Release Notes For GenBank Release 247
GBREL.TXT Genetic Sequence Data Bank
December 15 2021
NCBI-GenBank Flat File Release 247.0
Distribution Release Notes
234557297 sequences, 1053275115030 bases, for traditional GenBank records
2358202549 sequences, 15419048256410 bases, for set-based (WGS/TSA/TLS) records
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 247.0
1.2 Cutoff Date
1.3 Important Changes in Release 247.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 247.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for GenBank's web-based submission tool (BankIt) :
http://www.ncbi.nlm.nih.gov/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 247.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:
ftp://ftp.ncbi.nih.gov/genbank/wgs
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/tsa
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tls
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
See the README files in those areas for more information.
Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:
ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.
1.2 Cutoff Date
This full release, 247.0, incorporates data processed by the INSDC databases
as of Tuesday December 14 2021 at 5:33AM EST. For more recent data, users are
advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotide' database (see Section 6.4 of this document).
1.3 Important Changes in Release 247.0
1.3.1 Organizational changes
The total number of sequence data files increased by 154 with this release:
- the BCT division is now composed of 688 files (+25)
- the CON division is now composed of 223 files (+1)
- the INV division is now composed of 488 files (+27)
- the MAM division is now composed of 116 files (+17)
- the PLN division is now composed of 728 files (+5)
- the PRI division is now composed of 56 files (+1)
- the VRL division is now composed of 375 files (+78)
1.4 Upcoming Changes
No changes to the GenBank flatfile format are planned at this time.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the ENA and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the ENA and DDBJ databases.
BankIt may be used with any modern web browser. You can access BankIt
from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] .
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.
2.2 Files
This GenBank flat file release consists of 4454 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct395.seq - Bacterial sequence entries, part 395.
330. gbbct396.seq - Bacterial sequence entries, part 396.
331. gbbct397.seq - Bacterial sequence entries, part 397.
332. gbbct398.seq - Bacterial sequence entries, part 398.
333. gbbct399.seq - Bacterial sequence entries, part 399.
334. gbbct4.seq - Bacterial sequence entries, part 4.
335. gbbct40.seq - Bacterial sequence entries, part 40.
336. gbbct400.seq - Bacterial sequence entries, part 400.
337. gbbct401.seq - Bacterial sequence entries, part 401.
338. gbbct402.seq - Bacterial sequence entries, part 402.
339. gbbct403.seq - Bacterial sequence entries, part 403.
340. gbbct404.seq - Bacterial sequence entries, part 404.
341. gbbct405.seq - Bacterial sequence entries, part 405.
342. gbbct406.seq - Bacterial sequence entries, part 406.
343. gbbct407.seq - Bacterial sequence entries, part 407.
344. gbbct408.seq - Bacterial sequence entries, part 408.
345. gbbct409.seq - Bacterial sequence entries, part 409.
346. gbbct41.seq - Bacterial sequence entries, part 41.
347. gbbct410.seq - Bacterial sequence entries, part 410.
348. gbbct411.seq - Bacterial sequence entries, part 411.
349. gbbct412.seq - Bacterial sequence entries, part 412.
350. gbbct413.seq - Bacterial sequence entries, part 413.
351. gbbct414.seq - Bacterial sequence entries, part 414.
352. gbbct415.seq - Bacterial sequence entries, part 415.
353. gbbct416.seq - Bacterial sequence entries, part 416.
354. gbbct417.seq - Bacterial sequence entries, part 417.
355. gbbct418.seq - Bacterial sequence entries, part 418.
356. gbbct419.seq - Bacterial sequence entries, part 419.
357. gbbct42.seq - Bacterial sequence entries, part 42.
358. gbbct420.seq - Bacterial sequence entries, part 420.
359. gbbct421.seq - Bacterial sequence entries, part 421.
360. gbbct422.seq - Bacterial sequence entries, part 422.
361. gbbct423.seq - Bacterial sequence entries, part 423.
362. gbbct424.seq - Bacterial sequence entries, part 424.
363. gbbct425.seq - Bacterial sequence entries, part 425.
364. gbbct426.seq - Bacterial sequence entries, part 426.
365. gbbct427.seq - Bacterial sequence entries, part 427.
366. gbbct428.seq - Bacterial sequence entries, part 428.
367. gbbct429.seq - Bacterial sequence entries, part 429.
368. gbbct43.seq - Bacterial sequence entries, part 43.
369. gbbct430.seq - Bacterial sequence entries, part 430.
370. gbbct431.seq - Bacterial sequence entries, part 431.
371. gbbct432.seq - Bacterial sequence entries, part 432.
372. gbbct433.seq - Bacterial sequence entries, part 433.
373. gbbct434.seq - Bacterial sequence entries, part 434.
374. gbbct435.seq - Bacterial sequence entries, part 435.
375. gbbct436.seq - Bacterial sequence entries, part 436.
376. gbbct437.seq - Bacterial sequence entries, part 437.
377. gbbct438.seq - Bacterial sequence entries, part 438.
378. gbbct439.seq - Bacterial sequence entries, part 439.
379. gbbct44.seq - Bacterial sequence entries, part 44.
380. gbbct440.seq - Bacterial sequence entries, part 440.
381. gbbct441.seq - Bacterial sequence entries, part 441.
382. gbbct442.seq - Bacterial sequence entries, part 442.
383. gbbct443.seq - Bacterial sequence entries, part 443.
384. gbbct444.seq - Bacterial sequence entries, part 444.
385. gbbct445.seq - Bacterial sequence entries, part 445.
386. gbbct446.seq - Bacterial sequence entries, part 446.
387. gbbct447.seq - Bacterial sequence entries, part 447.
388. gbbct448.seq - Bacterial sequence entries, part 448.
389. gbbct449.seq - Bacterial sequence entries, part 449.
390. gbbct45.seq - Bacterial sequence entries, part 45.
391. gbbct450.seq - Bacterial sequence entries, part 450.
392. gbbct451.seq - Bacterial sequence entries, part 451.
393. gbbct452.seq - Bacterial sequence entries, part 452.
394. gbbct453.seq - Bacterial sequence entries, part 453.
395. gbbct454.seq - Bacterial sequence entries, part 454.
396. gbbct455.seq - Bacterial sequence entries, part 455.
397. gbbct456.seq - Bacterial sequence entries, part 456.
398. gbbct457.seq - Bacterial sequence entries, part 457.
399. gbbct458.seq - Bacterial sequence entries, part 458.
400. gbbct459.seq - Bacterial sequence entries, part 459.
401. gbbct46.seq - Bacterial sequence entries, part 46.
402. gbbct460.seq - Bacterial sequence entries, part 460.
403. gbbct461.seq - Bacterial sequence entries, part 461.
404. gbbct462.seq - Bacterial sequence entries, part 462.
405. gbbct463.seq - Bacterial sequence entries, part 463.
406. gbbct464.seq - Bacterial sequence entries, part 464.
407. gbbct465.seq - Bacterial sequence entries, part 465.
408. gbbct466.seq - Bacterial sequence entries, part 466.
409. gbbct467.seq - Bacterial sequence entries, part 467.
410. gbbct468.seq - Bacterial sequence entries, part 468.
411. gbbct469.seq - Bacterial sequence entries, part 469.
412. gbbct47.seq - Bacterial sequence entries, part 47.
413. gbbct470.seq - Bacterial sequence entries, part 470.
414. gbbct471.seq - Bacterial sequence entries, part 471.
415. gbbct472.seq - Bacterial sequence entries, part 472.
416. gbbct473.seq - Bacterial sequence entries, part 473.
417. gbbct474.seq - Bacterial sequence entries, part 474.
418. gbbct475.seq - Bacterial sequence entries, part 475.
419. gbbct476.seq - Bacterial sequence entries, part 476.
420. gbbct477.seq - Bacterial sequence entries, part 477.
421. gbbct478.seq - Bacterial sequence entries, part 478.
422. gbbct479.seq - Bacterial sequence entries, part 479.
423. gbbct48.seq - Bacterial sequence entries, part 48.
424. gbbct480.seq - Bacterial sequence entries, part 480.
425. gbbct481.seq - Bacterial sequence entries, part 481.
426. gbbct482.seq - Bacterial sequence entries, part 482.
427. gbbct483.seq - Bacterial sequence entries, part 483.
428. gbbct484.seq - Bacterial sequence entries, part 484.
429. gbbct485.seq - Bacterial sequence entries, part 485.
430. gbbct486.seq - Bacterial sequence entries, part 486.
431. gbbct487.seq - Bacterial sequence entries, part 487.
432. gbbct488.seq - Bacterial sequence entries, part 488.
433. gbbct489.seq - Bacterial sequence entries, part 489.
434. gbbct49.seq - Bacterial sequence entries, part 49.
435. gbbct490.seq - Bacterial sequence entries, part 490.
436. gbbct491.seq - Bacterial sequence entries, part 491.
437. gbbct492.seq - Bacterial sequence entries, part 492.
438. gbbct493.seq - Bacterial sequence entries, part 493.
439. gbbct494.seq - Bacterial sequence entries, part 494.
440. gbbct495.seq - Bacterial sequence entries, part 495.
441. gbbct496.seq - Bacterial sequence entries, part 496.
442. gbbct497.seq - Bacterial sequence entries, part 497.
443. gbbct498.seq - Bacterial sequence entries, part 498.
444. gbbct499.seq - Bacterial sequence entries, part 499.
445. gbbct5.seq - Bacterial sequence entries, part 5.
446. gbbct50.seq - Bacterial sequence entries, part 50.
447. gbbct500.seq - Bacterial sequence entries, part 500.
448. gbbct501.seq - Bacterial sequence entries, part 501.
449. gbbct502.seq - Bacterial sequence entries, part 502.
450. gbbct503.seq - Bacterial sequence entries, part 503.
451. gbbct504.seq - Bacterial sequence entries, part 504.
452. gbbct505.seq - Bacterial sequence entries, part 505.
453. gbbct506.seq - Bacterial sequence entries, part 506.
454. gbbct507.seq - Bacterial sequence entries, part 507.
455. gbbct508.seq - Bacterial sequence entries, part 508.
456. gbbct509.seq - Bacterial sequence entries, part 509.
457. gbbct51.seq - Bacterial sequence entries, part 51.
458. gbbct510.seq - Bacterial sequence entries, part 510.
459. gbbct511.seq - Bacterial sequence entries, part 511.
460. gbbct512.seq - Bacterial sequence entries, part 512.
461. gbbct513.seq - Bacterial sequence entries, part 513.
462. gbbct514.seq - Bacterial sequence entries, part 514.
463. gbbct515.seq - Bacterial sequence entries, part 515.
464. gbbct516.seq - Bacterial sequence entries, part 516.
465. gbbct517.seq - Bacterial sequence entries, part 517.
466. gbbct518.seq - Bacterial sequence entries, part 518.
467. gbbct519.seq - Bacterial sequence entries, part 519.
468. gbbct52.seq - Bacterial sequence entries, part 52.
469. gbbct520.seq - Bacterial sequence entries, part 520.
470. gbbct521.seq - Bacterial sequence entries, part 521.
471. gbbct522.seq - Bacterial sequence entries, part 522.
472. gbbct523.seq - Bacterial sequence entries, part 523.
473. gbbct524.seq - Bacterial sequence entries, part 524.
474. gbbct525.seq - Bacterial sequence entries, part 525.
475. gbbct526.seq - Bacterial sequence entries, part 526.
476. gbbct527.seq - Bacterial sequence entries, part 527.
477. gbbct528.seq - Bacterial sequence entries, part 528.
478. gbbct529.seq - Bacterial sequence entries, part 529.
479. gbbct53.seq - Bacterial sequence entries, part 53.
480. gbbct530.seq - Bacterial sequence entries, part 530.
481. gbbct531.seq - Bacterial sequence entries, part 531.
482. gbbct532.seq - Bacterial sequence entries, part 532.
483. gbbct533.seq - Bacterial sequence entries, part 533.
484. gbbct534.seq - Bacterial sequence entries, part 534.
485. gbbct535.seq - Bacterial sequence entries, part 535.
486. gbbct536.seq - Bacterial sequence entries, part 536.
487. gbbct537.seq - Bacterial sequence entries, part 537.
488. gbbct538.seq - Bacterial sequence entries, part 538.
489. gbbct539.seq - Bacterial sequence entries, part 539.
490. gbbct54.seq - Bacterial sequence entries, part 54.
491. gbbct540.seq - Bacterial sequence entries, part 540.
492. gbbct541.seq - Bacterial sequence entries, part 541.
493. gbbct542.seq - Bacterial sequence entries, part 542.
494. gbbct543.seq - Bacterial sequence entries, part 543.
495. gbbct544.seq - Bacterial sequence entries, part 544.
496. gbbct545.seq - Bacterial sequence entries, part 545.
497. gbbct546.seq - Bacterial sequence entries, part 546.
498. gbbct547.seq - Bacterial sequence entries, part 547.
499. gbbct548.seq - Bacterial sequence entries, part 548.
500. gbbct549.seq - Bacterial sequence entries, part 549.
501. gbbct55.seq - Bacterial sequence entries, part 55.
502. gbbct550.seq - Bacterial sequence entries, part 550.
503. gbbct551.seq - Bacterial sequence entries, part 551.
504. gbbct552.seq - Bacterial sequence entries, part 552.
505. gbbct553.seq - Bacterial sequence entries, part 553.
506. gbbct554.seq - Bacterial sequence entries, part 554.
507. gbbct555.seq - Bacterial sequence entries, part 555.
508. gbbct556.seq - Bacterial sequence entries, part 556.
509. gbbct557.seq - Bacterial sequence entries, part 557.
510. gbbct558.seq - Bacterial sequence entries, part 558.
511. gbbct559.seq - Bacterial sequence entries, part 559.
512. gbbct56.seq - Bacterial sequence entries, part 56.
