 98489047
EST241 191634 107203138
EST242 168058 100162600
EST243 180324 103395206
EST244 190067 112774100
EST245 186285 113280685
EST246 177967 115370161
EST247 6811 5394835
EST248 140684 86233670
EST249 212621 138844284
EST25 136503 39207107
EST250 226920 111313556
EST251 164069 113913134
EST252 183146 95756964
EST253 198080 98535367
EST254 123002 89272028
EST255 7413 5138730
EST256 140264 82389170
EST257 206392 112826286
EST258 162378 106258913
EST259 93841 92696927
EST26 102353 27615294
EST260 15036 19567679
EST261 147677 99225559
EST262 150896 89821420
EST263 139136 101757825
EST264 216533 99416935
EST265 4224 2642412
EST266 133967 96686403
EST267 130697 91301432
EST268 135677 98281222
EST269 113592 81462502
EST27 201416 85202631
EST270 15575 9827231
EST271 136074 84237789
EST272 126197 86196946
EST273 128323 97050498
EST274 35670 25454263
EST275 126736 89458518
EST276 116536 79046724
EST277 139052 83809497
EST278 145796 114766102
EST279 15486 10949090
EST28 19713 8852985
EST280 125388 117381359
EST281 132658 98908640
EST282 162514 97700191
EST283 165607 104413716
EST284 18919 11863137
EST285 142285 92456214
EST286 169004 115153071
EST287 151628 103870677
EST288 136456 103296234
EST289 3255 2122810
EST29 203774 100081169
EST290 159541 97224651
EST291 222464 90719791
EST292 152866 111339910
EST293 160398 71799326
EST294 10551 1193050
EST295 208919 37982085
EST296 212168 83253851
EST297 150194 115334993
EST298 168070 97736830
EST299 154876 103183719
EST3 156026 54734733
EST30 216500 109030037
EST300 169010 109940649
EST301 149577 109937373
EST302 2047 1383922
EST303 180827 102281924
EST304 178602 93097581
EST305 168947 109496172
EST306 158905 104112356
EST307 2301 1836837
EST308 226903 106725089
EST309 267054 116129355
EST31 154031 67130239
EST310 184680 111793289
EST311 150001 28271688
EST312 229941 100513315
EST313 174951 100179604
EST314 156380 99985549
EST315 158607 94448054
EST316 166394 114093378
EST317 179942 95197248
EST318 143687 97189386
EST319 188156 110324042
EST32 149394 63696383
EST320 187330 49206581
EST321 201871 33888691
EST322 174436 95510933
EST323 14493 9111136
EST324 158346 113326097
EST325 184784 110470367
EST326 167585 97771317
EST327 165651 109621930
EST328 165922 71417216
EST329 127843 80161184
EST33 165216 65708059
EST330 121728 80853125
EST331 146532 101245025
EST332 21820 7774986
EST333 250640 26635193
EST334 254708 23392102
EST335 151991 94206454
EST336 152235 98594976
EST337 151209 99840551
EST338 145953 92202538
EST339 237888 43423594
EST34 147093 64544320
EST340 185435 81237426
EST341 3685 4554017
EST342 169100 99903127
EST343 163706 101006058
EST344 145613 92727936
EST345 189908 103388819
EST346 155979 109699810
EST347 153511 101536377
EST348 1951 738181
EST349 184471 108452053
EST35 162621 70872559
EST350 169885 94645837
EST351 169244 105166052
EST352 178323 59608264
EST353 195038 71941256
EST354 194528 75305704
EST355 197065 74426894
EST356 135405 70508640
EST357 174807 127367579
EST358 148414 85118544
EST359 150556 86650597
EST36 160600 65885637
EST360 121920 95273560
EST361 5392 4286510
EST362 143354 94799931
EST363 155559 94494342
EST364 162147 90154220
EST365 157698 100325120
EST366 21937 9729299
EST367 45656 24624838
EST368 155308 104544223
EST369 138149 97255037
EST37 107946 33684188
EST370 158633 102056658
EST371 152663 109858372
EST372 29680 25288248
EST373 173564 146756127
EST374 163564 85431758
EST375 127677 80996734
EST376 137841 94057317
EST377 51157 35811072
EST378 131619 88276056
EST379 137447 89871154
EST38 99513 30489364
EST380 139754 97233001
EST381 147706 97347466
EST382 49930 40332362
EST383 164182 86552371
EST384 143622 81415127
EST385 144915 86073821
EST386 144157 103713157
EST387 155646 93181756
EST388 138127 87591810
EST389 133463 84875714
EST39 99153 31399537
EST390 19252 11819086
EST391 196902 107235645
EST392 137014 75086496
EST393 92962 54579752
EST394 120675 80303449
EST395 23099 14175362
EST396 131518 83245448
EST397 119611 76575368
EST398 147506 80759467
EST399 210530 82593877
EST4 142938 56345501
EST40 98816 29786630
EST400 29795 12545416
EST401 163649 84380495
EST402 163929 99177970
EST403 159177 95841266
EST404 125973 81299685
EST405 12110 7935207
EST406 129506 86704326
EST407 137485 90244511
EST408 178709 111928434
EST409 154288 93122045
EST41 39232 11598976
EST410 27623 12032838
EST411 166658 91952291
EST412 168866 124921438
EST413 87411 56149482
EST414 69678 41105837
EST415 34129 16802261
EST416 137675 80049361
EST417 82268 49325811
EST418 139989 56900987
EST419 148868 30145031
EST42 101326 31351096
EST420 148732 30447487
EST421 163341 80758198
EST422 25882 13994606
EST423 201222 115845880
EST424 237755 108748183
EST425 220133 107470427
EST426 127116 74514400
EST427 128057 85803248
EST428 131704 80409324
EST429 93228 56881081
EST43 102633 36243427
EST430 173975 110008863
EST431 213048 84735872
EST432 106792 28525649
EST433 184615 112690353
EST434 204033 111425634
EST435 179035 105675035
EST436 197423 116761422
EST437 134572 63148204
EST438 110907 60524263
EST439 162601 108614110
EST44 95475 48218258
EST440 181510 116038684
EST441 107719 85697863
EST442 177340 140026994
EST443 150404 90468507
EST444 53805 34233782
EST445 166324 107087931
EST446 178587 101256659
EST447 42327 24215122
EST448 195649 106687564
EST449 185001 94876024
EST45 121121 52335541
EST450 50898 38182739
EST451 189907 115816753
EST452 180028 118006489
EST453 54560 33977145
EST454 196580 133890456
EST455 219858 123775643
EST456 190422 127148411
EST457 183537 144418305
EST458 204235 155997292
EST459 192543 115419803
EST46 55810 33167886
EST460 161348 96638772
EST461 181276 94409195
EST462 6431 534203
EST463 53496 4381716
EST464 158232 12239421
EST465 144975 12987161
EST466 148608 30079541
EST467 149063 29643665
EST468 7062 1471579
EST469 148744 30417064
EST47 177025 89154453
EST470 141959 81858084
EST471 172661 101046443
EST472 161391 110665984
EST473 16966 12151339
EST474 160836 92812053
EST475 150646 104117270
EST476 133686 93217512
EST477 141793 98142132
EST478 16191 8329086
EST479 157292 103614424
EST48 158153 65086282
EST480 146182 105140040
EST481 161997 97559167
EST482 165869 51067765
EST483 12180 1915318
EST484 160517 40369185
EST485 150819 102163312
EST486 146729 96566962
EST487 170976 112381796
EST488 21619 11699355
EST489 132815 75920561
EST49 162318 92154710
EST490 189716 107933724
EST491 149560 109195909
EST492 53159 36076492
EST493 126855 87064282
EST494 145595 90241943
EST495 148613 89442242
EST496 163476 89081452
EST497 35400 18041209
EST498 151814 92135788
EST499 156202 92091621
EST5 162084 62609780
EST50 154341 80228818
EST500 168425 102012593
EST501 136536 85668660
EST502 15350 8547242
EST503 100266 71178650
EST504 78634 60627274
EST505 97503 64771452
EST506 143451 80482502
EST507 37110 21164449
EST508 120991 73607128
EST509 133540 87501358
EST51 156445 74826582
EST510 135322 79345359
EST511 152640 93049299
EST512 45269 24976637
EST513 155676 85797389
EST514 184723 110532846
EST515 121351 79440998
EST516 178209 94678139
EST517 4744 1765241
EST518 52576 18674859
EST519 183237 101007675
EST52 108164 61167975
EST520 152141 81353891
EST521 22392 13552682
EST522 162316 94446797
EST523 211757 123975299
EST524 29664 19024876
EST525 147952 99622109
EST526 158950 98067836
EST527 134285 87369716
EST528 128632 87802109
EST529 25677 16070670
EST53 153907 88947354
EST530 179560 74468277
EST531 179107 79600078
EST532 198743 83525888
EST533 194767 80466936
EST534 3410 1187658
EST535 178841 95307232
EST536 174407 102458892
EST537 180222 107874027
EST538 171896 103671986
EST539 196694 126517090
EST54 154270 84992271
EST540 186186 103334429
EST541 178871 82793643
EST542 146545 93615771
EST543 206771 125126638
EST544 205624 126733200
EST545 188949 108252864
EST546 208319 121337435
EST547 34072 17688009
EST548 154069 96424819
EST549 187947 117401871
EST55 152206 92261410
EST550 166655 99004821
EST551 133842 98225388
EST552 8915 7253109
EST553 157240 92159075
EST554 170464 84942643
EST555 149142 85090487
EST556 151163 81932683
EST557 11887 7106830
EST558 156509 79978871
EST559 181332 106377437
EST56 149952 69903188
EST560 162525 103083912
EST561 175334 108140837
EST562 3319 2235249
EST563 170744 117107232
EST564 183919 113640256
EST565 129041 83663044
EST566 169422 97775191
EST567 184830 110562150
EST568 35644 23280009
EST569 204465 119127975
EST57 142206 76733001
EST570 269500 91747576
EST571 25706 9441749
EST572 262208 83553217
EST573 157826 57585734
EST574 162309 59136881
EST575 80787 30881203
EST58 151707 83210662
EST59 161195 65790882
EST6 166268 65037604
EST60 144548 70120281
EST61 160487 90001957
EST62 150445 92626088
EST63 150092 99324635
EST64 157737 94526535
EST65 2378 988789
EST66 154805 103452156
EST67 163010 82998212
EST68 166574 84865226
EST69 142254 77775859
EST7 163878 67752199
EST70 148470 82575386
EST71 149056 86144200
EST72 148552 92243283
EST73 150768 87593799
EST74 2764 1628510
EST75 29919 18235506
EST76 186707 102811942
EST77 170458 90758531