513. gbbct560.seq - Bacterial sequence entries, part 560.
514. gbbct561.seq - Bacterial sequence entries, part 561.
515. gbbct562.seq - Bacterial sequence entries, part 562.
516. gbbct563.seq - Bacterial sequence entries, part 563.
517. gbbct564.seq - Bacterial sequence entries, part 564.
518. gbbct565.seq - Bacterial sequence entries, part 565.
519. gbbct566.seq - Bacterial sequence entries, part 566.
520. gbbct567.seq - Bacterial sequence entries, part 567.
521. gbbct568.seq - Bacterial sequence entries, part 568.
522. gbbct569.seq - Bacterial sequence entries, part 569.
523. gbbct57.seq - Bacterial sequence entries, part 57.
524. gbbct570.seq - Bacterial sequence entries, part 570.
525. gbbct571.seq - Bacterial sequence entries, part 571.
526. gbbct572.seq - Bacterial sequence entries, part 572.
527. gbbct573.seq - Bacterial sequence entries, part 573.
528. gbbct574.seq - Bacterial sequence entries, part 574.
529. gbbct575.seq - Bacterial sequence entries, part 575.
530. gbbct576.seq - Bacterial sequence entries, part 576.
531. gbbct577.seq - Bacterial sequence entries, part 577.
532. gbbct578.seq - Bacterial sequence entries, part 578.
533. gbbct579.seq - Bacterial sequence entries, part 579.
534. gbbct58.seq - Bacterial sequence entries, part 58.
535. gbbct580.seq - Bacterial sequence entries, part 580.
536. gbbct581.seq - Bacterial sequence entries, part 581.
537. gbbct582.seq - Bacterial sequence entries, part 582.
538. gbbct583.seq - Bacterial sequence entries, part 583.
539. gbbct584.seq - Bacterial sequence entries, part 584.
540. gbbct585.seq - Bacterial sequence entries, part 585.
541. gbbct586.seq - Bacterial sequence entries, part 586.
542. gbbct587.seq - Bacterial sequence entries, part 587.
543. gbbct588.seq - Bacterial sequence entries, part 588.
544. gbbct589.seq - Bacterial sequence entries, part 589.
545. gbbct59.seq - Bacterial sequence entries, part 59.
546. gbbct590.seq - Bacterial sequence entries, part 590.
547. gbbct591.seq - Bacterial sequence entries, part 591.
548. gbbct592.seq - Bacterial sequence entries, part 592.
549. gbbct593.seq - Bacterial sequence entries, part 593.
550. gbbct594.seq - Bacterial sequence entries, part 594.
551. gbbct595.seq - Bacterial sequence entries, part 595.
552. gbbct596.seq - Bacterial sequence entries, part 596.
553. gbbct597.seq - Bacterial sequence entries, part 597.
554. gbbct598.seq - Bacterial sequence entries, part 598.
555. gbbct599.seq - Bacterial sequence entries, part 599.
556. gbbct6.seq - Bacterial sequence entries, part 6.
557. gbbct60.seq - Bacterial sequence entries, part 60.
558. gbbct600.seq - Bacterial sequence entries, part 600.
559. gbbct601.seq - Bacterial sequence entries, part 601.
560. gbbct602.seq - Bacterial sequence entries, part 602.
561. gbbct603.seq - Bacterial sequence entries, part 603.
562. gbbct604.seq - Bacterial sequence entries, part 604.
563. gbbct605.seq - Bacterial sequence entries, part 605.
564. gbbct606.seq - Bacterial sequence entries, part 606.
565. gbbct607.seq - Bacterial sequence entries, part 607.
566. gbbct608.seq - Bacterial sequence entries, part 608.
567. gbbct609.seq - Bacterial sequence entries, part 609.
568. gbbct61.seq - Bacterial sequence entries, part 61.
569. gbbct610.seq - Bacterial sequence entries, part 610.
570. gbbct611.seq - Bacterial sequence entries, part 611.
571. gbbct612.seq - Bacterial sequence entries, part 612.
572. gbbct613.seq - Bacterial sequence entries, part 613.
573. gbbct614.seq - Bacterial sequence entries, part 614.
574. gbbct615.seq - Bacterial sequence entries, part 615.
575. gbbct616.seq - Bacterial sequence entries, part 616.
576. gbbct617.seq - Bacterial sequence entries, part 617.
577. gbbct618.seq - Bacterial sequence entries, part 618.
578. gbbct619.seq - Bacterial sequence entries, part 619.
579. gbbct62.seq - Bacterial sequence entries, part 62.
580. gbbct620.seq - Bacterial sequence entries, part 620.
581. gbbct621.seq - Bacterial sequence entries, part 621.
582. gbbct622.seq - Bacterial sequence entries, part 622.
583. gbbct623.seq - Bacterial sequence entries, part 623.
584. gbbct624.seq - Bacterial sequence entries, part 624.
585. gbbct625.seq - Bacterial sequence entries, part 625.
586. gbbct626.seq - Bacterial sequence entries, part 626.
587. gbbct627.seq - Bacterial sequence entries, part 627.
588. gbbct628.seq - Bacterial sequence entries, part 628.
589. gbbct629.seq - Bacterial sequence entries, part 629.
590. gbbct63.seq - Bacterial sequence entries, part 63.
591. gbbct630.seq - Bacterial sequence entries, part 630.
592. gbbct631.seq - Bacterial sequence entries, part 631.
593. gbbct632.seq - Bacterial sequence entries, part 632.
594. gbbct633.seq - Bacterial sequence entries, part 633.
595. gbbct634.seq - Bacterial sequence entries, part 634.
596. gbbct635.seq - Bacterial sequence entries, part 635.
597. gbbct636.seq - Bacterial sequence entries, part 636.
598. gbbct637.seq - Bacterial sequence entries, part 637.
599. gbbct638.seq - Bacterial sequence entries, part 638.
600. gbbct639.seq - Bacterial sequence entries, part 639.
601. gbbct64.seq - Bacterial sequence entries, part 64.
602. gbbct640.seq - Bacterial sequence entries, part 640.
603. gbbct641.seq - Bacterial sequence entries, part 641.
604. gbbct642.seq - Bacterial sequence entries, part 642.
605. gbbct643.seq - Bacterial sequence entries, part 643.
606. gbbct644.seq - Bacterial sequence entries, part 644.
607. gbbct645.seq - Bacterial sequence entries, part 645.
608. gbbct646.seq - Bacterial sequence entries, part 646.
609. gbbct647.seq - Bacterial sequence entries, part 647.
610. gbbct648.seq - Bacterial sequence entries, part 648.
611. gbbct649.seq - Bacterial sequence entries, part 649.
612. gbbct65.seq - Bacterial sequence entries, part 65.
613. gbbct650.seq - Bacterial sequence entries, part 650.
614. gbbct651.seq - Bacterial sequence entries, part 651.
615. gbbct652.seq - Bacterial sequence entries, part 652.
616. gbbct653.seq - Bacterial sequence entries, part 653.
617. gbbct654.seq - Bacterial sequence entries, part 654.
618. gbbct655.seq - Bacterial sequence entries, part 655.
619. gbbct656.seq - Bacterial sequence entries, part 656.
620. gbbct657.seq - Bacterial sequence entries, part 657.
621. gbbct658.seq - Bacterial sequence entries, part 658.
622. gbbct659.seq - Bacterial sequence entries, part 659.
623. gbbct66.seq - Bacterial sequence entries, part 66.
624. gbbct660.seq - Bacterial sequence entries, part 660.
625. gbbct661.seq - Bacterial sequence entries, part 661.
626. gbbct662.seq - Bacterial sequence entries, part 662.
627. gbbct663.seq - Bacterial sequence entries, part 663.
628. gbbct664.seq - Bacterial sequence entries, part 664.
629. gbbct665.seq - Bacterial sequence entries, part 665.
630. gbbct666.seq - Bacterial sequence entries, part 666.
631. gbbct667.seq - Bacterial sequence entries, part 667.
632. gbbct668.seq - Bacterial sequence entries, part 668.
633. gbbct669.seq - Bacterial sequence entries, part 669.
634. gbbct67.seq - Bacterial sequence entries, part 67.
635. gbbct670.seq - Bacterial sequence entries, part 670.
636. gbbct671.seq - Bacterial sequence entries, part 671.
637. gbbct672.seq - Bacterial sequence entries, part 672.
638. gbbct673.seq - Bacterial sequence entries, part 673.
639. gbbct674.seq - Bacterial sequence entries, part 674.
640. gbbct675.seq - Bacterial sequence entries, part 675.
641. gbbct676.seq - Bacterial sequence entries, part 676.
642. gbbct677.seq - Bacterial sequence entries, part 677.
643. gbbct678.seq - Bacterial sequence entries, part 678.
644. gbbct679.seq - Bacterial sequence entries, part 679.
645. gbbct68.seq - Bacterial sequence entries, part 68.
646. gbbct680.seq - Bacterial sequence entries, part 680.
647. gbbct681.seq - Bacterial sequence entries, part 681.
648. gbbct682.seq - Bacterial sequence entries, part 682.
649. gbbct683.seq - Bacterial sequence entries, part 683.
650. gbbct684.seq - Bacterial sequence entries, part 684.
651. gbbct685.seq - Bacterial sequence entries, part 685.
652. gbbct686.seq - Bacterial sequence entries, part 686.
653. gbbct687.seq - Bacterial sequence entries, part 687.
654. gbbct688.seq - Bacterial sequence entries, part 688.
655. gbbct69.seq - Bacterial sequence entries, part 69.
656. gbbct7.seq - Bacterial sequence entries, part 7.
657. gbbct70.seq - Bacterial sequence entries, part 70.
658. gbbct71.seq - Bacterial sequence entries, part 71.
659. gbbct72.seq - Bacterial sequence entries, part 72.
660. gbbct73.seq - Bacterial sequence entries, part 73.
661. gbbct74.seq - Bacterial sequence entries, part 74.
662. gbbct75.seq - Bacterial sequence entries, part 75.
663. gbbct76.seq - Bacterial sequence entries, part 76.
664. gbbct77.seq - Bacterial sequence entries, part 77.
665. gbbct78.seq - Bacterial sequence entries, part 78.
666. gbbct79.seq - Bacterial sequence entries, part 79.
667. gbbct8.seq - Bacterial sequence entries, part 8.
668. gbbct80.seq - Bacterial sequence entries, part 80.
669. gbbct81.seq - Bacterial sequence entries, part 81.
670. gbbct82.seq - Bacterial sequence entries, part 82.
671. gbbct83.seq - Bacterial sequence entries, part 83.
672. gbbct84.seq - Bacterial sequence entries, part 84.
673. gbbct85.seq - Bacterial sequence entries, part 85.
674. gbbct86.seq - Bacterial sequence entries, part 86.
675. gbbct87.seq - Bacterial sequence entries, part 87.
676. gbbct88.seq - Bacterial sequence entries, part 88.
677. gbbct89.seq - Bacterial sequence entries, part 89.
678. gbbct9.seq - Bacterial sequence entries, part 9.
679. gbbct90.seq - Bacterial sequence entries, part 90.
680. gbbct91.seq - Bacterial sequence entries, part 91.
681. gbbct92.seq - Bacterial sequence entries, part 92.
682. gbbct93.seq - Bacterial sequence entries, part 93.
683. gbbct94.seq - Bacterial sequence entries, part 94.
684. gbbct95.seq - Bacterial sequence entries, part 95.
685. gbbct96.seq - Bacterial sequence entries, part 96.
686. gbbct97.seq - Bacterial sequence entries, part 97.
687. gbbct98.seq - Bacterial sequence entries, part 98.
688. gbbct99.seq - Bacterial sequence entries, part 99.
689. gbchg.txt - Accession numbers of entries updated since the previous release.
690. gbcon1.seq - Constructed sequence entries, part 1.
691. gbcon10.seq - Constructed sequence entries, part 10.
692. gbcon100.seq - Constructed sequence entries, part 100.
693. gbcon101.seq - Constructed sequence entries, part 101.
694. gbcon102.seq - Constructed sequence entries, part 102.
695. gbcon103.seq - Constructed sequence entries, part 103.
696. gbcon104.seq - Constructed sequence entries, part 104.
697. gbcon105.seq - Constructed sequence entries, part 105.
698. gbcon106.seq - Constructed sequence entries, part 106.
699. gbcon107.seq - Constructed sequence entries, part 107.
700. gbcon108.seq - Constructed sequence entries, part 108.
701. gbcon109.seq - Constructed sequence entries, part 109.
702. gbcon11.seq - Constructed sequence entries, part 11.
703. gbcon110.seq - Constructed sequence entries, part 110.
704. gbcon111.seq - Constructed sequence entries, part 111.
705. gbcon112.seq - Constructed sequence entries, part 112.
706. gbcon113.seq - Constructed sequence entries, part 113.
707. gbcon114.seq - Constructed sequence entries, part 114.
708. gbcon115.seq - Constructed sequence entries, part 115.
709. gbcon116.seq - Constructed sequence entries, part 116.
710. gbcon117.seq - Constructed sequence entries, part 117.
711. gbcon118.seq - Constructed sequence entries, part 118.
712. gbcon119.seq - Constructed sequence entries, part 119.
713. gbcon12.seq - Constructed sequence entries, part 12.
714. gbcon120.seq - Constructed sequence entries, part 120.
715. gbcon121.seq - Constructed sequence entries, part 121.
716. gbcon122.seq - Constructed sequence entries, part 122.
717. gbcon123.seq - Constructed sequence entries, part 123.
718. gbcon124.seq - Constructed sequence entries, part 124.
719. gbcon125.seq - Constructed sequence entries, part 125.
720. gbcon126.seq - Constructed sequence entries, part 126.
721. gbcon127.seq - Constructed sequence entries, part 127.
722. gbcon128.seq - Constructed sequence entries, part 128.
723. gbcon129.seq - Constructed sequence entries, part 129.
724. gbcon13.seq - Constructed sequence entries, part 13.
725. gbcon130.seq - Constructed sequence entries, part 130.
726. gbcon131.seq - Constructed sequence entries, part 131.
727. gbcon132.seq - Constructed sequence entries, part 132.
728. gbcon133.seq - Constructed sequence entries, part 133.
729. gbcon134.seq - Constructed sequence entries, part 134.
730. gbcon135.seq - Constructed sequence entries, part 135.
731. gbcon136.seq - Constructed sequence entries, part 136.
732. gbcon137.seq - Constructed sequence entries, part 137.
733. gbcon138.seq - Constructed sequence entries, part 138.
734. gbcon139.seq - Constructed sequence entries, part 139.
735. gbcon14.seq - Constructed sequence entries, part 14.
736. gbcon140.seq - Constructed sequence entries, part 140.
737. gbcon141.seq - Constructed sequence entries, part 141.
738. gbcon142.seq - Constructed sequence entries, part 142.
739. gbcon143.seq - Constructed sequence entries, part 143.
740. gbcon144.seq - Constructed sequence entries, part 144.
741. gbcon145.seq - Constructed sequence entries, part 145.
742. gbcon146.seq - Constructed sequence entries, part 146.
743. gbcon147.seq - Constructed sequence entries, part 147.
744. gbcon148.seq - Constructed sequence entries, part 148.
745. gbcon149.seq - Constructed sequence entries, part 149.
746. gbcon15.seq - Constructed sequence entries, part 15.
747. gbcon150.seq - Constructed sequence entries, part 150.
748. gbcon151.seq - Constructed sequence entries, part 151.
749. gbcon152.seq - Constructed sequence entries, part 152.
750. gbcon153.seq - Constructed sequence entries, part 153.
751. gbcon154.seq - Constructed sequence entries, part 154.
752. gbcon155.seq - Constructed sequence entries, part 155.
753. gbcon156.seq - Constructed sequence entries, part 156.
754. gbcon157.seq - Constructed sequence entries, part 157.
755. gbcon158.seq - Constructed sequence entries, part 158.
756. gbcon159.seq - Constructed sequence entries, part 159.
757. gbcon16.seq - Constructed sequence entries, part 16.
758. gbcon160.seq - Constructed sequence entries, part 160.
759. gbcon161.seq - Constructed sequence entries, part 161.
760. gbcon162.seq - Constructed sequence entries, part 162.
761. gbcon163.seq - Constructed sequence entries, part 163.
762. gbcon164.seq - Constructed sequence entries, part 164.
763. gbcon165.seq - Constructed sequence entries, part 165.
764. gbcon166.seq - Constructed sequence entries, part 166.
765. gbcon167.seq - Constructed sequence entries, part 167.
766. gbcon168.seq - Constructed sequence entries, part 168.
767. gbcon169.seq - Constructed sequence entries, part 169.
768. gbcon17.seq - Constructed sequence entries, part 17.
769. gbcon170.seq - Constructed sequence entries, part 170.
770. gbcon171.seq - Constructed sequence entries, part 171.
771. gbcon172.seq - Constructed sequence entries, part 172.
772. gbcon173.seq - Constructed sequence entries, part 173.
773. gbcon174.seq - Constructed sequence entries, part 174.
774. gbcon175.seq - Constructed sequence entries, part 175.
775. gbcon176.seq - Constructed sequence entries, part 176.
776. gbcon177.seq - Constructed sequence entries, part 177.
777. gbcon178.seq - Constructed sequence entries, part 178.
778. gbcon179.seq - Constructed sequence entries, part 179.
779. gbcon18.seq - Constructed sequence entries, part 18.
780. gbcon180.seq - Constructed sequence entries, part 180.
781. gbcon181.seq - Constructed sequence entries, part 181.
782. gbcon182.seq - Constructed sequence entries, part 182.
783. gbcon183.seq - Constructed sequence entries, part 183.
784. gbcon184.seq - Constructed sequence entries, part 184.
785. gbcon185.seq - Constructed sequence entries, part 185.
786. gbcon186.seq - Constructed sequence entries, part 186.
787. gbcon187.seq - Constructed sequence entries, part 187.
788. gbcon188.seq - Constructed sequence entries, part 188.
789. gbcon189.seq - Constructed sequence entries, part 189.
790. gbcon19.seq - Constructed sequence entries, part 19.
791. gbcon190.seq - Constructed sequence entries, part 190.
792. gbcon191.seq - Constructed sequence entries, part 191.
793. gbcon192.seq - Constructed sequence entries, part 192.
794. gbcon193.seq - Constructed sequence entries, part 193.
795. gbcon194.seq - Constructed sequence entries, part 194.
796. gbcon195.seq - Constructed sequence entries, part 195.
797. gbcon196.seq - Constructed sequence entries, part 196.
798. gbcon197.seq - Constructed sequence entries, part 197.
799. gbcon198.seq - Constructed sequence entries, part 198.
800. gbcon199.seq - Constructed sequence entries, part 199.
801. gbcon2.seq - Constructed sequence entries, part 2.
802. gbcon20.seq - Constructed sequence entries, part 20.
803. gbcon200.seq - Constructed sequence entries, part 200.
804. gbcon201.seq - Constructed sequence entries, part 201.
805. gbcon202.seq - Constructed sequence entries, part 202.
806. gbcon203.seq - Constructed sequence entries, part 203.
807. gbcon204.seq - Constructed sequence entries, part 204.
808. gbcon205.seq - Constructed sequence entries, part 205.
809. gbcon206.seq - Constructed sequence entries, part 206.
810. gbcon207.seq - Constructed sequence entries, part 207.
811. gbcon208.seq - Constructed sequence entries, part 208.
812. gbcon209.seq - Constructed sequence entries, part 209.
813. gbcon21.seq - Constructed sequence entries, part 21.
814. gbcon210.seq - Constructed sequence entries, part 210.
815. gbcon211.seq - Constructed sequence entries, part 211.
816. gbcon212.seq - Constructed sequence entries, part 212.
817. gbcon213.seq - Constructed sequence entries, part 213.
818. gbcon214.seq - Constructed sequence entries, part 214.
819. gbcon215.seq - Constructed sequence entries, part 215.
820. gbcon216.seq - Constructed sequence entries, part 216.
821. gbcon217.seq - Constructed sequence entries, part 217.
822. gbcon218.seq - Constructed sequence entries, part 218.
823. gbcon219.seq - Constructed sequence entries, part 219.
824. gbcon22.seq - Constructed sequence entries, part 22.
825. gbcon220.seq - Constructed sequence entries, part 220.
826. gbcon221.seq - Constructed sequence entries, part 221.
827. gbcon222.seq - Constructed sequence entries, part 222.
828. gbcon223.seq - Constructed sequence entries, part 223.
829. gbcon23.seq - Constructed sequence entries, part 23.
830. gbcon24.seq - Constructed sequence entries, part 24.
831. gbcon25.seq - Constructed sequence entries, part 25.
832. gbcon26.seq - Constructed sequence entries, part 26.
833. gbcon27.seq - Constructed sequence entries, part 27.
834. gbcon28.seq - Constructed sequence entries, part 28.
835. gbcon29.seq - Constructed sequence entries, part 29.
836. gbcon3.seq - Constructed sequence entries, part 3.
837. gbcon30.seq - Constructed sequence entries, part 30.
838. gbcon31.seq - Constructed sequence entries, part 31.
839. gbcon32.seq - Constructed sequence entries, part 32.
840. gbcon33.seq - Constructed sequence entries, part 33.
841. gbcon34.seq - Constructed sequence entries, part 34.
842. gbcon35.seq - Constructed sequence entries, part 35.
843. gbcon36.seq - Constructed sequence entries, part 36.
844. gbcon37.seq - Constructed sequence entries, part 37.
845. gbcon38.seq - Constructed sequence entries, part 38.
846. gbcon39.seq - Constructed sequence entries, part 39.
847. gbcon4.seq - Constructed sequence entries, part 4.
848. gbcon40.seq - Constructed sequence entries, part 40.
849. gbcon41.seq - Constructed sequence entries, part 41.
850. gbcon42.seq - Constructed sequence entries, part 42.
851. gbcon43.seq - Constructed sequence entries, part 43.
852. gbcon44.seq - Constructed sequence entries, part 44.
853. gbcon45.seq - Constructed sequence entries, part 45.
854. gbcon46.seq - Constructed sequence entries, part 46.
855. gbcon47.seq - Constructed sequence entries, part 47.
856. gbcon48.seq - Constructed sequence entries, part 48.
857. gbcon49.seq - Constructed sequence entries, part 49.
858. gbcon5.seq - Constructed sequence entries, part 5.
859. gbcon50.seq - Constructed sequence entries, part 50.
860. gbcon51.seq - Constructed sequence entries, part 51.
861. gbcon52.seq - Constructed sequence entries, part 52.
862. gbcon53.seq - Constructed sequence entries, part 53.
863. gbcon54.seq - Constructed sequence entries, part 54.
864. gbcon55.seq - Constructed sequence entries, part 55.
865. gbcon56.seq - Constructed sequence entries, part 56.
866. gbcon57.seq - Constructed sequence entries, part 57.
867. gbcon58.seq - Constructed sequence entries, part 58.
868. gbcon59.seq - Constructed sequence entries, part 59.
869. gbcon6.seq - Constructed sequence entries, part 6.
870. gbcon60.seq - Constructed sequence entries, part 60.
871. gbcon61.seq - Constructed sequence entries, part 61.
872. gbcon62.seq - Constructed sequence entries, part 62.
873. gbcon63.seq - Constructed sequence entries, part 63.
874. gbcon64.seq - Constructed sequence entries, part 64.
875. gbcon65.seq - Constructed sequence entries, part 65.
876. gbcon66.seq - Constructed sequence entries, part 66.
877. gbcon67.seq - Constructed sequence entries, part 67.
878. gbcon68.seq - Constructed sequence entries, part 68.
879. gbcon69.seq - Constructed sequence entries, part 69.
880. gbcon7.seq - Constructed sequence entries, part 7.
881. gbcon70.seq - Constructed sequence entries, part 70.
882. gbcon71.seq - Constructed sequence entries, part 71.
883. gbcon72.seq - Constructed sequence entries, part 72.
884. gbcon73.seq - Constructed sequence entries, part 73.
885. gbcon74.seq - Constructed sequence entries, part 74.
886. gbcon75.seq - Constructed sequence entries, part 75.
887. gbcon76.seq - Constructed sequence entries, part 76.
888. gbcon77.seq - Constructed sequence entries, part 77.
889. gbcon78.seq - Constructed sequence entries, part 78.
890. gbcon79.seq - Constructed sequence entries, part 79.
891. gbcon8.seq - Constructed sequence entries, part 8.
892. gbcon80.seq - Constructed sequence entries, part 80.
893. gbcon81.seq - Constructed sequence entries, part 81.
894. gbcon82.seq - Constructed sequence entries, part 82.
895. gbcon83.seq - Constructed sequence entries, part 83.
896. gbcon84.seq - Constructed sequence entries, part 84.
897. gbcon85.seq - Constructed sequence entries, part 85.
898. gbcon86.seq - Constructed sequence entries, part 86.
899. gbcon87.seq - Constructed sequence entries, part 87.
900. gbcon88.seq - Constructed sequence entries, part 88.
901. gbcon89.seq - Constructed sequence entries, part 89.
902. gbcon9.seq - Constructed sequence entries, part 9.
903. gbcon90.seq - Constructed sequence entries, part 90.
904. gbcon91.seq - Constructed sequence entries, part 91.
905. gbcon92.seq - Constructed sequence entries, part 92.
906. gbcon93.seq - Constructed sequence entries, part 93.
907. gbcon94.seq - Constructed sequence entries, part 94.
908. gbcon95.seq - Constructed sequence entries, part 95.
909. gbcon96.seq - Constructed sequence entries, part 96.
910. gbcon97.seq - Constructed sequence entries, part 97.
911. gbcon98.seq - Constructed sequence entries, part 98.
912. gbcon99.seq - Constructed sequence entries, part 99.
913. gbdel.txt - Accession numbers of entries deleted since the previous release.
914. gbenv1.seq - Environmental sampling sequence entries, part 1.
915. gbenv10.seq - Environmental sampling sequence entries, part 10.
916. gbenv11.seq - Environmental sampling sequence entries, part 11.
917. gbenv12.seq - Environmental sampling sequence entries, part 12.
918. gbenv13.seq - Environmental sampling sequence entries, part 13.
919. gbenv14.seq - Environmental sampling sequence entries, part 14.
920. gbenv15.seq - Environmental sampling sequence entries, part 15.
921. gbenv16.seq - Environmental sampling sequence entries, part 16.
922. gbenv17.seq - Environmental sampling sequence entries, part 17.
923. gbenv18.seq - Environmental sampling sequence entries, part 18.
924. gbenv19.seq - Environmental sampling sequence entries, part 19.
925. gbenv2.seq - Environmental sampling sequence entries, part 2.
926. gbenv20.seq - Environmental sampling sequence entries, part 20.
927. gbenv21.seq - Environmental sampling sequence entries, part 21.
928. gbenv22.seq - Environmental sampling sequence entries, part 22.
929. gbenv23.seq - Environmental sampling sequence entries, part 23.
930. gbenv24.seq - Environmental sampling sequence entries, part 24.
931. gbenv25.seq - Environmental sampling sequence entries, part 25.
932. gbenv26.seq - Environmental sampling sequence entries, part 26.
933. gbenv27.seq - Environmental sampling sequence entries, part 27.
934. gbenv28.seq - Environmental sampling sequence entries, part 28.
935. gbenv29.seq - Environmental sampling sequence entries, part 29.
936. gbenv3.seq - Environmental sampling sequence entries, part 3.