EST78 212600 115717827
EST79 179457 103369706
EST8 160928 67797250
EST80 2123 1442005
EST81 196745 121640362
EST82 167573 93355391
EST83 136139 63338951
EST84 128109 62643019
EST85 10989 5630830
EST86 150357 92609118
EST87 154646 96984272
EST88 130214 66325611
EST89 140263 89342805
EST9 169418 69380160
EST90 14381 7458009
EST91 183467 91897835
EST92 204535 119856010
EST93 202005 107978679
EST94 192020 90402851
EST95 204070 87102143
EST96 145888 86970139
EST97 137848 84899384
EST98 158609 76440268
EST99 9280 6073374
GSS1 172832 126575132
GSS10 15031 14508319
GSS100 169231 144356515
GSS101 157749 108935751
GSS102 155985 106347536
GSS103 152502 105561845
GSS104 168005 122783070
GSS105 149804 126570500
GSS106 162066 125204781
GSS107 186623 116025316
GSS108 16058 9820533
GSS109 185735 119778325
GSS11 146486 107079660
GSS110 201336 103953762
GSS111 219954 124091627
GSS112 87417 56990793
GSS113 152238 114271565
GSS114 155173 118809397
GSS115 155139 118869811
GSS116 163366 106680649
GSS117 37173 21505622
GSS118 179780 132238950
GSS119 189809 117152112
GSS12 200826 104101140
GSS120 166036 55081336
GSS121 169957 76572607
GSS122 2295 1480054
GSS123 161723 105208392
GSS124 189169 124964186
GSS125 200745 81604444
GSS126 167188 79936559
GSS127 137268 94431217
GSS128 129855 104605133
GSS129 132043 108777560
GSS13 192063 84600595
GSS130 132451 106048276
GSS131 8056 5958858
GSS132 135214 112032054
GSS133 56598 47104660
GSS134 132584 107786768
GSS135 139149 116140565
GSS136 140043 114408742
GSS137 138251 109584898
GSS138 4155 2820771
GSS139 134784 106426486
GSS14 173281 89251824
GSS140 134049 108003847
GSS141 134400 111531585
GSS142 138188 116474348
GSS143 4675 3643453
GSS144 139468 108106612
GSS145 136810 113648547
GSS146 136898 113473892
GSS147 137299 112649085
GSS148 559 466085
GSS149 137155 110923756
GSS15 167983 83930679
GSS150 134480 106278327
GSS151 133002 107665198
GSS152 138659 116136290
GSS153 1985 1674795
GSS154 127182 92203837
GSS155 174080 105026233
GSS156 184513 110133142
GSS157 162402 108639012
GSS158 177431 102440455
GSS159 197022 129307000
GSS16 160060 81615096
GSS160 201458 133365835
GSS161 200723 134048006
GSS162 179465 125486286
GSS163 198341 136948587
GSS164 196713 139067120
GSS165 196065 138672070
GSS166 174298 134353538
GSS167 144587 97412907
GSS168 138114 80517957
GSS169 165347 73456578
GSS17 156174 85673627
GSS170 130087 57900795
GSS171 163014 141019316
GSS172 170950 113527672
GSS173 80812 52920567
GSS174 191881 129015715
GSS175 196554 117983862
GSS176 28456 14940540
GSS177 180225 98140530
GSS178 181302 123365801
GSS179 178800 126906476
GSS18 152981 95677320
GSS180 181098 127179984
GSS181 19114 12799890
GSS182 165902 130533276
GSS183 170977 155597399
GSS184 219919 123799690
GSS185 216581 103401654
GSS186 17290 8049466
GSS187 210015 95106166
GSS188 156568 134374532
GSS189 6818 6760628
GSS19 153707 72745819
GSS190 125540 102753347
GSS191 122235 93469471
GSS192 156847 154495780
GSS193 167720 158232911
GSS194 131396 104305071
GSS195 149360 107958474
GSS196 170325 141788280
GSS197 174263 119970230
GSS198 20136 11688868
GSS199 181316 133971324
GSS2 173589 107819358
GSS20 106546 59105521
GSS200 184910 120116892
GSS201 180127 93029592
GSS202 172829 121726073
GSS203 189216 117024741
GSS204 189414 116726891
GSS205 21729 12651457
GSS206 200615 129990067
GSS207 215712 142629172
GSS208 217635 140382802
GSS209 166429 136402995
GSS21 132536 64638951
GSS210 152472 108704003
GSS211 159985 120581373
GSS212 160039 145459792
GSS213 158444 140404489
GSS214 160859 145750229
GSS215 162431 144534355
GSS216 163049 142910892
GSS217 159417 122903915
GSS218 168345 139695448
GSS219 161743 115993986
GSS22 125191 56725897
GSS220 180530 88689585
GSS221 2575 1768585
GSS222 251369 52150506
GSS223 262481 40466091
GSS224 262523 40408947
GSS225 122800 38229504
GSS226 253355 52912344
GSS227 182565 86129448
GSS228 188825 55952994
GSS229 154339 118463226
GSS23 134196 73094577
GSS230 177033 144334259
GSS231 160568 145787944
GSS232 159531 147010793
GSS233 174549 109955224
GSS234 238210 57319690
GSS235 198151 101373468
GSS236 229423 39758510
GSS237 119094 74590504
GSS238 174029 112048984
GSS239 147861 90042086
GSS24 143035 74371292
GSS240 140661 84073818
GSS241 159796 149652844
GSS242 5899 5023719
GSS243 112668 95722541
GSS244 180351 149222837
GSS245 172954 122407496
GSS246 201906 127716652
GSS247 188210 120275961
GSS248 166175 94403497
GSS249 159873 84506384
GSS25 12092 5172754
GSS250 156433 119872540
GSS251 203514 148104443
GSS252 14298 9398581
GSS253 171523 67875770
GSS254 176683 96454754
GSS255 195475 152072364
GSS256 199776 154504000
GSS257 7495 6183699
GSS258 197813 157229673
GSS259 197524 124135901
GSS26 140902 65659537
GSS260 194959 142650302
GSS261 611 422080
GSS262 214911 131530338
GSS263 189958 57638710
GSS264 218598 111928830
GSS265 170488 153872948
GSS266 163848 150141940
GSS267 234900 132469628
GSS268 240183 119740511
GSS27 159863 79841194
GSS28 156780 92817384
GSS29 165484 85429638
GSS3 138093 115755641
GSS30 9311 4809210
GSS31 171978 102877480
GSS32 182794 109078835
GSS33 182356 87082611
GSS34 172894 102149372
GSS35 191042 104301903
GSS36 162180 112295088
GSS37 160410 98257518
GSS38 173347 108755067
GSS39 3659 2625600
GSS4 140176 112446360
GSS40 183985 122974505
GSS41 181701 117299100
GSS42 52326 27358639
GSS43 177824 102907428
GSS44 164532 141986785
GSS45 179635 148566932
GSS46 139666 92482471
GSS47 182857 132009511
GSS48 181604 114543954
GSS49 204426 116967818
GSS5 11600 8663177
GSS50 185612 99477863
GSS51 211954 108037045
GSS52 211747 108318359
GSS53 197315 132797049
GSS54 158211 124808059
GSS55 185583 139405028
GSS56 196775 63137269
GSS57 171822 96460264
GSS58 157621 106112242
GSS59 23373 13575160
GSS6 152749 116375726
GSS60 166616 156645100
GSS61 177157 98801574
GSS62 161196 115202462
GSS63 172331 112351434
GSS64 175440 118752155
GSS65 184542 127842865
GSS66 205677 128792596
GSS67 188166 112096806
GSS68 200686 134224634
GSS69 215702 158336970
GSS7 170814 119984140
GSS70 189038 138024221
GSS71 173742 107642623
GSS72 198219 111980277
GSS73 140725 76414851
GSS74 163079 95884017
GSS75 10697 6814502
GSS76 159270 97756741
GSS77 159481 96970229
GSS78 172285 114351414
GSS79 170749 109399099
GSS8 177134 108918276
GSS80 174370 122402741
GSS81 188875 105213057
GSS82 174789 125779909
GSS83 164306 106587290
GSS84 1781 1416018
GSS85 189251 108546104
GSS86 180972 113844730
GSS87 167306 118213440
GSS88 193311 106231618
GSS89 8529 4931343
GSS9 141921 118720680
GSS90 213831 107550639
GSS91 227222 89202095
GSS92 213483 139456408
GSS93 182686 91963194
GSS94 94686 37020965
GSS95 193805 75823638
GSS96 201086 123394316
GSS97 191020 122180795
GSS98 156116 139401502
GSS99 16660 10968419
HTC1 41206 63404125
HTC2 32318 72275691
HTC3 32080 77890442
HTC4 84836 50647832
HTC5 129804 161467165
HTC6 124984 122830042
HTC7 137623 130766468
HTC8 65123 58080365
HTG1 3784 374870703
HTG10 2848 363016285
HTG11 1976 365940103
HTG12 1714 382089084
HTG13 1718 381796340
HTG14 1659 383118453
HTG15 1835 380424998
HTG16 1750 361896240
HTG17 1843 380599315
HTG18 1752 382301790
HTG19 1775 381824019
HTG2 5068 373604329
HTG20 1891 380883515
HTG21 2135 355865123
HTG22 2426 376351102
HTG23 2269 379507879
HTG24 2442 381163865
HTG25 2175 382733656
HTG26 2070 368006459
HTG27 2074 380458182
HTG28 2061 380108509
HTG29 1047 202962639
HTG3 2556 370662362
HTG30 2040 379446758
HTG31 2203 375546591
HTG32 986 170706729
HTG33 2152 379221269
HTG34 2348 376393195
HTG35 1372 195850538
HTG36 2462 370234045
HTG37 2428 372528369
HTG38 1015 169191937
HTG39 2235 381490266
HTG4 2735 369989641
HTG40 2336 385145188
HTG41 1069 180930974
HTG42 2312 384776536
HTG43 2363 384490832
HTG44 906 155597869
HTG45 2500 379735659
HTG46 2319 385244375
HTG47 927 158722850
HTG48 2315 385567657
HTG49 2293 386023883
HTG5 2500 373389217
HTG50 900 149450476
HTG51 2237 385154833
HTG52 2106 380011723
HTG53 657 122585305
HTG54 2010 379525743
HTG55 1981 378955508
HTG56 1184 193581815
HTG57 2144 380658486
HTG58 2686 383430148
HTG59 2973 383248998
HTG6 2 386956
HTG60 884 128257683
HTG61 2959 380503057
HTG62 3012 366231486
HTG63 2990 372824610
HTG64 2953 336850403
HTG65 3178 359117111
HTG66 3179 359260560
HTG67 3186 360427818
HTG68 3128 367889098
HTG69 2913 377859052
HTG7 2327 375791086
HTG70 1846 312468258
HTG71 3415 365492036
HTG72 2071 381329139
HTG73 1668 298160154
HTG74 2088 382520375
HTG75 2244 384445864
HTG76 1669 296247510
HTG77 2201 385233869
HTG78 2249 384504439
HTG79 3219 384192102
HTG8 1500 384347777
HTG80 2166 384708164
HTG81 3033 373087380
HTG82 2044 207008446
HTG9 1582 384062276
INV1 154213 140639721
INV10 14 359428768
INV100 148923 103605729
INV101 152253 116440406
INV102 121665 83580022
INV103 154949 113622841
INV104 153641 120507385
INV105 53927 36012665
INV106 152803 109377871
INV107 153466 115498141
INV108 37192 32116114
INV109 141587 88517670
INV11 9 363281720
INV110 147784 93673501
INV111 43730 33354210
INV112 148087 97240627
INV113 139033 81414890
INV114 43138 25569956
INV115 138172 82626501
INV116 137815 82617077
INV117 54033 35677668
INV118 138822 83290089
INV119 135279 98800721
INV12 52 355336707
INV120 75073 58783223
INV121 141356 108604909
INV122 151054 120538131
INV123 156080 118319015
INV124 106390 233364050
INV125 183035 236941459
INV126 216228 165877386
INV127 38629 187147326
INV128 800 42674647
INV129 566 40635863
INV13 14 371434550
INV130 8037 115580217
INV131 23329 332915377
INV132 23255 171962006
INV133 68041 305365919
INV134 123287 266863020
INV135 64375 76908791
INV136 180571 237306452
INV137 41592 302727004
INV138 315 394021049
INV139 1012 100307854
INV14 78 134821644
INV140 2002 383526849
INV141 2 41011863
INV142 560 361609998
INV143 8 378508614
INV144 900 354220506
INV145 6 380479040
INV146 2 95552909
INV147 22 390382246
INV148 10036 362338941
INV149 376 367082002
INV15 6 384224499
INV150 3415 40188607
INV151 1 685423969
INV152 1 640667275
INV153 1 639123876
INV154 1 612949391
INV155 1 577192767
INV156 1 641629864
INV157 492 320919431
INV158 2 371500015
INV159 2 289902239
INV16 16 393880512
INV160 2965 358959205
INV161 59277 333080486
INV162 34 383065485
INV163 19 393344928
INV164 14 327270017
INV165 27 393651567
INV166 32 390738662
INV167 24 383706785
INV168 25 382049854
INV169 31 378115211
INV17 27 342153446
INV170 13 297748085
INV171 18 387848160
INV172 24 381271345
INV173 36 390867092
INV174 34 389743485
INV175 26 391141334
INV176 19 292893418
INV177 11 371260264
INV178 19 391738068
INV179 12 391781067
INV18 4 251686535
INV180 13 372901688
INV181 32 389502837
INV182 22 330411078
INV183 29 389284847
INV184 38 387663367
INV185 17 367589223
INV186 12 387517245
INV187 17 362786034
INV188 10 320557524
INV189 13 376469258
INV19 3 241225934
INV190 35 380323776
INV191 26 392110963
INV192 24 388964019
INV193 21 391745060
INV194 22 309540561
INV195 27 392282931
INV196 24 388632304
INV197 12 375724207
INV198 16 393313708
INV199 13 392068811
INV2 2288 315894747
INV20 3 393880593
INV200 10 277290815
INV201 15 358735036
INV202 11 386907833
INV203 16 377160071
INV204 21 392427759
INV205 5 215849302
INV206 15 382505853
INV207 743 382889760
INV208 26 386022184
INV209 28 394591284
INV21 3 261336042
INV210 7 307846652
INV211 4 182170525
INV212 2 342421305
INV213 2 269826459
INV214 18 385786230
INV215 1901 346423963
INV216 8858 319015069
INV217 11615 311682508
INV218 29288 83527942
INV219 148898 105777559
INV22 3 322765503
INV220 152686 93799413
INV221 80678 46904904
INV222 151221 93779787
INV223 151137 109865333
INV224 59221 50140394
INV225 151930 123394740
INV226 150264 121519804
INV227 151555 114814407
INV228 146908 121788199
INV229 114669 131386392
INV23 2 265971290
INV230 129052 156061174
INV231 1696 379941558
INV232 5261 374508091
INV233 169908 277278675
INV234 144287 271976701
INV235 59037 179152127
INV236 104213 292697254
INV237 28749 364829410
INV238 1766 378350697
INV239 2736 196647685
INV24 4 328757598
INV240 184144 268358078
INV241 1785 378880292
INV242 5583 374469857
INV243 20768 153711624
INV244 288223 205808194
INV245 1224 379793465
INV246 4515 373876603
INV247 92490 210334617
INV248 391527 140904810
INV249 109733 258294965
INV25 5 378753109
INV250 62463 308727005
INV251 4162 375136162
INV252 44629 350112618
INV253 2155 4626806
INV254 298725 199657065
INV255 214334 249067665
INV256 2226 377046597
INV257 19303 366955288
INV258 16948 41978773
INV259 298391 186889508
INV26 5 371191486
INV260 1355 379516794
INV261 3687 378313727
INV262 136930 300095839
INV263 38349 357698579
INV264 664 92151452
INV265 8529 370827851
INV266 197744 256830145
INV267 359558 128682792
INV268 93023 322972837
INV269 2568 378355489
INV27 4 376987297
INV270 61847 343439542
INV271 90786 334144382
INV272 8 106686795
INV273 15 379655485
INV274 6 355188453
INV275 1 239744465
INV276 1 231634122
INV277 1 221096292
INV278 1 220877407
INV279 1 216720617
INV28 4 293537168
INV280 1 210676062
INV281 2 387811394
INV282 2 329972158
INV283 2 302384449
INV284 20 360081608
INV285 9 301825222
INV286 23 382490317
INV287 23 380735444
INV288 18 387931948
INV289 33 390736486
INV29 4 373434888
INV290 63 380672086
INV291 20 391287680
INV292 2 32244328
INV293 27 388830496
INV294 21 386972019
INV295 9 351834369
INV296 5 163634948
INV297 1 292306469
INV298 2 327510524
INV299 17814 363918680
INV3 104823 182030209
INV30 14820 369675866
INV300 2865 36690115
INV31 138253 111653201
INV32 167285 134314161
INV33 126778 112361282
INV34 37136 273256295
INV35 2779 371575686
INV36 44 370097852
INV37 24 379270378
INV38 5 76533839
INV39 32 391299062
INV4 59170 272948680
INV40 25 362900281
INV41 18 380479131
INV42 19 390062857
INV43 5 134896453
INV44 18 373966012
INV45 24 386582132
INV46 8 380395300
INV47 19 379365223
INV48 9 138772803
INV49 28 391443577
INV5 37248 75696691
INV50 28 392100242
INV51 45 382097969
INV52 27 372689565
INV53 18 385206419
INV54 12 373566826
INV55 1 94407144
INV56 15 381614547
INV57 29 387067226
INV58 25 384930048
INV59 18 381070342
INV6 129081 165754942
INV60 96947 235213430
INV61 124195 97152909
INV62 28932 325602710
INV63 28932 340987430
INV64 26 389137258
INV65 14 387214037
INV66 20 342291921
INV67 34 391108664
INV68 71 392017627
INV69 24 388974367
INV7 207 346774014
INV70 21 381982755
INV71 20 377528210
INV72 24 388990901
INV73 29 394663938
INV74 27 393364049
INV75 23 381713426
INV76 134 350713408
INV77 4 381900476
INV78 24 389620287
INV79 33 393229173
INV8 85 322154899
INV80 9 344807465
INV81 23 323415557
INV82 32 372768847
INV83 20 384741007
INV84 25 385708546
INV85 29 388680045
INV86 22 323658394
INV87 25 386606940
INV88 22 384360764
INV89 22 375170777
INV9 3 136766944
INV90 31 394116451
INV91 20 281624502
INV92 11 364532943
INV93 14 378464462
INV94 38 390437780
INV95 20 259303673
INV96 35 382133951
INV97 38988 329161302
INV98 150717 102221541
INV99 32584 23402133
MAM1 32388 323882267
MAM10 26814 24994146
MAM11 13731 20581276
MAM12 3445 7368868
MAM13 107 699953
MAM14 20 277696380
MAM15 1 249270926
MAM16 2 343930246
MAM17 3 325384739
MAM18 1 90795278
MAM19 4 322903327
MAM2 22252 277073294
MAM20 4 298795355
MAM21 6 353843759
MAM22 5 329700903
MAM23 2 289079565
MAM24 3 348530310
MAM25 4 336581445
MAM26 5 375256260
MAM27 6 373952570
MAM28 8 377813420
MAM29 5 379300313
MAM3 2 316219032
MAM30 1 38035513
MAM31 5 285741626
MAM32 5 342804543
MAM33 8 370485433
MAM34 6 316655225
MAM35 4 238884849
MAM36 4 355768297
MAM37 6 355037276
MAM38 7 389945117
MAM39 6 319172640
MAM4 2 376685399
MAM40 5 323047396
MAM41 4 347221982
MAM42 5 288444151
MAM43 5 375232988
MAM44 5 248962388
MAM45 1 277956744
MAM46 1 154038104
MAM47 3 374028897
MAM48 2 298256496
MAM49 3 355148320
MAM5 2 295769989
MAM50 3 355658200
MAM51 3 369352591
MAM52 13 295784090
MAM53 54 7614329
MAM54 215 34073042
MAM55 431 71272130
MAM56 861 68509101
MAM57 1706 2411269
MAM58 6836 6159435
MAM59 110526 193401624
MAM6 2 385026516
MAM60 33096 281546482
MAM61 4 358286156
MAM62 5 387739617
MAM63 5 335893012
MAM64 6 364021592
MAM65 6 304412506
MAM66 10 386743576
MAM67 132616 153995056
MAM68 117949 169598879
MAM69 5091 4198007
MAM7 3 316699161
MAM70 1 716413629
MAM71 1 662751787
MAM72 1 611347268
MAM73 1 464895054
MAM74 1 288121652
MAM75 3 338107697
MAM76 1 223449203
MAM77 1 210645437
MAM78 1 201318998
MAM79 1 197708286
MAM8 5 343489620
MAM80 2 320231256
MAM81 2 293750401
MAM82 3 367535284
MAM83 4 351244600
MAM84 367 269065793
MAM85 1 203623556
MAM86 2 383513587
MAM87 4 383666147
MAM88 5 381503248
MAM89 1376 392320615
MAM9 933 216317382
MAM90 68888 268152155
MAM91 62397 78832420
PAT1 420075 157365338
PAT10 304138 130867531
PAT100 352852 189327041
PAT101 310862 206556098
PAT102 261889 226571161
PAT103 130469 96637053
PAT104 304402 217824161
PAT105 276793 236021165
PAT106 255575 243191966
PAT107 219302 91982645
PAT108 185522 168147091
PAT109 194742 145575468
PAT11 235970 217004517
PAT110 98134 56007996
PAT111 244010 110313663
PAT112 143100 226369725
PAT113 78463 27201918
PAT114 88276 271848496
PAT115 224854 124891051
PAT116 225592 104829687
PAT117 1426 4487182
PAT118 247765 75673289
PAT119 230776 33741646
PAT12 83511 75759050
PAT120 94886 123403652
PAT121 98574 119749391
PAT122 81936 115812708
PAT123 203202 107726655
PAT124 26050 9049830
PAT125 203753 100524714
PAT126 183498 80758866
PAT127 117398 19496465
PAT128 249613 208803486
PAT129 386162 114645759
PAT13 242994 211781414
PAT130 52454 7540548
PAT131 283984 180114539
PAT132 123559 298380740
PAT133 110196 303228342
PAT134 393173 122391607
PAT135 290833 158921442
PAT136 12495 8413579
PAT137 287141 182646284
PAT138 409360 14039521
PAT139 496812 33315384
PAT14 328307 148441313
PAT140 525210 7878150
PAT141 153458 3896573
PAT142 377415 123797918
PAT143 245707 106305353
PAT144 259895 238802744
PAT145 4634 392128968
PAT146 190899 207809354
PAT147 308470 120437803
PAT148 140527 153752459
PAT149 6431 91694678
PAT15 63699 1592475
PAT150 177885 181303248
PAT151 71548 185117089
PAT152 75797 115786083
PAT153 75754 115775734
PAT154 46229 38674255
PAT155 245585 68642488
PAT156 201628 63082013
PAT157 264567 57807478
PAT158 309586 83974322
PAT159 458728 54677701