937. gbenv30.seq - Environmental sampling sequence entries, part 30.
938. gbenv31.seq - Environmental sampling sequence entries, part 31.
939. gbenv32.seq - Environmental sampling sequence entries, part 32.
940. gbenv33.seq - Environmental sampling sequence entries, part 33.
941. gbenv34.seq - Environmental sampling sequence entries, part 34.
942. gbenv35.seq - Environmental sampling sequence entries, part 35.
943. gbenv36.seq - Environmental sampling sequence entries, part 36.
944. gbenv37.seq - Environmental sampling sequence entries, part 37.
945. gbenv38.seq - Environmental sampling sequence entries, part 38.
946. gbenv39.seq - Environmental sampling sequence entries, part 39.
947. gbenv4.seq - Environmental sampling sequence entries, part 4.
948. gbenv40.seq - Environmental sampling sequence entries, part 40.
949. gbenv41.seq - Environmental sampling sequence entries, part 41.
950. gbenv42.seq - Environmental sampling sequence entries, part 42.
951. gbenv43.seq - Environmental sampling sequence entries, part 43.
952. gbenv44.seq - Environmental sampling sequence entries, part 44.
953. gbenv45.seq - Environmental sampling sequence entries, part 45.
954. gbenv46.seq - Environmental sampling sequence entries, part 46.
955. gbenv47.seq - Environmental sampling sequence entries, part 47.
956. gbenv48.seq - Environmental sampling sequence entries, part 48.
957. gbenv49.seq - Environmental sampling sequence entries, part 49.
958. gbenv5.seq - Environmental sampling sequence entries, part 5.
959. gbenv50.seq - Environmental sampling sequence entries, part 50.
960. gbenv51.seq - Environmental sampling sequence entries, part 51.
961. gbenv52.seq - Environmental sampling sequence entries, part 52.
962. gbenv53.seq - Environmental sampling sequence entries, part 53.
963. gbenv54.seq - Environmental sampling sequence entries, part 54.
964. gbenv55.seq - Environmental sampling sequence entries, part 55.
965. gbenv56.seq - Environmental sampling sequence entries, part 56.
966. gbenv57.seq - Environmental sampling sequence entries, part 57.
967. gbenv58.seq - Environmental sampling sequence entries, part 58.
968. gbenv59.seq - Environmental sampling sequence entries, part 59.
969. gbenv6.seq - Environmental sampling sequence entries, part 6.
970. gbenv60.seq - Environmental sampling sequence entries, part 60.
971. gbenv61.seq - Environmental sampling sequence entries, part 61.
972. gbenv62.seq - Environmental sampling sequence entries, part 62.
973. gbenv63.seq - Environmental sampling sequence entries, part 63.
974. gbenv64.seq - Environmental sampling sequence entries, part 64.
975. gbenv65.seq - Environmental sampling sequence entries, part 65.
976. gbenv66.seq - Environmental sampling sequence entries, part 66.
977. gbenv67.seq - Environmental sampling sequence entries, part 67.
978. gbenv68.seq - Environmental sampling sequence entries, part 68.
979. gbenv69.seq - Environmental sampling sequence entries, part 69.
980. gbenv7.seq - Environmental sampling sequence entries, part 7.
981. gbenv70.seq - Environmental sampling sequence entries, part 70.
982. gbenv8.seq - Environmental sampling sequence entries, part 8.
983. gbenv9.seq - Environmental sampling sequence entries, part 9.
984. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
985. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
986. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
987. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
988. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
989. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
990. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
991. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
992. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
993. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
994. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
995. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
996. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
997. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
998. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
999. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
1000. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
1001. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
1002. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
1003. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
1004. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
1005. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
1006. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
1007. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
1008. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
1009. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
1010. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
1011. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
1012. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
1013. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
1014. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
1015. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
1016. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
1017. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
1018. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
1019. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
1020. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
1021. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
1022. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
1023. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
1024. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
1025. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
1026. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
1027. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
1028. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
1029. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
1030. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
1031. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
1032. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
1033. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
1034. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
1035. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
1036. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
1037. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
1038. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
1039. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
1040. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
1041. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
1042. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
1043. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
1044. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
1045. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
1046. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
1047. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
1048. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
1049. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
1050. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
1051. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
1052. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
1053. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
1054. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
1055. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
1056. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
1057. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
1058. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
1059. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
1060. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
1061. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
1062. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
1063. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
1064. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
1065. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
1066. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
1067. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
1068. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
1069. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
1070. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
1071. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
1072. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
1073. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
1074. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
1075. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
1076. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
1077. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
1078. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
1079. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
1080. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
1081. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
1082. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
1083. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
1084. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
1085. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
1086. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
1087. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
1088. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
1089. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
1090. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
1091. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
1092. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
1093. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
1094. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
1095. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
1096. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
1097. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
1098. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
1099. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
1100. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
1101. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
1102. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
1103. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
1104. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
1105. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
1106. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
1107. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
1108. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
1109. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
1110. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
1111. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
1112. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
1113. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
1114. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
1115. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
1116. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
1117. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
1118. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
1119. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
1120. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
1121. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
1122. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
1123. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
1124. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
1125. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
1126. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
1127. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
1128. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
1129. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
1130. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
1131. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
1132. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
1133. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
1134. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
1135. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
1136. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
1137. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
1138. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
1139. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
1140. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
1141. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
1142. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
1143. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
1144. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
1145. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
1146. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
1147. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
1148. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
1149. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
1150. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
1151. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
1152. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
1153. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
1154. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
1155. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
1156. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
1157. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
1158. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
1159. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
1160. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
1161. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
1162. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
1163. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
1164. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
1165. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
1166. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
1167. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
1168. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
1169. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
1170. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
1171. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
1172. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
1173. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
1174. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
1175. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
1176. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
1177. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
1178. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
1179. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
1180. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
1181. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
1182. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
1183. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
1184. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
1185. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
1186. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
1187. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
1188. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
1189. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
1190. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
1191. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
1192. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
1193. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
1194. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
1195. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
1196. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
1197. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
1198. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
1199. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
1200. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
1201. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
1202. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
1203. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
1204. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
1205. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
1206. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
1207. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
1208. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
1209. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
1210. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
1211. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1212. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1213. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1214. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1215. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1216. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1217. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1218. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1219. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1220. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1221. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1222. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1223. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1224. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1225. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1226. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1227. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1228. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1229. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1230. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1231. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1232. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1233. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1234. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1235. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1236. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1237. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1238. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1239. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1240. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1241. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1242. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1243. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1244. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1245. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1246. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1247. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1248. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1249. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1250. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1251. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1252. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1253. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1254. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1255. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1256. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1257. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1258. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1259. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1260. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1261. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1262. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1263. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1264. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1265. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1266. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1267. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1268. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1269. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1270. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1271. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1272. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1273. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1274. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1275. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1276. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1277. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1278. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1279. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1280. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1281. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1282. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1283. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1284. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1285. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1286. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1287. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1288. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1289. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1290. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1291. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1292. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1293. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1294. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1295. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1296. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1297. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1298. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1299. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1300. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1301. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1302. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1303. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1304. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1305. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1306. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1307. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1308. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1309. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1310. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1311. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1312. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1313. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1314. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1315. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1316. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1317. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1318. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1319. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1320. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1321. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1322. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1323. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1324. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1325. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1326. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1327. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1328. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1329. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1330. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1331. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1332. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1333. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1334. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1335. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1336. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1337. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1338. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1339. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1340. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1341. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1342. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1343. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1344. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1345. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1346. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1347. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1348. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1349. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1350. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1351. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1352. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1353. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1354. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1355. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1356. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1357. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1358. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1359. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1360. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1361. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1362. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1363. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1364. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1365. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1366. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1367. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1368. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1369. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1370. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1371. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1372. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1373. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1374. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1375. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1376. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1377. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1378. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1379. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1380. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1381. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1382. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1383. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1384. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1385. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1386. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1387. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1388. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1389. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1390. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1391. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1392. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1393. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1394. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1395. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1396. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1397. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1398. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1399. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1400. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1401. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1402. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1403. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1404. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1405. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1406. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1407. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1408. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1409. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1410. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1411. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
1412. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
1413. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
1414. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
1415. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
1416. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
1417. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1418. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
1419. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
1420. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
1421. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
1422. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
1423. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
1424. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
1425. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
1426. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
1427. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
1428. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1429. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1430. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
1431. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
1432. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
1433. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
1434. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
1435. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
1436. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
1437. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
1438. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
1439. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
1440. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1441. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
1442. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
1443. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
1444. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
1445. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
1446. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
1447. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
1448. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
1449. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
1450. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
1451. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1452. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
1453. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
1454. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
1455. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
1456. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
1457. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
1458. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
1459. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
1460. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
1461. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
1462. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1463. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
1464. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
1465. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
1466. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
1467. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
1468. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
1469. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
1470. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
1471. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
1472. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
1473. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1474. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
1475. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
1476. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
1477. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
1478. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
1479. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
1480. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
1481. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
1482. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
1483. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
1484. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1485. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
1486. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
1487. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
1488. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
1489. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
1490. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
1491. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
1492. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
1493. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
1494. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
1495. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1496. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
1497. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
1498. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
1499. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
1500. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
1501. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
1502. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
1503. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
1504. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
1505. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
1506. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1507. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
1508. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
1509. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
1510. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
1511. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
1512. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
1513. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1514. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1515. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1516. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1517. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1518. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1519. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1520. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1521. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1522. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1523. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1524. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1525. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1526. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1527. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1528. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1529. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1530. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1531. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1532. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1533. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1534. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1535. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1536. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1537. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1538. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1539. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1540. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1541. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1542. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1543. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1544. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1545. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1546. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1547. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1548. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1549. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1550. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1551. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1552. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1553. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1554. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1555. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1556. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1557. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1558. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1559. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1560. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1561. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1562. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1563. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1564. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1565. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1566. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1567. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1568. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1569. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1570. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1571. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1572. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1573. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1574. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1575. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1576. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1577. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1578. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1579. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1580. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1581. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1582. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1583. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1584. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1585. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1586. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1587. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1588. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1589. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1590. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1591. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1592. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1593. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1594. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1595. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1596. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1597. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1598. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1599. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1600. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1601. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1602. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1603. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1604. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1605. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1606. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1607. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1608. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1609. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1610. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1611. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1612. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1613. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1614. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1615. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1616. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1617. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1618. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1619. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1620. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1621. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1622. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1623. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1624. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1625. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1626. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1627. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1628. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1629. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1630. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1631. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1632. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1633. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1634. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1635. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1636. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1637. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1638. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1639. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1640. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1641. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1642. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1643. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1644. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1645. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1646. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1647. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1648. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1649. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1650. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1651. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1652. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1653. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1654. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1655. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1656. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1657. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1658. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1659. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1660. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1661. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1662. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1663. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1664. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1665. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1666. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1667. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1668. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1669. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1670. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1671. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1672. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1673. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1674. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1675. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1676. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1677. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1678. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1679. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1680. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1681. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1682. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1683. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1684. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1685. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1686. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1687. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1688. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1689. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1690. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1691. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1692. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1693. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1694. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1695. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1696. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1697. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1698. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1699. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1700. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1701. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1702. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1703. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1704. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1705. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1706. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1707. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1708. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1709. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1710. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1711. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1712. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1713. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1714. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1715. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1716. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1717. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1718. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1719. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1720. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1721. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1722. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1723. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1724. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1725. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1726. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1727. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1728. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1729. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1730. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1731. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1732. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1733. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1734. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1735. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1736. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1737. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1738. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1739. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1740. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1741. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1742. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1743. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1744. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1745. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1746. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1747. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1748. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1749. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1750. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1751. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1752. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1753. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1754. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1755. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1756. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1757. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1758. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1759. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1760. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1761. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1762. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1763. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1764. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1765. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1766. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1767. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1768. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1769. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1770. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1771. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1772. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1773. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1774. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1775. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1776. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1777. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1778. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1779. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1780. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1781. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1782. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1783. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1784. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1785. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1786. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1787. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1788. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1789. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1790. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1791. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1792. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1793. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1794. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1795. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1796. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1797. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1798. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1799. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1800. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1801. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1802. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1803. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1804. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1805. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1806. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1807. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1808. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1809. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1810. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1811. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1812. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1813. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1814. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1815. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1816. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1817. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1818. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1819. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1820. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1821. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1822. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1823. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1824. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1825. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1826. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1827. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1828. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1829. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1830. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1831. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1832. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1833. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1834. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1835. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1836. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1837. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1838. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1839. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1840. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1841. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1842. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1843. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1844. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1845. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1846. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1847. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1848. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1849. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1850. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1851. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1852. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1853. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1854. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1855. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1856. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1857. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1858. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1859. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1860. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1861. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1862. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1863. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1864. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1865. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1866. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1867. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1868. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1869. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1870. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1871. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1872. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1873. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1874. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1875. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1876. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1877. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1878. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1879. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1880. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1881. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1882. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1883. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1884. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1885. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1886. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1887. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1888. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1889. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1890. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1891. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1892. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1893. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1894. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1895. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1896. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1897. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1898. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1899. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1900. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1901. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1902. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1903. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1904. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1905. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1906. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1907. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1908. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1909. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1910. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1911. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1912. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1913. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1914. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1915. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1916. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1917. gbinv1.seq - Invertebrate sequence entries, part 1.
1918. gbinv10.seq - Invertebrate sequence entries, part 10.
1919. gbinv100.seq - Invertebrate sequence entries, part 100.
1920. gbinv101.seq - Invertebrate sequence entries, part 101.
1921. gbinv102.seq - Invertebrate sequence entries, part 102.
1922. gbinv103.seq - Invertebrate sequence entries, part 103.
1923. gbinv104.seq - Invertebrate sequence entries, part 104.
1924. gbinv105.seq - Invertebrate sequence entries, part 105.
1925. gbinv106.seq - Invertebrate sequence entries, part 106.
1926. gbinv107.seq - Invertebrate sequence entries, part 107.
1927. gbinv108.seq - Invertebrate sequence entries, part 108.
1928. gbinv109.seq - Invertebrate sequence entries, part 109.
1929. gbinv11.seq - Invertebrate sequence entries, part 11.
1930. gbinv110.seq - Invertebrate sequence entries, part 110.
1931. gbinv111.seq - Invertebrate sequence entries, part 111.
1932. gbinv112.seq - Invertebrate sequence entries, part 112.
1933. gbinv113.seq - Invertebrate sequence entries, part 113.
1934. gbinv114.seq - Invertebrate sequence entries, part 114.
1935. gbinv115.seq - Invertebrate sequence entries, part 115.
1936. gbinv116.seq - Invertebrate sequence entries, part 116.
1937. gbinv117.seq - Invertebrate sequence entries, part 117.
1938. gbinv118.seq - Invertebrate sequence entries, part 118.
1939. gbinv119.seq - Invertebrate sequence entries, part 119.
1940. gbinv12.seq - Invertebrate sequence entries, part 12.
1941. gbinv120.seq - Invertebrate sequence entries, part 120.
1942. gbinv121.seq - Invertebrate sequence entries, part 121.
1943. gbinv122.seq - Invertebrate sequence entries, part 122.
1944. gbinv123.seq - Invertebrate sequence entries, part 123.
1945. gbinv124.seq - Invertebrate sequence entries, part 124.
1946. gbinv125.seq - Invertebrate sequence entries, part 125.
1947. gbinv126.seq - Invertebrate sequence entries, part 126.
1948. gbinv127.seq - Invertebrate sequence entries, part 127.
1949. gbinv128.seq - Invertebrate sequence entries, part 128.
1950. gbinv129.seq - Invertebrate sequence entries, part 129.
1951. gbinv13.seq - Invertebrate sequence entries, part 13.
1952. gbinv130.seq - Invertebrate sequence entries, part 130.
1953. gbinv131.seq - Invertebrate sequence entries, part 131.
1954. gbinv132.seq - Invertebrate sequence entries, part 132.
1955. gbinv133.seq - Invertebrate sequence entries, part 133.
1956. gbinv134.seq - Invertebrate sequence entries, part 134.
1957. gbinv135.seq - Invertebrate sequence entries, part 135.
1958. gbinv136.seq - Invertebrate sequence entries, part 136.
1959. gbinv137.seq - Invertebrate sequence entries, part 137.
1960. gbinv138.seq - Invertebrate sequence entries, part 138.
1961. gbinv139.seq - Invertebrate sequence entries, part 139.
1962. gbinv14.seq - Invertebrate sequence entries, part 14.
1963. gbinv140.seq - Invertebrate sequence entries, part 140.
1964. gbinv141.seq - Invertebrate sequence entries, part 141.
1965. gbinv142.seq - Invertebrate sequence entries, part 142.
1966. gbinv143.seq - Invertebrate sequence entries, part 143.
1967. gbinv144.seq - Invertebrate sequence entries, part 144.
1968. gbinv145.seq - Invertebrate sequence entries, part 145.
1969. gbinv146.seq - Invertebrate sequence entries, part 146.
1970. gbinv147.seq - Invertebrate sequence entries, part 147.
1971. gbinv148.seq - Invertebrate sequence entries, part 148.
1972. gbinv149.seq - Invertebrate sequence entries, part 149.
1973. gbinv15.seq - Invertebrate sequence entries, part 15.
1974. gbinv150.seq - Invertebrate sequence entries, part 150.
1975. gbinv151.seq - Invertebrate sequence entries, part 151.
1976. gbinv152.seq - Invertebrate sequence entries, part 152.
1977. gbinv153.seq - Invertebrate sequence entries, part 153.
1978. gbinv154.seq - Invertebrate sequence entries, part 154.
1979. gbinv155.seq - Invertebrate sequence entries, part 155.
1980. gbinv156.seq - Invertebrate sequence entries, part 156.
1981. gbinv157.seq - Invertebrate sequence entries, part 157.
1982. gbinv158.seq - Invertebrate sequence entries, part 158.
1983. gbinv159.seq - Invertebrate sequence entries, part 159.
1984. gbinv16.seq - Invertebrate sequence entries, part 16.
1985. gbinv160.seq - Invertebrate sequence entries, part 160.
1986. gbinv161.seq - Invertebrate sequence entries, part 161.
1987. gbinv162.seq - Invertebrate sequence entries, part 162.
1988. gbinv163.seq - Invertebrate sequence entries, part 163.
1989. gbinv164.seq - Invertebrate sequence entries, part 164.
1990. gbinv165.seq - Invertebrate sequence entries, part 165.
1991. gbinv166.seq - Invertebrate sequence entries, part 166.
1992. gbinv167.seq - Invertebrate sequence entries, part 167.
1993. gbinv168.seq - Invertebrate sequence entries, part 168.
1994. gbinv169.seq - Invertebrate sequence entries, part 169.
1995. gbinv17.seq - Invertebrate sequence entries, part 17.
1996. gbinv170.seq - Invertebrate sequence entries, part 170.
1997. gbinv171.seq - Invertebrate sequence entries, part 171.
1998. gbinv172.seq - Invertebrate sequence entries, part 172.
1999. gbinv173.seq - Invertebrate sequence entries, part 173.
2000. gbinv174.seq - Invertebrate sequence entries, part 174.
2001. gbinv175.seq - Invertebrate sequence entries, part 175.
2002. gbinv176.seq - Invertebrate sequence entries, part 176.
2003. gbinv177.seq - Invertebrate sequence entries, part 177.
2004. gbinv178.seq - Invertebrate sequence entries, part 178.
2005. gbinv179.seq - Invertebrate sequence entries, part 179.
2006. gbinv18.seq - Invertebrate sequence entries, part 18.
2007. gbinv180.seq - Invertebrate sequence entries, part 180.
2008. gbinv181.seq - Invertebrate sequence entries, part 181.
2009. gbinv182.seq - Invertebrate sequence entries, part 182.
2010. gbinv183.seq - Invertebrate sequence entries, part 183.
2011. gbinv184.seq - Invertebrate sequence entries, part 184.
2012. gbinv185.seq - Invertebrate sequence entries, part 185.
2013. gbinv186.seq - Invertebrate sequence entries, part 186.
2014. gbinv187.seq - Invertebrate sequence entries, part 187.
2015. gbinv188.seq - Invertebrate sequence entries, part 188.
2016. gbinv189.seq - Invertebrate sequence entries, part 189.
2017. gbinv19.seq - Invertebrate sequence entries, part 19.
2018. gbinv190.seq - Invertebrate sequence entries, part 190.
2019. gbinv191.seq - Invertebrate sequence entries, part 191.
2020. gbinv192.seq - Invertebrate sequence entries, part 192.
2021. gbinv193.seq - Invertebrate sequence entries, part 193.
2022. gbinv194.seq - Invertebrate sequence entries, part 194.
2023. gbinv195.seq - Invertebrate sequence entries, part 195.
2024. gbinv196.seq - Invertebrate sequence entries, part 196.
2025. gbinv197.seq - Invertebrate sequence entries, part 197.
2026. gbinv198.seq - Invertebrate sequence entries, part 198.
2027. gbinv199.seq - Invertebrate sequence entries, part 199.
2028. gbinv2.seq - Invertebrate sequence entries, part 2.
2029. gbinv20.seq - Invertebrate sequence entries, part 20.
2030. gbinv200.seq - Invertebrate sequence entries, part 200.
2031. gbinv201.seq - Invertebrate sequence entries, part 201.
2032. gbinv202.seq - Invertebrate sequence entries, part 202.
2033. gbinv203.seq - Invertebrate sequence entries, part 203.
2034. gbinv204.seq - Invertebrate sequence entries, part 204.
2035. gbinv205.seq - Invertebrate sequence entries, part 205.
2036. gbinv206.seq - Invertebrate sequence entries, part 206.
2037. gbinv207.seq - Invertebrate sequence entries, part 207.
2038. gbinv208.seq - Invertebrate sequence entries, part 208.
2039. gbinv209.seq - Invertebrate sequence entries, part 209.
2040. gbinv21.seq - Invertebrate sequence entries, part 21.
2041. gbinv210.seq - Invertebrate sequence entries, part 210.
2042. gbinv211.seq - Invertebrate sequence entries, part 211.
2043. gbinv212.seq - Invertebrate sequence entries, part 212.
2044. gbinv213.seq - Invertebrate sequence entries, part 213.
2045. gbinv214.seq - Invertebrate sequence entries, part 214.
2046. gbinv215.seq - Invertebrate sequence entries, part 215.
2047. gbinv216.seq - Invertebrate sequence entries, part 216.
2048. gbinv217.seq - Invertebrate sequence entries, part 217.
2049. gbinv218.seq - Invertebrate sequence entries, part 218.
2050. gbinv219.seq - Invertebrate sequence entries, part 219.
2051. gbinv22.seq - Invertebrate sequence entries, part 22.
2052. gbinv220.seq - Invertebrate sequence entries, part 220.
2053. gbinv221.seq - Invertebrate sequence entries, part 221.
2054. gbinv222.seq - Invertebrate sequence entries, part 222.
2055. gbinv223.seq - Invertebrate sequence entries, part 223.
2056. gbinv224.seq - Invertebrate sequence entries, part 224.
2057. gbinv225.seq - Invertebrate sequence entries, part 225.
2058. gbinv226.seq - Invertebrate sequence entries, part 226.
2059. gbinv227.seq - Invertebrate sequence entries, part 227.
2060. gbinv228.seq - Invertebrate sequence entries, part 228.
2061. gbinv229.seq - Invertebrate sequence entries, part 229.
2062. gbinv23.seq - Invertebrate sequence entries, part 23.
2063. gbinv230.seq - Invertebrate sequence entries, part 230.
2064. gbinv231.seq - Invertebrate sequence entries, part 231.
2065. gbinv232.seq - Invertebrate sequence entries, part 232.
2066. gbinv233.seq - Invertebrate sequence entries, part 233.
2067. gbinv234.seq - Invertebrate sequence entries, part 234.
2068. gbinv235.seq - Invertebrate sequence entries, part 235.
2069. gbinv236.seq - Invertebrate sequence entries, part 236.
2070. gbinv237.seq - Invertebrate sequence entries, part 237.
2071. gbinv238.seq - Invertebrate sequence entries, part 238.
2072. gbinv239.seq - Invertebrate sequence entries, part 239.
2073. gbinv24.seq - Invertebrate sequence entries, part 24.
2074. gbinv240.seq - Invertebrate sequence entries, part 240.
2075. gbinv241.seq - Invertebrate sequence entries, part 241.
2076. gbinv242.seq - Invertebrate sequence entries, part 242.
2077. gbinv243.seq - Invertebrate sequence entries, part 243.
2078. gbinv244.seq - Invertebrate sequence entries, part 244.
2079. gbinv245.seq - Invertebrate sequence entries, part 245.
2080. gbinv246.seq - Invertebrate sequence entries, part 246.
2081. gbinv247.seq - Invertebrate sequence entries, part 247.
2082. gbinv248.seq - Invertebrate sequence entries, part 248.
2083. gbinv249.seq - Invertebrate sequence entries, part 249.
2084. gbinv25.seq - Invertebrate sequence entries, part 25.
2085. gbinv250.seq - Invertebrate sequence entries, part 250.
2086. gbinv251.seq - Invertebrate sequence entries, part 251.
2087. gbinv252.seq - Invertebrate sequence entries, part 252.
2088. gbinv253.seq - Invertebrate sequence entries, part 253.
2089. gbinv254.seq - Invertebrate sequence entries, part 254.
2090. gbinv255.seq - Invertebrate sequence entries, part 255.
2091. gbinv256.seq - Invertebrate sequence entries, part 256.
2092. gbinv257.seq - Invertebrate sequence entries, part 257.
2093. gbinv258.seq - Invertebrate sequence entries, part 258.
2094. gbinv259.seq - Invertebrate sequence entries, part 259.
2095. gbinv26.seq - Invertebrate sequence entries, part 26.
2096. gbinv260.seq - Invertebrate sequence entries, part 260.
2097. gbinv261.seq - Invertebrate sequence entries, part 261.
2098. gbinv262.seq - Invertebrate sequence entries, part 262.
2099. gbinv263.seq - Invertebrate sequence entries, part 263.
2100. gbinv264.seq - Invertebrate sequence entries, part 264.
2101. gbinv265.seq - Invertebrate sequence entries, part 265.
2102. gbinv266.seq - Invertebrate sequence entries, part 266.
2103. gbinv267.seq - Invertebrate sequence entries, part 267.
2104. gbinv268.seq - Invertebrate sequence entries, part 268.
2105. gbinv269.seq - Invertebrate sequence entries, part 269.
2106. gbinv27.seq - Invertebrate sequence entries, part 27.
2107. gbinv270.seq - Invertebrate sequence entries, part 270.
2108. gbinv271.seq - Invertebrate sequence entries, part 271.
2109. gbinv272.seq - Invertebrate sequence entries, part 272.
2110. gbinv273.seq - Invertebrate sequence entries, part 273.
2111. gbinv274.seq - Invertebrate sequence entries, part 274.
2112. gbinv275.seq - Invertebrate sequence entries, part 275.
2113. gbinv276.seq - Invertebrate sequence entries, part 276.
2114. gbinv277.seq - Invertebrate sequence entries, part 277.
2115. gbinv278.seq - Invertebrate sequence entries, part 278.
2116. gbinv279.seq - Invertebrate sequence entries, part 279.
2117. gbinv28.seq - Invertebrate sequence entries, part 28.
2118. gbinv280.seq - Invertebrate sequence entries, part 280.
2119. gbinv281.seq - Invertebrate sequence entries, part 281.