PAT16 197482 165318298
PAT160 227775 118065838
PAT161 360553 132694979
PAT162 287883 50230249
PAT163 154055 4622328
PAT164 229227 77275728
PAT165 228121 72916652
PAT166 281284 18699015
PAT167 64337 7031178
PAT168 153383 170227500
PAT169 73417 134980723
PAT17 217865 141822851
PAT170 74139 123431457
PAT171 137229 84274353
PAT172 175192 2627880
PAT173 234159 99508566
PAT174 198443 145137226
PAT175 229727 110397994
PAT176 105069 67821574
PAT177 80124 122466507
PAT178 260802 46024555
PAT179 294811 4422165
PAT18 217787 104554456
PAT180 7780 116700
PAT181 278538 10765362
PAT182 99590 135915739
PAT183 220910 105875731
PAT184 23917 35278529
PAT185 143999 206566501
PAT186 173285 186742155
PAT187 70129 243259642
PAT188 6542 8869371
PAT189 137168 133366031
PAT19 238917 105580979
PAT190 136594 204924247
PAT191 208576 98959256
PAT192 284105 31395234
PAT193 26278 42269468
PAT194 264589 66935450
PAT195 227269 82111943
PAT196 179588 5746816
PAT197 194343 81150933
PAT198 52350 9088688
PAT199 82690 146051882
PAT2 329685 203025907
PAT20 217523 131791327
PAT200 75930 116106222
PAT201 76058 115438165
PAT202 205771 85563217
PAT203 2801 56020
PAT204 342231 6844620
PAT205 341891 7168782
PAT206 341071 7503562
PAT207 331154 110021550
PAT208 268658 230373189
PAT209 282624 222310160
PAT21 295515 53574820
PAT210 192664 139614235
PAT211 276098 235021090
PAT212 188385 291326630
PAT213 137484 196232251
PAT214 247191 246690030
PAT215 11728 387687504
PAT216 313354 152356909
PAT217 244602 252477336
PAT218 160029 300870611
PAT219 215545 135077252
PAT22 146923 94671628
PAT220 172971 290885692
PAT221 266015 215701541
PAT222 378431 123918618
PAT223 187428 61523062
PAT224 317818 206630332
PAT225 43590 365712261
PAT226 151381 180550783
PAT227 338212 193787787
PAT228 332520 206353769
PAT229 271383 152908605
PAT23 196051 155681695
PAT230 34983 121046321
PAT24 279824 73243728
PAT25 228203 147460861
PAT26 209295 140218597
PAT27 62580 53901225
PAT28 304662 206975876
PAT29 321045 202870000
PAT3 50177 20258842
PAT30 69609 127456994
PAT31 217213 274043600
PAT32 399532 38379558
PAT33 255755 169052451
PAT34 232479 137934297
PAT35 62201 29247676
PAT36 159610 193120910
PAT37 187244 152014323
PAT38 212001 134509397
PAT39 97874 9820233
PAT4 329516 180387112
PAT40 349668 21562100
PAT41 269131 102155190
PAT42 166 390395449
PAT43 7285 386170321
PAT44 91553 5256860
PAT45 304606 19422510
PAT46 304621 19407682
PAT47 188163 183525476
PAT48 31132 33395968
PAT49 100021 274296388
PAT5 261932 200082729
PAT50 347914 22045690
PAT51 356635 6776065
PAT52 92431 1756189
PAT53 351487 15876250
PAT54 360979 6858601
PAT55 133552 2537488
PAT56 360626 6851894
PAT57 359974 6839506
PAT58 125418 2711844
PAT59 535700 100616524
PAT6 217637 164402035
PAT60 111356 330233433
PAT61 289774 158820679
PAT62 481510 50384146
PAT63 225628 89296979
PAT64 254564 194652862
PAT65 328374 204069679
PAT66 171716 140675490
PAT67 349862 190728733
PAT68 612603 75778089
PAT69 132887 40797313
PAT7 247422 122522282
PAT70 484033 127126269
PAT71 126354 109119371
PAT72 150168 307250321
PAT73 318626 211710240
PAT74 51881 214846609
PAT75 189165 289007376
PAT76 317843 207880789
PAT77 123868 129694058
PAT78 342751 192409991
PAT79 362616 180214431
PAT8 224289 103129364
PAT80 20467 17346132
PAT81 311143 212599739
PAT82 414691 138165335
PAT83 481329 57361173
PAT84 327289 49350302
PAT85 456880 82648416
PAT86 157574 115871211
PAT87 167204 186356802
PAT88 316210 151191469
PAT89 224186 179615888
PAT9 153307 78034966
PAT90 160872 40093839
PAT91 548289 10417491
PAT92 499577 9491963
PAT93 509422 32511534
PAT94 211221 45759082
PAT95 257687 203232161
PAT96 388300 141392321
PAT97 39461 44145288
PAT98 361773 186862184
PAT99 415062 154422395
PHG1 8922 216147941
PHG2 4545 220995425
PHG3 5285 216214852
PHG4 3566 224200370
PHG5 840 23253682
PLN1 135075 172330816
PLN10 18921 157294990
PLN100 60 390510712
PLN101 8 357693623
PLN102 6 351635285
PLN103 12 293471641
PLN104 78 341267500
PLN105 130 325254839
PLN106 127 374275132
PLN107 90 183523907
PLN108 196 355571810
PLN109 128 334405244
PLN11 29377 278503063
PLN110 35 366667162
PLN111 27 301682430
PLN112 37 16871
PLN113 149 79314
PLN114 2469 93786416
PLN115 7181 18795412
PLN116 14346 29953091
PLN117 97724 209408903
PLN118 129423 90008692
PLN119 159024 148267057
PLN12 2658 334144218
PLN120 162828 146545918
PLN121 57541 31435462
PLN122 181658 125729890
PLN123 49813 254579796
PLN124 41637 287857567
PLN125 71572 108647327
PLN126 98644 85504671
PLN127 49729 72847341
PLN128 25061 110565816
PLN129 13561 89764040
PLN13 37 329935405
PLN130 1 774434471
PLN131 8305 28494037
PLN132 1861 361385154
PLN133 5 372618381
PLN134 6 372447772
PLN135 6 368295254
PLN136 2 132503639
PLN137 425 311696501
PLN138 8 327823341
PLN139 6 343447962
PLN14 46 124218893
PLN140 1 66465249
PLN141 1 474651383
PLN142 1 612216829
PLN143 1 571018318
PLN144 1 574020038
PLN145 1 538550714
PLN146 1 514282554
PLN147 1 575541767
PLN148 122 335982221
PLN149 12211 142194234
PLN15 9 366014477
PLN150 175257 124235493
PLN151 23661 15778956
PLN152 148446 156345077
PLN153 149695 145704209
PLN154 86479 71741269
PLN155 154427 132979189
PLN156 164106 118616915
PLN157 24028 26415389
PLN158 147685 134501640
PLN159 125626 155882241
PLN16 2395 340580897
PLN160 167305 121798695
PLN161 116021 120540364
PLN162 134597 149654232
PLN163 102156 121612353
PLN164 135911 149983463
PLN165 126573 163285563
PLN166 120559 166541099
PLN167 20001 17989571
PLN168 124481 164290084
PLN169 112945 173236208
PLN17 1949 233857567
PLN170 85667 158041086
PLN171 119317 172044715
PLN172 104769 189946304
PLN173 12304 324245889
PLN174 18878 172715970
PLN175 19737 363518883
PLN176 10232 333664247
PLN177 302 288936846
PLN178 5 324373291
PLN179 1461 370188698
PLN18 3 330514248
PLN180 1432 1403557
PLN181 1370 386993708
PLN182 8 179149947
PLN183 943 232082587
PLN184 1 522466905
PLN185 1 675310294
PLN186 1 628753756
PLN187 1 624247919
PLN188 1 599018945
PLN189 1 573247234
PLN19 37 346663474
PLN190 1 634667502
PLN191 8478 149585073
PLN192 1 727344967
PLN193 1 946003158
PLN194 1 965754312
PLN195 1 906459801
PLN196 1 876148008
PLN197 1 885153844
PLN198 1 899925126
PLN199 1 528437893
PLN2 39504 282972265
PLN20 19710 29586755
PLN200 4094 344330287
PLN201 10 362580157
PLN202 4 120184706
PLN203 129 363593727
PLN204 404 366581476
PLN205 9 335385998
PLN206 129 308977457
PLN207 2 317663561
PLN208 1 192140685
PLN209 1 279860179
PLN21 96587 101384517
PLN210 1 259520967
PLN211 2 294703259
PLN212 1 238633233
PLN213 1 162496318
PLN214 1 420743833
PLN215 205 92200346
PLN216 16 383095167
PLN217 32 120825431
PLN218 1 541700351
PLN219 1 696809892
PLN22 113432 117615216
PLN220 1 655542733
PLN221 1 648987779
PLN222 1 622068216
PLN223 1 583456046
PLN224 1 654005093
PLN225 130 298375
PLN226 1 522466905
PLN227 1 675310294
PLN228 1 628753756
PLN229 1 624247919
PLN23 57311 72144580
PLN230 1 599018945
PLN231 1 573247234
PLN232 1 634667502
PLN233 313 95007523
PLN234 1 521073757
PLN235 1 672273650
PLN236 1 634137895
PLN237 1 624121443
PLN238 1 607506942
PLN239 1 564293627
PLN24 28689 28922869
PLN240 1 632401812
PLN241 1 520603772
PLN242 1 661076038
PLN243 1 626572591
PLN244 1 612852138
PLN245 1 598896166
PLN246 1 570629545
PLN247 1 623813090
PLN248 1 513014082
PLN249 1 653624577
PLN25 2648 194594881
PLN250 1 616219606
PLN251 1 610044819
PLN252 1 583417444
PLN253 1 550735148
PLN254 1 620104558
PLN255 1 523168208
PLN256 1 671211297
PLN257 1 630677708
PLN258 1 623428415
PLN259 1 604298040
PLN26 344 254550430
PLN260 1 558526623
PLN261 1 628419988
PLN262 1 500012378
PLN263 1 648922534
PLN264 1 604770208
PLN265 1 597403059
PLN266 1 576456374
PLN267 1 556080982
PLN268 1 603311816
PLN269 1 512023576
PLN27 400 261235914
PLN270 1 652551272
PLN271 1 615767531
PLN272 1 605571303
PLN273 1 592249714
PLN274 1 549757368
PLN275 1 616509610
PLN276 1 550024188
PLN277 1 710194481
PLN278 1 661081403
PLN279 1 659460550
PLN28 198 168828441
PLN280 1 630572514
PLN281 1 598618390
PLN282 1 658974642
PLN283 1 559656399
PLN284 1 717517502
PLN285 1 672450454
PLN286 1 665297378
PLN287 1 636785599
PLN288 1 599706080
PLN289 1 675658265
PLN29 298 258873545
PLN290 1 523168208
PLN291 1 495661851
PLN292 1 640830439
PLN293 1 597781253
PLN294 1 600363860
PLN295 1 570178053
PLN296 1 534998810
PLN297 1 616598997
PLN298 1 537457279
PLN299 1 685947972
PLN3 3695 380523795
PLN30 339 265493888
PLN300 1 649921694
PLN301 1 641099225
PLN302 1 611845738
PLN303 1 581041262
PLN304 1 655783664
PLN305 1 521174834
PLN306 1 667717957
PLN307 1 631819663
PLN308 1 624692602
PLN309 1 597351075
PLN31 485 350911896
PLN310 1 561737938
PLN311 1 629651422
PLN312 1 524514255
PLN313 1 670202054
PLN314 1 631946783
PLN315 1 626743494
PLN316 1 600801835
PLN317 1 566971015
PLN318 1 629827058
PLN319 1 522114480
PLN32 112 80604200
PLN320 1 671530377
PLN321 1 631910401
PLN322 1 622474059
PLN323 1 598240357
PLN324 1 562137082
PLN325 1 633805855
PLN326 1 525723083
PLN327 1 684336246
PLN328 1 636053469
PLN329 1 629969872
PLN33 455 379563194
PLN330 1 604087610
PLN331 1 568600391
PLN332 1 640498578
PLN333 1 519546829
PLN334 1 665715246
PLN335 1 624683667
PLN336 1 621078253
PLN337 1 600910593
PLN338 1 558953701
PLN339 1 626840912
PLN34 127 379253996
PLN340 1 543344542
PLN341 1 697540743
PLN342 1 655862368
PLN343 1 646765634
PLN344 1 618540729
PLN345 1 587963859
PLN346 1 658085510
PLN347 283 378458630
PLN348 15 312691008
PLN349 20 111531882
PLN35 91 241350431
PLN350 1 596211899
PLN351 1 705338699
PLN352 1 493450010
PLN353 1 804285258
PLN354 1 810734643
PLN355 1 673981989
PLN356 1 754496630
PLN357 1 855759449
PLN358 1 614042580
PLN359 1 743847818
PLN36 108 325736871
PLN360 1 673340788
PLN361 1 515668560
PLN362 1 713320806
PLN363 1 703598484
PLN364 1 570159854
PLN365 1 625793224
PLN366 1 721110502
PLN367 1 459355444
PLN368 1 745201001
PLN369 1 749284433
PLN37 17 390428741
PLN370 1 643344672
PLN371 1 595297365
PLN372 1 688905267
PLN373 1 491807393
PLN374 1 769338634
PLN375 1 671568023
PLN376 1 635285330
PLN377 1 745618965
PLN378 1 839470345
PLN379 1 646400022
PLN38 234 283333018
PLN380 1 747589525
PLN381 1 665179885
PLN382 1 506585010
PLN383 1 703962928
PLN384 1 702438406
PLN385 1 568126671
PLN386 1 610851963
PLN387 1 707596419
PLN388 1 465558328
PLN389 1 734536914
PLN39 161 383746871
PLN390 1 738743901
PLN391 1 636778132
PLN392 1 602900890
PLN393 1 697493198
PLN394 1 490518203
PLN395 1 784661008
PLN396 1 810500911
PLN397 1 655314739
PLN398 1 752710991
PLN399 1 890847171
PLN4 3520 387632137
PLN40 65 329728329
PLN400 1 621781073
PLN401 1 743084022
PLN402 1 676741658
PLN403 1 509452426
PLN404 1 710124532
PLN405 1 480767623
PLN406 1 578021311
PLN407 1 620140791
PLN408 1 716573881
PLN409 1 476726550
PLN41 16 386556087
PLN410 1 756324664
PLN411 1 977471539
PLN412 1 642207261
PLN413 1 502612092
PLN414 1 646234737
PLN415 1 605172934
PLN416 1 593744788
PLN417 1 571972453
PLN418 1 545472572
PLN419 1 607667504
PLN42 20 328777414
PLN420 1 590561804
PLN421 1 685720839
PLN422 1 490910922
PLN423 1 782694893
PLN424 1 796420183
PLN425 1 650274702
PLN426 1 739889549
PLN427 1 848590828
PLN428 1 610626473
PLN429 1 738023571
PLN43 6 376299569
PLN430 1 667607564
PLN431 1 506274898
PLN432 1 701434008
PLN433 1 690770133
PLN434 1 567265955
PLN435 1 612987783
PLN436 1 704156067
PLN437 1 475327881
PLN438 1 732118298
PLN439 1 733931846
PLN44 1 65870126
PLN440 1 636796232
PLN441 1 599764323
PLN442 1 691313424
PLN443 1 493357854
PLN444 1 782685093
PLN445 1 786410271
PLN446 1 648139033
PLN447 1 744407562
PLN448 1 835583350
PLN449 1 623221719
PLN45 93 388494695
PLN450 1 741299132
PLN451 1 669032550
PLN452 1 517040482
PLN453 1 711661679
PLN454 1 708205786
PLN455 1 573398137
PLN456 1 583494258
PLN457 1 707105489
PLN458 1 471251328
PLN459 1 737453356
PLN46 15 373888800
PLN460 1 736349413
PLN461 1 639162162
PLN462 1 586755746
PLN463 1 704478343
PLN464 1 492109999
PLN465 1 791475352
PLN466 1 785940626
PLN467 1 661246824
PLN468 1 756990402
PLN469 1 858776195
PLN47 9 363551984
PLN470 1 621195942
PLN471 1 754256086
PLN472 1 670301833
PLN473 1 509263899
PLN474 1 708234589
PLN475 1 725120110
PLN476 1 575129590
PLN477 1 620883766
PLN478 1 727285804
PLN479 1 479660269
PLN48 60 374148929
PLN480 1 745978486
PLN481 1 750160716
PLN482 1 642428577
PLN483 1 591313643
PLN484 1 705330581
PLN485 1 495656580
PLN486 1 803232604
PLN487 1 790745243
PLN488 1 657494025
PLN489 1 759305888
PLN49 14 212654302
PLN490 1 856542542
PLN491 1 628321883
PLN492 1 754364263
PLN493 1 697113365
PLN494 1 504254270
PLN495 1 715354979
PLN496 1 713929667
PLN497 1 572943128
PLN498 1 626959190
PLN499 1 715714221
PLN5 97748 201650190
PLN50 74 124609184
PLN500 1 483823121
PLN501 1 742917797
PLN502 1 748536659
PLN503 1 643784981
PLN504 1 600654286
PLN505 1 685083685
PLN506 1 486317123
PLN507 1 794150360
PLN508 1 799857935
PLN509 1 655329108
PLN51 8 358353307
PLN510 1 749763888
PLN511 1 838116175
PLN512 1 610468321
PLN513 1 736551279
PLN514 1 666328382
PLN515 1 504826275
PLN516 1 702606209
PLN517 1 467876140
PLN518 1 566465558
PLN519 1 614421429
PLN52 3 347496433
PLN520 1 698878671
PLN521 1 480431564
PLN522 1 735408736
PLN523 1 969998116
PLN524 1 635024734
PLN525 10 3368
PLN526 1 595339094
PLN527 1 698605642
PLN528 1 499102108
PLN529 1 791748890
PLN53 4 370651368
PLN530 1 797311483
PLN531 1 656817438
PLN532 1 753360318
PLN533 1 845838138
PLN534 1 619661694
PLN535 1 752772853
PLN536 1 689709469
PLN537 1 509595892
PLN538 1 712797596
PLN539 1 710493282
PLN54 2 271593360
PLN540 1 570643040
PLN541 1 619886155
PLN542 1 705533140
PLN543 1 484551304
PLN544 1 740148362
PLN545 1 757233630
PLN546 1 642499559
PLN547 1 594006513
PLN548 1 693261537
PLN549 1 492948387
PLN55 1 150766190
PLN550 1 781462734
PLN551 1 802944975
PLN552 1 650275864
PLN553 1 756841830
PLN554 1 850623622
PLN555 1 614136911
PLN556 1 723255126
PLN557 1 669876730
PLN558 1 507533340
PLN559 1 712168462
PLN56 2 288204953
PLN560 1 712339524
PLN561 1 564869106
PLN562 1 619418949
PLN563 1 715454519
PLN564 1 478264344
PLN565 1 734693445
PLN566 1 749685439
PLN567 1 633598967
PLN568 171 140760852
PLN569 1 516505932
PLN57 2 286787940
PLN570 1 665585731
PLN571 1 621516506
PLN572 1 610333535
PLN573 1 588218686
PLN574 1 561794515
PLN575 1 632540561
PLN576 118 87991
PLN577 1 313789095
PLN578 1 248068439
PLN579 1 241454477
PLN58 2 295931502
PLN580 1 251811976
PLN581 1 225452224
PLN582 1 173806927
PLN583 2 370152128
PLN584 158 374282142
PLN585 599 391596749
PLN586 10 362580157
PLN587 7 281547701
PLN588 1 314258027
PLN589 1 394306295
PLN59 50 360868274
PLN590 1 325599754
PLN591 1 288763641
PLN592 1 187311108
PLN593 1 277174932
PLN594 1 235078182
PLN595 15 332895745
PLN596 16436 36185494
PLN597 5636 1862075
PLN598 5224 2478918
PLN599 1 563502314
PLN6 111699 128138648
PLN60 8 373615720
PLN600 2017 4991012
PLN601 1 594102056
PLN602 1 689851870
PLN603 1 495453186
PLN604 1 780798557
PLN605 1 801256715
PLN606 1 651852609
PLN607 1 750843639
PLN608 1 830829764
PLN609 1 615552423
PLN61 7 376229618
PLN610 1 744588157
PLN611 1 673617499
PLN612 1 509857067
PLN613 1 709773743
PLN614 1 713149757
PLN615 1 566080677
PLN616 1 618079260
PLN617 1 720988478
PLN618 1 473592718
PLN619 1 736706236
PLN62 6 342806685
PLN620 1 750620385
PLN621 1 638686055
PLN622 1 480980714
PLN623 6684 330577769
PLN624 3760 370633860
PLN625 10097 326490424
PLN626 1753 12315783
PLN627 1 585266722
PLN628 1 681112512
PLN629 1 775448786
PLN63 6 347730275
PLN630 1 790338525
PLN631 1 746673839
PLN632 1 836514780
PLN633 1 736872137
PLN634 1 676292951
PLN635 1 669155517
PLN636 1 701372996
PLN637 1 615672275
PLN638 1 698614761
PLN639 1 728031845
PLN64 6 350661716
PLN640 1 722970987
PLN641 12302 8480478
PLN642 94661 141764076
PLN643 109314 181349496
PLN644 91419 195304504
PLN645 79072 192999381
PLN646 98902 191219034
PLN647 102146 189824336
PLN648 102735 188309153
PLN649 5479 13961713
PLN65 43 144640005
PLN650 91847 201929716
PLN651 93127 199645441
PLN652 75142 219134769
PLN653 18872 52279468
PLN654 69498 226195291
PLN655 85045 204239917
PLN656 65756 235203808
PLN657 69259 227243576
PLN658 24761 94322836
PLN659 70696 226856260
PLN66 144 326417895
PLN660 44431 296090782
PLN661 6 357582661
PLN662 7 359051083
PLN663 34603 325154054
PLN664 2444 4708075
PLN67 7 298887356
PLN68 6 332369654
PLN69 50 340388796
PLN7 64149 184783224
PLN70 34 333743749
PLN71 1 48961553
PLN72 195 309764478
PLN73 6 336790634
PLN74 5 336035871
PLN75 6 326965702
PLN76 5 304407451
PLN77 13 303962775
PLN78 5 284426683
PLN79 8 327303441
PLN8 21749 106849481
PLN80 61 76849044
PLN81 2 355063454
PLN82 1 333667882
PLN83 1 302574826
PLN84 1 296818136
PLN85 1 257455782
PLN86 1 252943167
PLN87 1 225803546
PLN88 1 219123305
PLN89 2 394302667
PLN9 35233 291274408
PLN90 38 30696039
PLN91 15 305289289
PLN92 2 286029496
PLN93 2 307738366
PLN94 2 269669619
PLN95 1 157681923
PLN96 40 376080648
PLN97 33 389701062
PLN98 81 364968222
PLN99 46 275131990
PRI1 23047 60053106
PRI10 2265 387936439
PRI11 4375 381717987
PRI12 2068 191950792
PRI13 2459 391017609
PRI14 17343 243216304
PRI15 27929 79132073
PRI16 96050 166265556
PRI17 11025 363947920
PRI18 3741 383223079
PRI19 15303 353911286
PRI2 23838 319338979
PRI20 2239 172855211
PRI21 1 250749103
PRI22 1 238414537
PRI23 2 387789264
PRI24 2 351926207
PRI25 2 301224727
PRI26 2 270924633
PRI27 3 376243325
PRI28 4 374251276
PRI29 5 290585290
PRI3 2613 370370379
PRI30 42410 314483155
PRI31 18911 23568685
PRI32 53141 193817517
PRI33 4 351860731
PRI34 5 337827736
PRI35 3 297245061
PRI36 3 382019003
PRI37 2 285375381
PRI38 2 306826759
PRI39 2 354172067
PRI4 2409 360399901
PRI40 2 394680893
PRI41 1 242696752
PRI42 12373 364516820
PRI43 113541 183831523
PRI44 53712 103476461
PRI45 74330 199952244
PRI46 54429 215566213
PRI47 34622 144332518
PRI48 69722 214218466
PRI49 96653 188139173
PRI5 2593 353874487
PRI50 1 229594237
PRI51 1 190673448
PRI52 9368 358512524
PRI53 48772 211004999
PRI54 94139 188382791
PRI55 37266 66988698
PRI6 2112 282951291
PRI7 2729 356953890
PRI8 3181 362167571
PRI9 2423 385530941
ROD1 38451 309764896
ROD10 15053 352243468
ROD11 1336 2453179
ROD12 22213 347967024
ROD13 1002 157743814