2120. gbinv282.seq - Invertebrate sequence entries, part 282.
2121. gbinv283.seq - Invertebrate sequence entries, part 283.
2122. gbinv284.seq - Invertebrate sequence entries, part 284.
2123. gbinv285.seq - Invertebrate sequence entries, part 285.
2124. gbinv286.seq - Invertebrate sequence entries, part 286.
2125. gbinv287.seq - Invertebrate sequence entries, part 287.
2126. gbinv288.seq - Invertebrate sequence entries, part 288.
2127. gbinv289.seq - Invertebrate sequence entries, part 289.
2128. gbinv29.seq - Invertebrate sequence entries, part 29.
2129. gbinv290.seq - Invertebrate sequence entries, part 290.
2130. gbinv291.seq - Invertebrate sequence entries, part 291.
2131. gbinv292.seq - Invertebrate sequence entries, part 292.
2132. gbinv293.seq - Invertebrate sequence entries, part 293.
2133. gbinv294.seq - Invertebrate sequence entries, part 294.
2134. gbinv295.seq - Invertebrate sequence entries, part 295.
2135. gbinv296.seq - Invertebrate sequence entries, part 296.
2136. gbinv297.seq - Invertebrate sequence entries, part 297.
2137. gbinv298.seq - Invertebrate sequence entries, part 298.
2138. gbinv299.seq - Invertebrate sequence entries, part 299.
2139. gbinv3.seq - Invertebrate sequence entries, part 3.
2140. gbinv30.seq - Invertebrate sequence entries, part 30.
2141. gbinv300.seq - Invertebrate sequence entries, part 300.
2142. gbinv301.seq - Invertebrate sequence entries, part 301.
2143. gbinv302.seq - Invertebrate sequence entries, part 302.
2144. gbinv303.seq - Invertebrate sequence entries, part 303.
2145. gbinv304.seq - Invertebrate sequence entries, part 304.
2146. gbinv305.seq - Invertebrate sequence entries, part 305.
2147. gbinv306.seq - Invertebrate sequence entries, part 306.
2148. gbinv307.seq - Invertebrate sequence entries, part 307.
2149. gbinv308.seq - Invertebrate sequence entries, part 308.
2150. gbinv309.seq - Invertebrate sequence entries, part 309.
2151. gbinv31.seq - Invertebrate sequence entries, part 31.
2152. gbinv310.seq - Invertebrate sequence entries, part 310.
2153. gbinv311.seq - Invertebrate sequence entries, part 311.
2154. gbinv312.seq - Invertebrate sequence entries, part 312.
2155. gbinv313.seq - Invertebrate sequence entries, part 313.
2156. gbinv314.seq - Invertebrate sequence entries, part 314.
2157. gbinv315.seq - Invertebrate sequence entries, part 315.
2158. gbinv316.seq - Invertebrate sequence entries, part 316.
2159. gbinv317.seq - Invertebrate sequence entries, part 317.
2160. gbinv318.seq - Invertebrate sequence entries, part 318.
2161. gbinv319.seq - Invertebrate sequence entries, part 319.
2162. gbinv32.seq - Invertebrate sequence entries, part 32.
2163. gbinv320.seq - Invertebrate sequence entries, part 320.
2164. gbinv321.seq - Invertebrate sequence entries, part 321.
2165. gbinv322.seq - Invertebrate sequence entries, part 322.
2166. gbinv323.seq - Invertebrate sequence entries, part 323.
2167. gbinv324.seq - Invertebrate sequence entries, part 324.
2168. gbinv325.seq - Invertebrate sequence entries, part 325.
2169. gbinv326.seq - Invertebrate sequence entries, part 326.
2170. gbinv327.seq - Invertebrate sequence entries, part 327.
2171. gbinv328.seq - Invertebrate sequence entries, part 328.
2172. gbinv329.seq - Invertebrate sequence entries, part 329.
2173. gbinv33.seq - Invertebrate sequence entries, part 33.
2174. gbinv330.seq - Invertebrate sequence entries, part 330.
2175. gbinv331.seq - Invertebrate sequence entries, part 331.
2176. gbinv332.seq - Invertebrate sequence entries, part 332.
2177. gbinv333.seq - Invertebrate sequence entries, part 333.
2178. gbinv334.seq - Invertebrate sequence entries, part 334.
2179. gbinv335.seq - Invertebrate sequence entries, part 335.
2180. gbinv336.seq - Invertebrate sequence entries, part 336.
2181. gbinv337.seq - Invertebrate sequence entries, part 337.
2182. gbinv338.seq - Invertebrate sequence entries, part 338.
2183. gbinv339.seq - Invertebrate sequence entries, part 339.
2184. gbinv34.seq - Invertebrate sequence entries, part 34.
2185. gbinv340.seq - Invertebrate sequence entries, part 340.
2186. gbinv341.seq - Invertebrate sequence entries, part 341.
2187. gbinv342.seq - Invertebrate sequence entries, part 342.
2188. gbinv343.seq - Invertebrate sequence entries, part 343.
2189. gbinv344.seq - Invertebrate sequence entries, part 344.
2190. gbinv345.seq - Invertebrate sequence entries, part 345.
2191. gbinv346.seq - Invertebrate sequence entries, part 346.
2192. gbinv347.seq - Invertebrate sequence entries, part 347.
2193. gbinv348.seq - Invertebrate sequence entries, part 348.
2194. gbinv349.seq - Invertebrate sequence entries, part 349.
2195. gbinv35.seq - Invertebrate sequence entries, part 35.
2196. gbinv350.seq - Invertebrate sequence entries, part 350.
2197. gbinv351.seq - Invertebrate sequence entries, part 351.
2198. gbinv352.seq - Invertebrate sequence entries, part 352.
2199. gbinv353.seq - Invertebrate sequence entries, part 353.
2200. gbinv354.seq - Invertebrate sequence entries, part 354.
2201. gbinv355.seq - Invertebrate sequence entries, part 355.
2202. gbinv356.seq - Invertebrate sequence entries, part 356.
2203. gbinv357.seq - Invertebrate sequence entries, part 357.
2204. gbinv358.seq - Invertebrate sequence entries, part 358.
2205. gbinv359.seq - Invertebrate sequence entries, part 359.
2206. gbinv36.seq - Invertebrate sequence entries, part 36.
2207. gbinv360.seq - Invertebrate sequence entries, part 360.
2208. gbinv361.seq - Invertebrate sequence entries, part 361.
2209. gbinv362.seq - Invertebrate sequence entries, part 362.
2210. gbinv363.seq - Invertebrate sequence entries, part 363.
2211. gbinv364.seq - Invertebrate sequence entries, part 364.
2212. gbinv365.seq - Invertebrate sequence entries, part 365.
2213. gbinv366.seq - Invertebrate sequence entries, part 366.
2214. gbinv367.seq - Invertebrate sequence entries, part 367.
2215. gbinv368.seq - Invertebrate sequence entries, part 368.
2216. gbinv369.seq - Invertebrate sequence entries, part 369.
2217. gbinv37.seq - Invertebrate sequence entries, part 37.
2218. gbinv370.seq - Invertebrate sequence entries, part 370.
2219. gbinv371.seq - Invertebrate sequence entries, part 371.
2220. gbinv372.seq - Invertebrate sequence entries, part 372.
2221. gbinv373.seq - Invertebrate sequence entries, part 373.
2222. gbinv374.seq - Invertebrate sequence entries, part 374.
2223. gbinv375.seq - Invertebrate sequence entries, part 375.
2224. gbinv376.seq - Invertebrate sequence entries, part 376.
2225. gbinv377.seq - Invertebrate sequence entries, part 377.
2226. gbinv378.seq - Invertebrate sequence entries, part 378.
2227. gbinv379.seq - Invertebrate sequence entries, part 379.
2228. gbinv38.seq - Invertebrate sequence entries, part 38.
2229. gbinv380.seq - Invertebrate sequence entries, part 380.
2230. gbinv381.seq - Invertebrate sequence entries, part 381.
2231. gbinv382.seq - Invertebrate sequence entries, part 382.
2232. gbinv383.seq - Invertebrate sequence entries, part 383.
2233. gbinv384.seq - Invertebrate sequence entries, part 384.
2234. gbinv385.seq - Invertebrate sequence entries, part 385.
2235. gbinv386.seq - Invertebrate sequence entries, part 386.
2236. gbinv387.seq - Invertebrate sequence entries, part 387.
2237. gbinv388.seq - Invertebrate sequence entries, part 388.
2238. gbinv389.seq - Invertebrate sequence entries, part 389.
2239. gbinv39.seq - Invertebrate sequence entries, part 39.
2240. gbinv390.seq - Invertebrate sequence entries, part 390.
2241. gbinv391.seq - Invertebrate sequence entries, part 391.
2242. gbinv392.seq - Invertebrate sequence entries, part 392.
2243. gbinv393.seq - Invertebrate sequence entries, part 393.
2244. gbinv394.seq - Invertebrate sequence entries, part 394.
2245. gbinv395.seq - Invertebrate sequence entries, part 395.
2246. gbinv396.seq - Invertebrate sequence entries, part 396.
2247. gbinv397.seq - Invertebrate sequence entries, part 397.
2248. gbinv398.seq - Invertebrate sequence entries, part 398.
2249. gbinv399.seq - Invertebrate sequence entries, part 399.
2250. gbinv4.seq - Invertebrate sequence entries, part 4.
2251. gbinv40.seq - Invertebrate sequence entries, part 40.
2252. gbinv400.seq - Invertebrate sequence entries, part 400.
2253. gbinv401.seq - Invertebrate sequence entries, part 401.
2254. gbinv402.seq - Invertebrate sequence entries, part 402.
2255. gbinv403.seq - Invertebrate sequence entries, part 403.
2256. gbinv404.seq - Invertebrate sequence entries, part 404.
2257. gbinv405.seq - Invertebrate sequence entries, part 405.
2258. gbinv406.seq - Invertebrate sequence entries, part 406.
2259. gbinv407.seq - Invertebrate sequence entries, part 407.
2260. gbinv408.seq - Invertebrate sequence entries, part 408.
2261. gbinv409.seq - Invertebrate sequence entries, part 409.
2262. gbinv41.seq - Invertebrate sequence entries, part 41.
2263. gbinv410.seq - Invertebrate sequence entries, part 410.
2264. gbinv411.seq - Invertebrate sequence entries, part 411.
2265. gbinv412.seq - Invertebrate sequence entries, part 412.
2266. gbinv413.seq - Invertebrate sequence entries, part 413.
2267. gbinv414.seq - Invertebrate sequence entries, part 414.
2268. gbinv415.seq - Invertebrate sequence entries, part 415.
2269. gbinv416.seq - Invertebrate sequence entries, part 416.
2270. gbinv417.seq - Invertebrate sequence entries, part 417.
2271. gbinv418.seq - Invertebrate sequence entries, part 418.
2272. gbinv419.seq - Invertebrate sequence entries, part 419.
2273. gbinv42.seq - Invertebrate sequence entries, part 42.
2274. gbinv420.seq - Invertebrate sequence entries, part 420.
2275. gbinv421.seq - Invertebrate sequence entries, part 421.
2276. gbinv422.seq - Invertebrate sequence entries, part 422.
2277. gbinv423.seq - Invertebrate sequence entries, part 423.
2278. gbinv424.seq - Invertebrate sequence entries, part 424.
2279. gbinv425.seq - Invertebrate sequence entries, part 425.
2280. gbinv426.seq - Invertebrate sequence entries, part 426.
2281. gbinv427.seq - Invertebrate sequence entries, part 427.
2282. gbinv428.seq - Invertebrate sequence entries, part 428.
2283. gbinv429.seq - Invertebrate sequence entries, part 429.
2284. gbinv43.seq - Invertebrate sequence entries, part 43.
2285. gbinv430.seq - Invertebrate sequence entries, part 430.
2286. gbinv431.seq - Invertebrate sequence entries, part 431.
2287. gbinv432.seq - Invertebrate sequence entries, part 432.
2288. gbinv433.seq - Invertebrate sequence entries, part 433.
2289. gbinv434.seq - Invertebrate sequence entries, part 434.
2290. gbinv435.seq - Invertebrate sequence entries, part 435.
2291. gbinv436.seq - Invertebrate sequence entries, part 436.
2292. gbinv437.seq - Invertebrate sequence entries, part 437.
2293. gbinv438.seq - Invertebrate sequence entries, part 438.
2294. gbinv439.seq - Invertebrate sequence entries, part 439.
2295. gbinv44.seq - Invertebrate sequence entries, part 44.
2296. gbinv440.seq - Invertebrate sequence entries, part 440.
2297. gbinv441.seq - Invertebrate sequence entries, part 441.
2298. gbinv442.seq - Invertebrate sequence entries, part 442.
2299. gbinv443.seq - Invertebrate sequence entries, part 443.
2300. gbinv444.seq - Invertebrate sequence entries, part 444.
2301. gbinv445.seq - Invertebrate sequence entries, part 445.
2302. gbinv446.seq - Invertebrate sequence entries, part 446.
2303. gbinv447.seq - Invertebrate sequence entries, part 447.
2304. gbinv448.seq - Invertebrate sequence entries, part 448.
2305. gbinv449.seq - Invertebrate sequence entries, part 449.
2306. gbinv45.seq - Invertebrate sequence entries, part 45.
2307. gbinv450.seq - Invertebrate sequence entries, part 450.
2308. gbinv451.seq - Invertebrate sequence entries, part 451.
2309. gbinv452.seq - Invertebrate sequence entries, part 452.
2310. gbinv453.seq - Invertebrate sequence entries, part 453.
2311. gbinv454.seq - Invertebrate sequence entries, part 454.
2312. gbinv455.seq - Invertebrate sequence entries, part 455.
2313. gbinv456.seq - Invertebrate sequence entries, part 456.
2314. gbinv457.seq - Invertebrate sequence entries, part 457.