ROD14 53466 238707384
ROD15 21658 310382782
ROD16 228387 97434634
ROD17 96974 65103533
ROD18 37883 247000089
ROD19 2 383374219
ROD2 1810 346957759
ROD20 2 353017828
ROD21 2 317259772
ROD22 2 289653994
ROD23 1 140975125
ROD24 3 385591618
ROD25 4 335044383
ROD26 5 356599364
ROD27 2 394024503
ROD28 2 369416674
ROD29 2 335852806
ROD3 1885 352024250
ROD30 2 300392300
ROD31 2 283621167
ROD32 3 348161973
ROD33 5 386542915
ROD34 154 237877425
ROD35 1 193958709
ROD36 2 350925653
ROD37 2 319642044
ROD38 2 276360533
ROD39 3 382322699
ROD4 1943 360884621
ROD40 3 366447402
ROD41 5 245850017
ROD42 2 348668775
ROD43 2 314889876
ROD44 3 389462371
ROD45 3 321351180
ROD46 1 93020901
ROD47 5 385423505
ROD48 6 342729329
ROD49 3 325864489
ROD5 1990 363733749
ROD50 4 358685719
ROD51 4 302148481
ROD52 5 337904903
ROD53 6 385168143
ROD54 6 347801590
ROD55 6 283624907
ROD56 80705 214227030
ROD6 306 57843793
ROD7 1975 368354297
ROD8 1990 369693686
ROD9 1959 368016559
STS1 170456 86853136
STS10 202215 61355397
STS11 167032 59462482
STS2 143554 63344283
STS3 8245 4839643
STS4 108725 63673512
STS5 110379 70040590
STS6 106166 81423611
STS7 122521 86625645
STS8 198742 60873959
STS9 8953 2430879
SYN1 54442 100617525
SYN10 2 382762979
SYN11 2 332214168
SYN12 4 386933112
SYN13 1 271050050
SYN14 2 294093621
SYN15 3 329883353
SYN16 4 353920981
SYN17 2 328712085
SYN18 4 357672913
SYN19 1 207870274
SYN2 1 271050050
SYN20 2 382762979
SYN21 2 332214168
SYN22 8 392789107
SYN23 65816 193076589
SYN24 541 20777084
SYN25 9183 352928592
SYN26 17218 334475810
SYN27 109259 160455897
SYN28 32731 97348416
SYN29 6959 232567626
SYN3 2 294093621
SYN4 3 329883353
SYN5 4 353920981
SYN6 1 64242768
SYN7 3 371658272
SYN8 2 250483958
SYN9 1 207870274
TSA1 233379 79653713
TSA10 168620 151882439
TSA100 63252 114802277
TSA101 79841 41351312
TSA102 82721 28609319
TSA103 67721 19747702
TSA104 84021 22863253
TSA105 84236 21912832
TSA106 84446 20981295
TSA107 134042 46621688
TSA108 155667 149676184
TSA109 183730 101083950
TSA11 157833 129928381
TSA110 47348 107503283
TSA111 136867 166252974
TSA112 166495 124901244
TSA113 97423 237859520
TSA114 99257 234633653
TSA115 12708 5978473
TSA116 134189 172362066
TSA117 127781 180160426
TSA118 129595 177105775
TSA119 121186 168272985
TSA12 96970 81223522
TSA120 161588 123667649
TSA121 122311 187541168
TSA122 147961 145186533
TSA123 94592 61300137
TSA124 136202 168455642
TSA125 159235 124954199
TSA126 156460 125810552
TSA127 123500 121448801
TSA13 144445 166877725
TSA14 183179 128348861
TSA15 63956 19389564
TSA16 207559 109270376
TSA17 186915 104023410
TSA18 49380 65170400
TSA19 154738 149587836
TSA2 222489 88761403
TSA20 216986 100238238
TSA21 205873 104166326
TSA22 22693 12535715
TSA23 158964 127360041
TSA24 173318 148890122
TSA25 214965 83902995
TSA26 105827 75169883
TSA27 172910 71716168
TSA28 221930 89798997
TSA29 26888 19147632
TSA3 74606 22549982
TSA30 203801 105213489
TSA31 180460 145757585
TSA32 69461 30780900
TSA33 188249 126080028
TSA34 147105 171156456
TSA35 162844 143034354
TSA36 150188 161796191
TSA37 167342 152072055
TSA38 141406 134174466
TSA39 170369 157568728
TSA4 200107 117397278
TSA40 68539 95284697
TSA41 171892 122248327
TSA42 190077 128883583
TSA43 179565 129786674
TSA44 74788 42541556
TSA45 179837 148961559
TSA46 157618 110427650
TSA47 134614 95382384
TSA48 185173 132793697
TSA49 208467 104145310
TSA5 215390 134315100
TSA50 79060 109863998
TSA51 193326 109684073
TSA52 179762 119005289
TSA53 111989 117134802
TSA54 155065 135926838
TSA55 161491 91811831
TSA56 130880 143874686
TSA57 137221 81350084
TSA58 155281 162331143
TSA59 162870 156978878
TSA6 15756 19456676
TSA60 193460 121152461
TSA61 58307 95815324
TSA62 173904 118336485
TSA63 151865 162169634
TSA64 60981 124236666
TSA65 201109 152115772
TSA66 185638 143700395
TSA67 163423 121712708
TSA68 182114 137377481
TSA69 170731 97712914
TSA7 193885 54027947
TSA70 40637 38146354
TSA71 119065 123313318
TSA72 131964 141438855
TSA73 151655 115933671
TSA74 830 251943
TSA75 152989 102336522
TSA76 156503 143538644
TSA77 40595 33645981
TSA78 176683 138455592
TSA79 161932 158903820
TSA8 157535 121615138
TSA80 11473 9475196
TSA81 185669 115791752
TSA82 143397 147854773
TSA83 177760 145456271
TSA84 159212 177068694
TSA85 17057 11897952
TSA86 168307 128893220
TSA87 156344 150391937
TSA88 195417 125563889
TSA89 31946 22565095
TSA9 99556 68880314
TSA90 196286 138439609
TSA91 112986 113189975
TSA92 98986 206634893
TSA93 87112 229168164
TSA94 77344 247719367
TSA95 30093 107285833
TSA96 141033 144555977
TSA97 106053 76615758
TSA98 74413 65471527
TSA99 33768 32853514
UNA1 700 4420346
VRL1 132421 138780376
VRL10 44176 308098048
VRL100 12384 370286134
VRL101 12382 370211898
VRL102 5593 167207813
VRL103 12391 370378994
VRL104 12393 370390238
VRL105 12395 370424114
VRL106 7993 238860319
VRL107 12409 370814633
VRL108 12404 370667524
VRL109 12459 371903729
VRL11 115586 146333519
VRL110 5256 156739850
VRL111 12227 365134813
VRL112 12346 368941421
VRL113 5895 176149686
VRL114 1904 56895892
VRL115 12412 370879993
VRL116 12615 376531313
VRL117 12642 377214911
VRL118 6340 188969823
VRL119 12640 377031424
VRL12 22888 79449124
VRL120 12732 379414321
VRL121 12742 379705519
VRL122 7006 208976171
VRL123 12705 378687920
VRL124 12643 377171669
VRL125 12570 374982047
VRL126 4245 126647995
VRL127 12563 374631570
VRL128 12551 374528400
VRL129 12589 375489671
VRL13 114065 144978071
VRL130 30244 46769699
VRL14 112586 147954004
VRL15 26369 44258793
VRL16 91102 158466088
VRL17 96719 150176020
VRL18 60946 99679982
VRL19 92386 166033580
VRL2 126453 151457532
VRL20 91156 163933587
VRL21 53959 120917303
VRL22 83156 172781048
VRL23 86026 167244464
VRL24 69419 118978940
VRL25 82970 167612962
VRL26 83273 167343577
VRL27 50178 111723932
VRL28 86168 191591949
VRL29 51338 273125141
VRL3 100193 117671331
VRL30 72265 193848776
VRL31 35231 78022508
VRL32 67818 182253059
VRL33 77100 186512318
VRL34 64673 152922199
VRL35 75180 192368872
VRL36 83523 172050149
VRL37 70191 139270175
VRL38 79416 175635771
VRL39 64617 185227660
VRL4 94614 149040310
VRL40 39331 199484322
VRL41 9244 93712735
VRL42 20808 217944893
VRL43 15232 219198575
VRL44 32150 207215118
VRL45 2938 87573279
VRL46 15121 219951898
VRL47 19519 216623270
VRL48 11379 220880459
VRL49 5138 97125800
VRL5 87219 144400840
VRL50 8826 222920788
VRL51 8074 221797584
VRL52 9042 221606118
VRL53 3909 97899810
VRL54 8058 222490945
VRL55 7978 221760690
VRL56 7960 222609587
VRL57 7563 222379651
VRL58 1910 56759299
VRL59 9799 220908342
VRL6 93293 144785513
VRL60 9692 220589031
VRL61 7588 221537221
VRL62 9104 221172981
VRL63 1615 46988406
VRL64 7492 221046425
VRL65 7584 222297003
VRL66 7484 221136510
VRL67 8743 223049618
VRL68 1248 37171367
VRL69 7499 220687975
VRL7 130391 141310808
VRL70 7434 221237340
VRL71 7731 221105504
VRL72 6012 177239399
VRL73 7537 221868234
VRL74 7901 220813368
VRL75 7529 219772250
VRL76 5137 153083833
VRL77 7506 222341451
VRL78 7484 220082740
VRL79 7545 221937033
VRL8 70173 88317844
VRL80 4246 125599189
VRL81 7422 220789265
VRL82 7496 222760880
VRL83 7589 222766410
VRL84 2128 63491541
VRL85 7573 222585936
VRL86 7733 222113255
VRL87 7419 221055535
VRL88 2812 80149900
VRL89 7480 222457690
VRL9 121329 144536798
VRL90 7763 222277462
VRL91 7475 220890002
VRL92 2423 71617149
VRL93 7505 221768730
VRL94 7679 222022152
VRL95 7558 223212669
VRL96 6534 187765800
VRL97 12365 369630589
VRL98 12387 370295291
VRL99 12393 370567303
VRT1 70024 272629402
VRT10 37396 74041240
VRT100 1 825560060
VRT101 1 595904407
VRT102 1 486875112
VRT103 1 387033265
VRT104 1 371528181
VRT105 1 313513962
VRT106 1 277530821
VRT107 1 268302114
VRT108 3 319484498
VRT109 5 386368861
VRT11 18698 27611025
VRT110 7 393936069
VRT111 7 384166854
VRT112 1 46063367
VRT113 7 344525641
VRT114 6 384186008
VRT115 8 388949147
VRT116 332 334400544
VRT117 1 222115097
VRT118 3 377547369
VRT119 10 383496928
VRT12 5986 380511905
VRT120 33 389650655
VRT121 6 59236435
VRT122 1 772932187
VRT123 1 662004353
VRT124 1 535506559
VRT125 1 376147139
VRT126 1 364230008
VRT127 1 346409914
VRT128 1 311292523
VRT129 1 247732340
VRT13 3363 217068541
VRT130 1 228143320
VRT131 1 221182781
VRT132 2 321892640
VRT133 490 332426844
VRT134 12 378048109
VRT135 9 378909870
VRT136 6 345737823
VRT137 2 137693511
VRT138 7 385107928
VRT139 8 360581972
VRT14 4685 4674270
VRT140 10 364952837
VRT141 4 133261911
VRT142 8 359905961
VRT143 5 370674748
VRT144 9 378247816
VRT145 6 166907986
VRT146 14 379842153
VRT147 15 375595384
VRT148 41 289507176
VRT149 11 366984719
VRT15 1171 26255719
VRT150 14 374291772
VRT151 10 185283047
VRT152 1 550518975
VRT153 1 529596002
VRT154 1 413748038
VRT155 1 326378286
VRT156 1 272612222
VRT157 1 260396842
VRT158 1 197956435
VRT159 2 384149701
VRT16 293 13983146
VRT160 2 288058306
VRT161 4 353983664
VRT162 433 371853020
VRT163 2 310725315
VRT164 2 280326572
VRT165 3 371471404
VRT166 3 354148189
VRT167 3 303679844
VRT168 4 341249946
VRT169 18 371172209
VRT17 37 392789976
VRT170 13 392880011
VRT171 13 164097178
VRT172 1 313568160