2315. gbinv458.seq - Invertebrate sequence entries, part 458.
2316. gbinv459.seq - Invertebrate sequence entries, part 459.
2317. gbinv46.seq - Invertebrate sequence entries, part 46.
2318. gbinv460.seq - Invertebrate sequence entries, part 460.
2319. gbinv461.seq - Invertebrate sequence entries, part 461.
2320. gbinv462.seq - Invertebrate sequence entries, part 462.
2321. gbinv463.seq - Invertebrate sequence entries, part 463.
2322. gbinv464.seq - Invertebrate sequence entries, part 464.
2323. gbinv465.seq - Invertebrate sequence entries, part 465.
2324. gbinv466.seq - Invertebrate sequence entries, part 466.
2325. gbinv467.seq - Invertebrate sequence entries, part 467.
2326. gbinv468.seq - Invertebrate sequence entries, part 468.
2327. gbinv469.seq - Invertebrate sequence entries, part 469.
2328. gbinv47.seq - Invertebrate sequence entries, part 47.
2329. gbinv470.seq - Invertebrate sequence entries, part 470.
2330. gbinv471.seq - Invertebrate sequence entries, part 471.
2331. gbinv472.seq - Invertebrate sequence entries, part 472.
2332. gbinv473.seq - Invertebrate sequence entries, part 473.
2333. gbinv474.seq - Invertebrate sequence entries, part 474.
2334. gbinv475.seq - Invertebrate sequence entries, part 475.
2335. gbinv476.seq - Invertebrate sequence entries, part 476.
2336. gbinv477.seq - Invertebrate sequence entries, part 477.
2337. gbinv478.seq - Invertebrate sequence entries, part 478.
2338. gbinv479.seq - Invertebrate sequence entries, part 479.
2339. gbinv48.seq - Invertebrate sequence entries, part 48.
2340. gbinv480.seq - Invertebrate sequence entries, part 480.
2341. gbinv481.seq - Invertebrate sequence entries, part 481.
2342. gbinv482.seq - Invertebrate sequence entries, part 482.
2343. gbinv483.seq - Invertebrate sequence entries, part 483.
2344. gbinv484.seq - Invertebrate sequence entries, part 484.
2345. gbinv485.seq - Invertebrate sequence entries, part 485.
2346. gbinv486.seq - Invertebrate sequence entries, part 486.
2347. gbinv487.seq - Invertebrate sequence entries, part 487.
2348. gbinv488.seq - Invertebrate sequence entries, part 488.
2349. gbinv49.seq - Invertebrate sequence entries, part 49.
2350. gbinv5.seq - Invertebrate sequence entries, part 5.
2351. gbinv50.seq - Invertebrate sequence entries, part 50.
2352. gbinv51.seq - Invertebrate sequence entries, part 51.
2353. gbinv52.seq - Invertebrate sequence entries, part 52.
2354. gbinv53.seq - Invertebrate sequence entries, part 53.
2355. gbinv54.seq - Invertebrate sequence entries, part 54.
2356. gbinv55.seq - Invertebrate sequence entries, part 55.
2357. gbinv56.seq - Invertebrate sequence entries, part 56.
2358. gbinv57.seq - Invertebrate sequence entries, part 57.
2359. gbinv58.seq - Invertebrate sequence entries, part 58.
2360. gbinv59.seq - Invertebrate sequence entries, part 59.
2361. gbinv6.seq - Invertebrate sequence entries, part 6.
2362. gbinv60.seq - Invertebrate sequence entries, part 60.
2363. gbinv61.seq - Invertebrate sequence entries, part 61.
2364. gbinv62.seq - Invertebrate sequence entries, part 62.
2365. gbinv63.seq - Invertebrate sequence entries, part 63.
2366. gbinv64.seq - Invertebrate sequence entries, part 64.
2367. gbinv65.seq - Invertebrate sequence entries, part 65.
2368. gbinv66.seq - Invertebrate sequence entries, part 66.
2369. gbinv67.seq - Invertebrate sequence entries, part 67.
2370. gbinv68.seq - Invertebrate sequence entries, part 68.
2371. gbinv69.seq - Invertebrate sequence entries, part 69.
2372. gbinv7.seq - Invertebrate sequence entries, part 7.
2373. gbinv70.seq - Invertebrate sequence entries, part 70.
2374. gbinv71.seq - Invertebrate sequence entries, part 71.
2375. gbinv72.seq - Invertebrate sequence entries, part 72.
2376. gbinv73.seq - Invertebrate sequence entries, part 73.
2377. gbinv74.seq - Invertebrate sequence entries, part 74.
2378. gbinv75.seq - Invertebrate sequence entries, part 75.
2379. gbinv76.seq - Invertebrate sequence entries, part 76.
2380. gbinv77.seq - Invertebrate sequence entries, part 77.
2381. gbinv78.seq - Invertebrate sequence entries, part 78.
2382. gbinv79.seq - Invertebrate sequence entries, part 79.
2383. gbinv8.seq - Invertebrate sequence entries, part 8.
2384. gbinv80.seq - Invertebrate sequence entries, part 80.
2385. gbinv81.seq - Invertebrate sequence entries, part 81.
2386. gbinv82.seq - Invertebrate sequence entries, part 82.
2387. gbinv83.seq - Invertebrate sequence entries, part 83.
2388. gbinv84.seq - Invertebrate sequence entries, part 84.
2389. gbinv85.seq - Invertebrate sequence entries, part 85.
2390. gbinv86.seq - Invertebrate sequence entries, part 86.
2391. gbinv87.seq - Invertebrate sequence entries, part 87.
2392. gbinv88.seq - Invertebrate sequence entries, part 88.
2393. gbinv89.seq - Invertebrate sequence entries, part 89.
2394. gbinv9.seq - Invertebrate sequence entries, part 9.
2395. gbinv90.seq - Invertebrate sequence entries, part 90.
2396. gbinv91.seq - Invertebrate sequence entries, part 91.
2397. gbinv92.seq - Invertebrate sequence entries, part 92.
2398. gbinv93.seq - Invertebrate sequence entries, part 93.
2399. gbinv94.seq - Invertebrate sequence entries, part 94.
2400. gbinv95.seq - Invertebrate sequence entries, part 95.
2401. gbinv96.seq - Invertebrate sequence entries, part 96.
2402. gbinv97.seq - Invertebrate sequence entries, part 97.
2403. gbinv98.seq - Invertebrate sequence entries, part 98.
2404. gbinv99.seq - Invertebrate sequence entries, part 99.
2405. gbmam1.seq - Other mammalian sequence entries, part 1.
2406. gbmam10.seq - Other mammalian sequence entries, part 10.
2407. gbmam100.seq - Other mammalian sequence entries, part 100.
2408. gbmam101.seq - Other mammalian sequence entries, part 101.
2409. gbmam102.seq - Other mammalian sequence entries, part 102.
2410. gbmam103.seq - Other mammalian sequence entries, part 103.
2411. gbmam104.seq - Other mammalian sequence entries, part 104.
2412. gbmam105.seq - Other mammalian sequence entries, part 105.
2413. gbmam106.seq - Other mammalian sequence entries, part 106.
2414. gbmam107.seq - Other mammalian sequence entries, part 107.
2415. gbmam108.seq - Other mammalian sequence entries, part 108.
2416. gbmam109.seq - Other mammalian sequence entries, part 109.
2417. gbmam11.seq - Other mammalian sequence entries, part 11.
2418. gbmam110.seq - Other mammalian sequence entries, part 110.
2419. gbmam111.seq - Other mammalian sequence entries, part 111.
2420. gbmam112.seq - Other mammalian sequence entries, part 112.
2421. gbmam113.seq - Other mammalian sequence entries, part 113.
2422. gbmam114.seq - Other mammalian sequence entries, part 114.
2423. gbmam115.seq - Other mammalian sequence entries, part 115.
2424. gbmam116.seq - Other mammalian sequence entries, part 116.
2425. gbmam12.seq - Other mammalian sequence entries, part 12.
2426. gbmam13.seq - Other mammalian sequence entries, part 13.
2427. gbmam14.seq - Other mammalian sequence entries, part 14.
2428. gbmam15.seq - Other mammalian sequence entries, part 15.
2429. gbmam16.seq - Other mammalian sequence entries, part 16.
2430. gbmam17.seq - Other mammalian sequence entries, part 17.
2431. gbmam18.seq - Other mammalian sequence entries, part 18.
2432. gbmam19.seq - Other mammalian sequence entries, part 19.
2433. gbmam2.seq - Other mammalian sequence entries, part 2.
2434. gbmam20.seq - Other mammalian sequence entries, part 20.
2435. gbmam21.seq - Other mammalian sequence entries, part 21.
2436. gbmam22.seq - Other mammalian sequence entries, part 22.
2437. gbmam23.seq - Other mammalian sequence entries, part 23.
2438. gbmam24.seq - Other mammalian sequence entries, part 24.
2439. gbmam25.seq - Other mammalian sequence entries, part 25.
2440. gbmam26.seq - Other mammalian sequence entries, part 26.
2441. gbmam27.seq - Other mammalian sequence entries, part 27.
2442. gbmam28.seq - Other mammalian sequence entries, part 28.
2443. gbmam29.seq - Other mammalian sequence entries, part 29.
2444. gbmam3.seq - Other mammalian sequence entries, part 3.
2445. gbmam30.seq - Other mammalian sequence entries, part 30.
2446. gbmam31.seq - Other mammalian sequence entries, part 31.
2447. gbmam32.seq - Other mammalian sequence entries, part 32.
2448. gbmam33.seq - Other mammalian sequence entries, part 33.
2449. gbmam34.seq - Other mammalian sequence entries, part 34.
2450. gbmam35.seq - Other mammalian sequence entries, part 35.
2451. gbmam36.seq - Other mammalian sequence entries, part 36.
2452. gbmam37.seq - Other mammalian sequence entries, part 37.
2453. gbmam38.seq - Other mammalian sequence entries, part 38.
2454. gbmam39.seq - Other mammalian sequence entries, part 39.
2455. gbmam4.seq - Other mammalian sequence entries, part 4.
2456. gbmam40.seq - Other mammalian sequence entries, part 40.
2457. gbmam41.seq - Other mammalian sequence entries, part 41.
2458. gbmam42.seq - Other mammalian sequence entries, part 42.
2459. gbmam43.seq - Other mammalian sequence entries, part 43.
2460. gbmam44.seq - Other mammalian sequence entries, part 44.
2461. gbmam45.seq - Other mammalian sequence entries, part 45.
2462. gbmam46.seq - Other mammalian sequence entries, part 46.
2463. gbmam47.seq - Other mammalian sequence entries, part 47.
2464. gbmam48.seq - Other mammalian sequence entries, part 48.
2465. gbmam49.seq - Other mammalian sequence entries, part 49.
2466. gbmam5.seq - Other mammalian sequence entries, part 5.
2467. gbmam50.seq - Other mammalian sequence entries, part 50.
2468. gbmam51.seq - Other mammalian sequence entries, part 51.
2469. gbmam52.seq - Other mammalian sequence entries, part 52.
2470. gbmam53.seq - Other mammalian sequence entries, part 53.
2471. gbmam54.seq - Other mammalian sequence entries, part 54.
2472. gbmam55.seq - Other mammalian sequence entries, part 55.
2473. gbmam56.seq - Other mammalian sequence entries, part 56.
2474. gbmam57.seq - Other mammalian sequence entries, part 57.
2475. gbmam58.seq - Other mammalian sequence entries, part 58.
2476. gbmam59.seq - Other mammalian sequence entries, part 59.
2477. gbmam6.seq - Other mammalian sequence entries, part 6.
2478. gbmam60.seq - Other mammalian sequence entries, part 60.
2479. gbmam61.seq - Other mammalian sequence entries, part 61.
2480. gbmam62.seq - Other mammalian sequence entries, part 62.
2481. gbmam63.seq - Other mammalian sequence entries, part 63.
2482. gbmam64.seq - Other mammalian sequence entries, part 64.
2483. gbmam65.seq - Other mammalian sequence entries, part 65.
2484. gbmam66.seq - Other mammalian sequence entries, part 66.
2485. gbmam67.seq - Other mammalian sequence entries, part 67.
2486. gbmam68.seq - Other mammalian sequence entries, part 68.
2487. gbmam69.seq - Other mammalian sequence entries, part 69.
2488. gbmam7.seq - Other mammalian sequence entries, part 7.
2489. gbmam70.seq - Other mammalian sequence entries, part 70.
2490. gbmam71.seq - Other mammalian sequence entries, part 71.
2491. gbmam72.seq - Other mammalian sequence entries, part 72.
2492. gbmam73.seq - Other mammalian sequence entries, part 73.
2493. gbmam74.seq - Other mammalian sequence entries, part 74.
2494. gbmam75.seq - Other mammalian sequence entries, part 75.
2495. gbmam76.seq - Other mammalian sequence entries, part 76.
2496. gbmam77.seq - Other mammalian sequence entries, part 77.
2497. gbmam78.seq - Other mammalian sequence entries, part 78.
2498. gbmam79.seq - Other mammalian sequence entries, part 79.
2499. gbmam8.seq - Other mammalian sequence entries, part 8.
2500. gbmam80.seq - Other mammalian sequence entries, part 80.
2501. gbmam81.seq - Other mammalian sequence entries, part 81.
2502. gbmam82.seq - Other mammalian sequence entries, part 82.
2503. gbmam83.seq - Other mammalian sequence entries, part 83.
2504. gbmam84.seq - Other mammalian sequence entries, part 84.
2505. gbmam85.seq - Other mammalian sequence entries, part 85.
2506. gbmam86.seq - Other mammalian sequence entries, part 86.
2507. gbmam87.seq - Other mammalian sequence entries, part 87.
2508. gbmam88.seq - Other mammalian sequence entries, part 88.