VRT173 1 289498315
VRT174 1 277254249
VRT175 1 244324502
VRT176 1 233859027
VRT177 1 225974235
VRT178 1 211674833
VRT179 1 199962141
VRT18 13 392458500
VRT180 2 390673241
VRT181 2 334991523
VRT182 2 324316137
VRT183 2 292002398
VRT184 1 133841611
VRT185 3 336899598
VRT186 28 389500106
VRT187 6 332993899
VRT188 6 378599539
VRT189 1 47256133
VRT19 12 379958897
VRT190 6 330076811
VRT191 7 362796652
VRT192 8 365387335
VRT193 20 273534543
VRT194 9 378695651
VRT195 11 392251032
VRT196 205 341394663
VRT197 7 347210350
VRT198 7 370650631
VRT199 8 391548385
VRT2 72836 271700141
VRT20 11 316368323
VRT200 6 385659507
VRT201 7 341110862
VRT202 1 55350661
VRT203 8 387616857
VRT204 3 259325358
VRT205 5 392602723
VRT206 41 394037361
VRT207 3 148003845
VRT208 7 387415360
VRT209 7 365756282
VRT21 13 385338369
VRT210 6 352657526
VRT211 5 346047628
VRT212 2 134650353
VRT213 5 356250620
VRT214 6 374573269
VRT215 6 364137996
VRT216 7 343458516
VRT217 2 121348818
VRT218 7 358240592
VRT219 8 383435354
VRT22 14 372163844
VRT220 8 365970383
VRT221 6 357597984
VRT222 7 355728138
VRT223 8 362648569
VRT224 7 390172982
VRT225 8 391413434
VRT226 8 377681388
VRT227 1 42933508
VRT228 100 376541917
VRT229 20 391000381
VRT23 14 352781625
VRT230 13 383659375
VRT231 52 386118286
VRT232 11 394338841
VRT233 11 274288418
VRT234 1 843366180
VRT235 1 842558404
VRT236 1 707956555
VRT237 1 635713434
VRT238 1 567300182
VRT239 1 439630435
VRT24 19 384683297
VRT240 1 236595445
VRT241 1 231667822
VRT242 2 382351630
VRT243 2 103223822
VRT244 1 690654357
VRT245 1 541439571
VRT246 1 495417988
VRT247 1 481763206
VRT248 1 429350720
VRT249 1 224823088
VRT25 16 379729070
VRT250 1 212589178
VRT251 2 374746477
VRT252 2 318111367
VRT253 29 270968231
VRT254 2 352563619
VRT255 7 386835620
VRT256 4314 352825248
VRT257 19 370712563
VRT258 15988 152796988
VRT259 139419 132625805
VRT26 16 381718727
VRT260 144314 125804693
VRT261 124399 117704326
VRT262 87955 126539844
VRT263 3 351846198
VRT264 5 374381301
VRT265 16 387558511
VRT266 12980 68585547
VRT27 2 51507477
VRT28 6 344600068
VRT29 7 384846875
VRT3 9006 334129504
VRT30 7 359521465
VRT31 33 269170512
VRT32 147 10842596
VRT33 586 15797052
VRT34 2343 67436863
VRT35 19198 357652178
VRT36 54157 304795318
VRT37 158680 137227714
VRT38 18090 13375217
VRT39 117693 200745678
VRT4 3 141387178
VRT40 84115 68089699
VRT41 2 304060631
VRT42 6 387303573
VRT43 28 305102738
VRT44 157350 129522012
VRT45 37581 25790918
VRT46 185763 123620333
VRT47 148540 105783405
VRT48 168364 113477827
VRT49 8427 7213349
VRT5 8 354279535
VRT50 133023 105740718
VRT51 156384 117939936
VRT52 142271 87446013
VRT53 188518 120085542
VRT54 103160 61313740
VRT55 157558 119275171
VRT56 152280 136968967
VRT57 130 390068043
VRT58 368 388330219
VRT59 1890 386612266
VRT6 11 387350249
VRT60 93395 228218040
VRT61 145106 21008965
VRT62 75789 25336814
VRT63 13375 365641119
VRT64 20 379347618
VRT65 270 393447049
VRT66 3067 391133617
VRT67 3471 230588304
VRT68 6884 378842754
VRT69 16 388667304
VRT7 11 393947221
VRT70 16 378559418
VRT71 12 379509384
VRT72 7 285874095
VRT73 12 387522266
VRT74 18 375242791
VRT75 16 386329687
VRT76 229 277860126
VRT77 17 367327734
VRT78 15 385834222
VRT79 7 149460915
VRT8 30744 333424138
VRT80 1 350098611
VRT81 1 332461053
VRT82 1 309313702
VRT83 1 293870033
VRT84 1 232056431
VRT85 1 209933285
VRT86 1 199226436
VRT87 2 392231039
VRT88 2 338442208
VRT89 2 304508243
VRT9 74952 70629182
VRT90 3 317261932
VRT91 7 378896727
VRT92 11 374771935
VRT93 13 379441801
VRT94 3 70710155
VRT95 16 344076996
VRT96 10 385210617
VRT97 15 392781064
VRT98 22 370094349
VRT99 1 839681426
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 244.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:
Entries Bases Species
1941990 157984188634 Triticum aestivum
1347290 97045683117 Hordeum vulgare subsp. vulgare
27343447 27327127602 Homo sapiens
143691 10852879426 Escherichia coli
10027996 10450579861 Mus musculus
23070 9981333416 Triticum turgidum subsp. durum
1730160 9551377069 Danio rerio
268430 7970084957 Severe acute respiratory syndrome coronavirus 2
4218955 7409951379 Zea mays
21517 6749231079 Secale cereale
2201883 6547202724 Rattus norvegicus
19460 5792241078 Klebsiella pneumoniae
1470713 5774219348 Canis lupus familiaris
2240678 5446053879 Bos taurus
54 5178626132 Rhinatrema bivittatum
3305148 5079869199 Sus scrofa
1932 4991586515 Bufo bufo
17 4548077046 Microcaecilia unicolor
10180 4261868626 Macrobrachium nipponense
3416 4108375968 Scyliorhinus canicula
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
187 Dec 2011 135117731375 146413798
188 Feb 2012 137384889783 149819246
189 Apr 2012 139266481398 151824421
190 Jun 2012 141343240755 154130210
191 Aug 2012 143081765233 156424033
192 Oct 2012 145430961262 157889737
193 Dec 2012 148390863904 161140325
194 Feb 2013 150141354858 162886727
195 Apr 2013 151178979155 164136731
196 Jun 2013 152599230112 165740164
197 Aug 2013 154192921011 167295840
198 Oct 2013 155176494699 168335396
199 Dec 2013 156230531562 169331407
200 Feb 2014 157943793171 171123749
201 Apr 2014 159813411760 171744486
202 Jun 2014 161822845643 173353076
203 Aug 2014 165722980375 174108750
204 Oct 2014 181563676918 178322253
205 Dec 2014 184938063614 179295769
206 Feb 2015 187893826750 181336445
207 Apr 2015 189739230107 182188746
208 Jun 2015 193921042946 185019352
209 Aug 2015 199823644287 187066846
210 Oct 2015 202237081559 188372017
211 Dec 2015 203939111071 189232925
212 Feb 2016 207018196067 190250235
213 Apr 2016 211423912047 193739511
214 Jun 2016 213200907819 194463572
215 Aug 2016 217971437647 196120831
216 Oct 2016 220731315250 197390691
217 Dec 2016 224973060433 198565475
218 Feb 2017 228719437638 199341377
219 Apr 2017 231824951552 200877884
220 Jun 2017 234997362623 201663568
221 Aug 2017 240343378258 203180606
222 Oct 2017 244914705468 203953682
223 Dec 2017 249722163594 206293625
224 Feb 2018 253630708098 207040555
225 Apr 2018 260189141631 208452303
226 Jun 2018 263957884539 209775348
227 Aug 2018 260806936411 208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
228 Oct 2018 279668290132 209656636
229 Dec 2018 285688542186 211281415
230 Feb 2019 303709510632 212260377
231 Apr 2019 321680566570 212775414
232 Jun 2019 329835282370 213383758
233 Aug 2019 366733917629 213865349
234 Oct 2019 386197018538 216763706
235 Dec 2019 388417258009 215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
236 Feb 2020 399376854872 216214215
237 Apr 2020 415770027949 216531829
238 Jun 2020 427823258901 217122233
239 Aug 2020 654057069549 218642238
240 Oct 2020 698688094046 219055207
241 Dec 2020 723003822007 221467827
242 Feb 2021 776291211106 226241476
243 Apr 2021 832400799511 227123201
244 Jun 2021 866009790959 227888889
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
187 Dec 2011 239868309609 73729553
188 Feb 2012 261370512675 78656704
189 Apr 2012 272693351548 80905298
190 Jun 2012 287577367116 82076779
191 Aug 2012 308196411905 84020064
192 Oct 2012 333881846451 86480509
193 Dec 2012 356002922838 92767765
194 Feb 2013 390900990416 103101291
195 Apr 2013 418026593606 110509314
196 Jun 2013 453829752320 112488036
197 Aug 2013 500420412665 124812020
198 Oct 2013 535842167741 130203205
199 Dec 2013 556764321498 133818570
200 Feb 2014 591378698544 139725795
201 Apr 2014 621015432437 143446790
202 Jun 2014 719581958743 175779064
203 Aug 2014 774052098731 189080419
204 Oct 2014 805549167708 196049974
205 Dec 2014 848977922022 200301550
206 Feb 2015 873281414087 205465046
207 Apr 2015 969102906813 243779199
208 Jun 2015 1038937210221 258702138
209 Aug 2015 1163275601001 302955543
210 Oct 2015 1222635267498 309198943
211 Dec 2015 1297865618365 317122157
212 Feb 2016 1399865495608 333012760
213 Apr 2016 1452207704949 338922537
214 Jun 2016 1556175944648 350278081
215 Aug 2016 1637224970324 359796497
216 Oct 2016 1676238489250 363213315
217 Dec 2016 1817189565845 395301176
218 Feb 2017 1892966308635 409490397
219 Apr 2017 2035032639807 451840147
220 Jun 2017 2164683993369 487891767
221 Aug 2017 2242294609510 499965722
222 Oct 2017 2318156361999 508825331
223 Dec 2017 2466098053327 551063065
224 Feb 2018 2608532210351 564286852
225 Apr 2018 2784740996536 621379029
226 Jun 2018 2944617324086 639804105
227 Aug 2018 3204855013281 665309765
228 Oct 2018 3444172142207 722438528
229 Dec 2018 3656719423096 773773190
230 Feb 2019 4164513961679 945019312
231 Apr 2019 4421986382065 993732214
232 Jun 2019 4847677297950 1022913321
233 Aug 2019 5585922333160 1075272215
234 Oct 2019 5985250251028 1097629174
235 Dec 2019 6277551200690 1127023870
236 Feb 2020 6968991265752 1206720688
237 Apr 2020 7788133221338 1267547429
238 Jun 2020 8114046262158 1302852615
239 Aug 2020 8841649410652 1408122887
240 Oct 2020 9215815569509 1432874252
241 Dec 2020 11830842428018 1517995689
242 Feb 2021 12270717209612 1563938043
243 Apr 2021 12732048052023 1590670459
244 Jun 2021 13442974346437 1632796606
The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.
TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).
Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.
Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tsa
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.
Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.
Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.
Release Date Base Pairs Entries
201 Apr 2014 23632325832 29734989
202 Jun 2014 31707343431 38011942
203 Aug 2014 33676182560 40556905
204 Oct 2014 36279458440 43567759
205 Dec 2014 46056420903 62635617
206 Feb 2015 49765340047 66706014
207 Apr 2015 55796332435 71989588
208 Jun 2015 60697472570 76974601
209 Aug 2015 69360654413 87827013
210 Oct 2015 70917172944 81790031
211 Dec 2015 77583339176 87488539
212 Feb 2016 81932555094 92132318
213 Apr 2016 87811163676 98147566
214 Jun 2016 94413958919 104677061
215 Aug 2016 103399742586 113179607
216 Oct 2016 113209225762 124199597
217 Dec 2016 125328824508 142094337
218 Feb 2017 133517212104 151431485
219 Apr 2017 149038907599 165068542
220 Jun 2017 158112969073 176812130
221 Aug 2017 167045663417 186777106
222 Oct 2017 172909268535 192754804
223 Dec 2017 181394660188 201559502
224 Feb 2018 193940551226 214324264
225 Apr 2018 205232396043 227364990
226 Jun 2018 216556686631 238788334
227 Aug 2018 225520004678 249295386
228 Oct 2018 235875573598 259927414
229 Dec 2018 248592892188 274845473
230 Feb 2019 263936885705 294772430
231 Apr 2019 277118019688 311247136
232 Jun 2019 285390240861 319927264
233 Aug 2019 294727165179 331347807
234 Oct 2019 305371891408 342811151
235 Dec 2019 325433016129 367193844
236 Feb 2020 340994289065 386644871
237 Apr 2020 349692751528 396392280
238 Jun 2020 359947709062 409725050
239 Aug 2020 366968951160 417524567
240 Oct 2020 382996662270 435968379
241 Dec 2020 392206975386 446397378
242 Feb 2021 407605409948 463151000
243 Apr 2021 425076483459 481154920
244 Jun 2021 436594941165 494641358
The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.
Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
ftp://ftp.ncbi.nih.gov/genbank/tls
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.
Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.
Release Date Base Pairs Entries
217 Dec 2016 584697919 1268690
218 Feb 2017 636923295 1438349
219 Apr 2017 636923295 1438349 (unchanged)
220 Jun 2017 824191338 1628475
221 Aug 2017 824191338 1628475 (unchanged)
222 Oct 2017 2993818315 9479460
223 Dec 2017 4458042616 12695198
224 Feb 2018 4531966831 12819978
225 Apr 2018 5612769448 14782654
226 Jun 2018 5896511468 15393041
227 Aug 2018 6077824493 15822538
228 Oct 2018 8435112913 20752288
229 Dec 2018 8511829281 20924588
230 Feb 2019 9146836085 23259929
231 Apr 2019 9623321565 24240761
232 Jun 2019 10182427815 25530139
233 Aug 2019 10531800829 26363945
234 Oct 2019 10848455369 27460978
235 Dec 2019 11280596614 28227180
236 Feb 2020 13669678196 34037371
237 Apr 2020 24615270313 65521132
238 Jun 2020 27500635128 75063181
239 Aug 2020 27825059498 75682157
240 Oct 2020 28814798868 78177358
241 Dec 2020 33036509446 88039152
242 Feb 2021 33634122995 90130561
243 Apr 2021 37998534461 102395753
244 Jun 2021 38198113354 102662929
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
June 15 2021
NCBI-GenBank Flat File Release 244.0
Bacterial Sequences (Part 1)
51396 loci, 92682287 bases, from 51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.
NOTE : Presentation of GI sequence identifiers in the GenBank
flatfile format was discontinued as of March 2017.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
or 2010.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
3.4.4.1 : Important notice about parsing the LOCUS line
Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.
Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.
Consider this LOCUS line for a typical complete bacterial genome:
LOCUS CP032762 5868661 bp DNA circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:
LOCUS AZZZAA02123456789 9999999999 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:
LOCUS AZZZAA0212345678910000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:
LOCUS AZZZAA02123456789 10000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.
3.4.4.2 : Data elements of the LOCUS line
The data elements of the LOCUS line format and their typical/historical
column positions are as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus Name (usually identical to the Accession Number)
29-29 space
30-40 Sequence Length, right-justified
41-41 space
42-43 'bp'
44-44 space
45-47 Strandedness : spaces (if not known), ss- (single-stranded),
ds- (double-stranded), or ms- (mixed-stranded)
48-53 Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA).
Left justified.
54-55 space
56-63 Molecule Topology : 'linear' followed by two spaces,
or 'circular'
64-64 space
65-67 Division Code
68-68 space
69-79 Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.
The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :
LOCUS HUMPDNRC 273 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S125 polymorphic dinucleotide repeat.
ACCESSION L10620
LOCUS HUMPDNRG 169 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S114 polymorphic dinucleotide repeat.
ACCESSION L10624
But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:
LOCUS AF035771 1357 bp mRNA linear PRI 30-JUN-1998
DEFINITION Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
complete cds.
ACCESSION AF035771
The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :
PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags)
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites)
GSS - GSS sequences (Genome Survey Sequences)
HTG - HTGS sequences (High Throughput Genomic sequences)
HTC - HTC sequences (High Throughput cDNA sequences)
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences
The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1
^^^^^^^^^^
Compound
Accession.Version
Number
A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:
http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS ANHA01000001 503 bp DNA linear BCT 23-NOV-2012
DEFINITION Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION ANHA01000001 ANHA01000000
VERSION ANHA01000001.1
DBLINK BioProject: PRJNA177352
BioSample: SAMN01795900
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK BioProject:PRJNA174162,PRJNA999998,PRJNA999999
And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.
As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".
DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:
http://www.ncbi.nlm.nih.gov/bioproject
At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:
http://www.ncbi.nlm.nih.gov/books/NBK54016/
DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:
http://www.ncbi.nlm.nih.gov/assembly
At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:
http://www.ncbi.nlm.nih.gov/assembly/help/
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:
http://www.insdc.org/documents/feature-table
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.2
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
The list of valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.3
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS KZ271580 141308 bp DNA linear CON 17-AUG-2017
DEFINITION Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION KZ271580 LQNL01000000
VERSION KZ271580.1
DBLINK BioProject: PRJNA230512
BioSample: SAMN04226856
KEYWORDS WGS; HIGH_QUALITY_DRAFT.
...
mRNA complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/product="hypothetical protein"
CDS complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/codon_start=1
/product="hypothetical protein"
/protein_id="OZC04795.1"
/db_xref="GI:1233056989"
/translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Scaffold/CON-division join() sequence
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.
The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] .
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Sayers E, Cavanaugh M, Clark K, Ostell J, Pruitt K,
Karsch-Mizrachi I, "GenBank", Nucleic Acids Research,
Volume 47, Issue D1, January 2019, pp. D94-D99
PMID: 30365038
PMCID: PMC6323954
DOI: 10.1093/nar/gky989
The following statement is an example of how one might cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'
(1) Sayers, E. et al, Nucleic Acids Res. 47(D1):D94-D99 (2019)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: Simply direct your web browser of choice to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] .
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 218.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
Vincent Calhoun, Larry Chlumsky, Karen Clark, Scott Durkin,
Francescopaolo di Cello, Michel Eschenbrenner, Michael Fetchko,
Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
Susan Schafer, Augustus Tilley, Beverly Underwood, Simone Walker
and Linda Yankie
Data Management and Preparation
Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
Sergiy Gotvyanskyy, Eugene Gribov, Jonathan Kans, Leonid Khotomliansky,
Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh, Alex Kotliarov,
Frank Ludwig, Anatoly Mnev, Vasuki Palanigobu,
Anton Perkov, Andriy Petrow, Sergey Petrunin, Wenyao Shi, Denis Sinyakov,
Thomas Smith, Vladimir Soussov, Elena Starchenko, Hanzhen Sun,
Andrei Vereshchagin, Jewen Xiao, Eugene Yaschenko, Liwei Zhou
Database Administration
Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
Benjamin Slade, Constantin Vasilyev
Customer Support
Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian
Project Direction
Steve Sherry : Acting Director, NCBI
Kim Pruitt : Branch Chief, NCBI/IEB
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