2509. gbmam89.seq - Other mammalian sequence entries, part 89.
2510. gbmam9.seq - Other mammalian sequence entries, part 9.
2511. gbmam90.seq - Other mammalian sequence entries, part 90.
2512. gbmam91.seq - Other mammalian sequence entries, part 91.
2513. gbmam92.seq - Other mammalian sequence entries, part 92.
2514. gbmam93.seq - Other mammalian sequence entries, part 93.
2515. gbmam94.seq - Other mammalian sequence entries, part 94.
2516. gbmam95.seq - Other mammalian sequence entries, part 95.
2517. gbmam96.seq - Other mammalian sequence entries, part 96.
2518. gbmam97.seq - Other mammalian sequence entries, part 97.
2519. gbmam98.seq - Other mammalian sequence entries, part 98.
2520. gbmam99.seq - Other mammalian sequence entries, part 99.
2521. gbnew.txt - Accession numbers of entries new since the previous release.
2522. gbpat1.seq - Patent sequence entries, part 1.
2523. gbpat10.seq - Patent sequence entries, part 10.
2524. gbpat100.seq - Patent sequence entries, part 100.
2525. gbpat101.seq - Patent sequence entries, part 101.
2526. gbpat102.seq - Patent sequence entries, part 102.
2527. gbpat103.seq - Patent sequence entries, part 103.
2528. gbpat104.seq - Patent sequence entries, part 104.
2529. gbpat105.seq - Patent sequence entries, part 105.
2530. gbpat106.seq - Patent sequence entries, part 106.
2531. gbpat107.seq - Patent sequence entries, part 107.
2532. gbpat108.seq - Patent sequence entries, part 108.
2533. gbpat109.seq - Patent sequence entries, part 109.
2534. gbpat11.seq - Patent sequence entries, part 11.
2535. gbpat110.seq - Patent sequence entries, part 110.
2536. gbpat111.seq - Patent sequence entries, part 111.
2537. gbpat112.seq - Patent sequence entries, part 112.
2538. gbpat113.seq - Patent sequence entries, part 113.
2539. gbpat114.seq - Patent sequence entries, part 114.
2540. gbpat115.seq - Patent sequence entries, part 115.
2541. gbpat116.seq - Patent sequence entries, part 116.
2542. gbpat117.seq - Patent sequence entries, part 117.
2543. gbpat118.seq - Patent sequence entries, part 118.
2544. gbpat119.seq - Patent sequence entries, part 119.
2545. gbpat12.seq - Patent sequence entries, part 12.
2546. gbpat120.seq - Patent sequence entries, part 120.
2547. gbpat121.seq - Patent sequence entries, part 121.
2548. gbpat122.seq - Patent sequence entries, part 122.
2549. gbpat123.seq - Patent sequence entries, part 123.
2550. gbpat124.seq - Patent sequence entries, part 124.
2551. gbpat125.seq - Patent sequence entries, part 125.
2552. gbpat126.seq - Patent sequence entries, part 126.
2553. gbpat127.seq - Patent sequence entries, part 127.
2554. gbpat128.seq - Patent sequence entries, part 128.
2555. gbpat129.seq - Patent sequence entries, part 129.
2556. gbpat13.seq - Patent sequence entries, part 13.
2557. gbpat130.seq - Patent sequence entries, part 130.
2558. gbpat131.seq - Patent sequence entries, part 131.
2559. gbpat132.seq - Patent sequence entries, part 132.
2560. gbpat133.seq - Patent sequence entries, part 133.
2561. gbpat134.seq - Patent sequence entries, part 134.
2562. gbpat135.seq - Patent sequence entries, part 135.
2563. gbpat136.seq - Patent sequence entries, part 136.
2564. gbpat137.seq - Patent sequence entries, part 137.
2565. gbpat138.seq - Patent sequence entries, part 138.
2566. gbpat139.seq - Patent sequence entries, part 139.
2567. gbpat14.seq - Patent sequence entries, part 14.
2568. gbpat140.seq - Patent sequence entries, part 140.
2569. gbpat141.seq - Patent sequence entries, part 141.
2570. gbpat142.seq - Patent sequence entries, part 142.
2571. gbpat143.seq - Patent sequence entries, part 143.
2572. gbpat144.seq - Patent sequence entries, part 144.
2573. gbpat145.seq - Patent sequence entries, part 145.
2574. gbpat146.seq - Patent sequence entries, part 146.
2575. gbpat147.seq - Patent sequence entries, part 147.
2576. gbpat148.seq - Patent sequence entries, part 148.
2577. gbpat149.seq - Patent sequence entries, part 149.
2578. gbpat15.seq - Patent sequence entries, part 15.
2579. gbpat150.seq - Patent sequence entries, part 150.
2580. gbpat151.seq - Patent sequence entries, part 151.
2581. gbpat152.seq - Patent sequence entries, part 152.
2582. gbpat153.seq - Patent sequence entries, part 153.
2583. gbpat154.seq - Patent sequence entries, part 154.
2584. gbpat155.seq - Patent sequence entries, part 155.
2585. gbpat156.seq - Patent sequence entries, part 156.
2586. gbpat157.seq - Patent sequence entries, part 157.
2587. gbpat158.seq - Patent sequence entries, part 158.
2588. gbpat159.seq - Patent sequence entries, part 159.
2589. gbpat16.seq - Patent sequence entries, part 16.
2590. gbpat160.seq - Patent sequence entries, part 160.
2591. gbpat161.seq - Patent sequence entries, part 161.
2592. gbpat162.seq - Patent sequence entries, part 162.
2593. gbpat163.seq - Patent sequence entries, part 163.
2594. gbpat164.seq - Patent sequence entries, part 164.
2595. gbpat165.seq - Patent sequence entries, part 165.
2596. gbpat166.seq - Patent sequence entries, part 166.
2597. gbpat167.seq - Patent sequence entries, part 167.
2598. gbpat168.seq - Patent sequence entries, part 168.
2599. gbpat169.seq - Patent sequence entries, part 169.
2600. gbpat17.seq - Patent sequence entries, part 17.
2601. gbpat170.seq - Patent sequence entries, part 170.
2602. gbpat171.seq - Patent sequence entries, part 171.
2603. gbpat172.seq - Patent sequence entries, part 172.
2604. gbpat173.seq - Patent sequence entries, part 173.
2605. gbpat174.seq - Patent sequence entries, part 174.
2606. gbpat175.seq - Patent sequence entries, part 175.
2607. gbpat176.seq - Patent sequence entries, part 176.
2608. gbpat177.seq - Patent sequence entries, part 177.
2609. gbpat178.seq - Patent sequence entries, part 178.
2610. gbpat179.seq - Patent sequence entries, part 179.
2611. gbpat18.seq - Patent sequence entries, part 18.
2612. gbpat180.seq - Patent sequence entries, part 180.
2613. gbpat181.seq - Patent sequence entries, part 181.
2614. gbpat182.seq - Patent sequence entries, part 182.
2615. gbpat183.seq - Patent sequence entries, part 183.
2616. gbpat184.seq - Patent sequence entries, part 184.
2617. gbpat185.seq - Patent sequence entries, part 185.
2618. gbpat186.seq - Patent sequence entries, part 186.
2619. gbpat187.seq - Patent sequence entries, part 187.
2620. gbpat188.seq - Patent sequence entries, part 188.
2621. gbpat189.seq - Patent sequence entries, part 189.
2622. gbpat19.seq - Patent sequence entries, part 19.
2623. gbpat190.seq - Patent sequence entries, part 190.
2624. gbpat191.seq - Patent sequence entries, part 191.
2625. gbpat192.seq - Patent sequence entries, part 192.
2626. gbpat193.seq - Patent sequence entries, part 193.
2627. gbpat194.seq - Patent sequence entries, part 194.
2628. gbpat195.seq - Patent sequence entries, part 195.
2629. gbpat196.seq - Patent sequence entries, part 196.
2630. gbpat197.seq - Patent sequence entries, part 197.
2631. gbpat198.seq - Patent sequence entries, part 198.
2632. gbpat199.seq - Patent sequence entries, part 199.
2633. gbpat2.seq - Patent sequence entries, part 2.
2634. gbpat20.seq - Patent sequence entries, part 20.
2635. gbpat200.seq - Patent sequence entries, part 200.
2636. gbpat201.seq - Patent sequence entries, part 201.
2637. gbpat202.seq - Patent sequence entries, part 202.
2638. gbpat203.seq - Patent sequence entries, part 203.
2639. gbpat204.seq - Patent sequence entries, part 204.
2640. gbpat205.seq - Patent sequence entries, part 205.
2641. gbpat206.seq - Patent sequence entries, part 206.
2642. gbpat207.seq - Patent sequence entries, part 207.
2643. gbpat208.seq - Patent sequence entries, part 208.
2644. gbpat209.seq - Patent sequence entries, part 209.
2645. gbpat21.seq - Patent sequence entries, part 21.
2646. gbpat210.seq - Patent sequence entries, part 210.
2647. gbpat211.seq - Patent sequence entries, part 211.
2648. gbpat212.seq - Patent sequence entries, part 212.
2649. gbpat213.seq - Patent sequence entries, part 213.
2650. gbpat214.seq - Patent sequence entries, part 214.
2651. gbpat215.seq - Patent sequence entries, part 215.
2652. gbpat216.seq - Patent sequence entries, part 216.
2653. gbpat217.seq - Patent sequence entries, part 217.
2654. gbpat218.seq - Patent sequence entries, part 218.
2655. gbpat219.seq - Patent sequence entries, part 219.
2656. gbpat22.seq - Patent sequence entries, part 22.
2657. gbpat220.seq - Patent sequence entries, part 220.
2658. gbpat221.seq - Patent sequence entries, part 221.
2659. gbpat222.seq - Patent sequence entries, part 222.
2660. gbpat223.seq - Patent sequence entries, part 223.
2661. gbpat224.seq - Patent sequence entries, part 224.
2662. gbpat225.seq - Patent sequence entries, part 225.
2663. gbpat226.seq - Patent sequence entries, part 226.
2664. gbpat227.seq - Patent sequence entries, part 227.
2665. gbpat228.seq - Patent sequence entries, part 228.
2666. gbpat229.seq - Patent sequence entries, part 229.
2667. gbpat23.seq - Patent sequence entries, part 23.
2668. gbpat230.seq - Patent sequence entries, part 230.
2669. gbpat231.seq - Patent sequence entries, part 231.
2670. gbpat232.seq - Patent sequence entries, part 232.
2671. gbpat233.seq - Patent sequence entries, part 233.
2672. gbpat234.seq - Patent sequence entries, part 234.
2673. gbpat235.seq - Patent sequence entries, part 235.
2674. gbpat236.seq - Patent sequence entries, part 236.
2675. gbpat237.seq - Patent sequence entries, part 237.
2676. gbpat238.seq - Patent sequence entries, part 238.
2677. gbpat239.seq - Patent sequence entries, part 239.
2678. gbpat24.seq - Patent sequence entries, part 24.
2679. gbpat240.seq - Patent sequence entries, part 240.
2680. gbpat241.seq - Patent sequence entries, part 241.
2681. gbpat242.seq - Patent sequence entries, part 242.
2682. gbpat243.seq - Patent sequence entries, part 243.
2683. gbpat244.seq - Patent sequence entries, part 244.
2684. gbpat245.seq - Patent sequence entries, part 245.
2685. gbpat246.seq - Patent sequence entries, part 246.
2686. gbpat25.seq - Patent sequence entries, part 25.
2687. gbpat26.seq - Patent sequence entries, part 26.
2688. gbpat27.seq - Patent sequence entries, part 27.
2689. gbpat28.seq - Patent sequence entries, part 28.
2690. gbpat29.seq - Patent sequence entries, part 29.
2691. gbpat3.seq - Patent sequence entries, part 3.
2692. gbpat30.seq - Patent sequence entries, part 30.
2693. gbpat31.seq - Patent sequence entries, part 31.
2694. gbpat32.seq - Patent sequence entries, part 32.
2695. gbpat33.seq - Patent sequence entries, part 33.
2696. gbpat34.seq - Patent sequence entries, part 34.
2697. gbpat35.seq - Patent sequence entries, part 35.
2698. gbpat36.seq - Patent sequence entries, part 36.
2699. gbpat37.seq - Patent sequence entries, part 37.
2700. gbpat38.seq - Patent sequence entries, part 38.
2701. gbpat39.seq - Patent sequence entries, part 39.
2702. gbpat4.seq - Patent sequence entries, part 4.
2703. gbpat40.seq - Patent sequence entries, part 40.
2704. gbpat41.seq - Patent sequence entries, part 41.
2705. gbpat42.seq - Patent sequence entries, part 42.
2706. gbpat43.seq - Patent sequence entries, part 43.
2707. gbpat44.seq - Patent sequence entries, part 44.
2708. gbpat45.seq - Patent sequence entries, part 45.
2709. gbpat46.seq - Patent sequence entries, part 46.
2710. gbpat47.seq - Patent sequence entries, part 47.
2711. gbpat48.seq - Patent sequence entries, part 48.
2712. gbpat49.seq - Patent sequence entries, part 49.
2713. gbpat5.seq - Patent sequence entries, part 5.
2714. gbpat50.seq - Patent sequence entries, part 50.
2715. gbpat51.seq - Patent sequence entries, part 51.
2716. gbpat52.seq - Patent sequence entries, part 52.
2717. gbpat53.seq - Patent sequence entries, part 53.
2718. gbpat54.seq - Patent sequence entries, part 54.
2719. gbpat55.seq - Patent sequence entries, part 55.
2720. gbpat56.seq - Patent sequence entries, part 56.
2721. gbpat57.seq - Patent sequence entries, part 57.
2722. gbpat58.seq - Patent sequence entries, part 58.
2723. gbpat59.seq - Patent sequence entries, part 59.
2724. gbpat6.seq - Patent sequence entries, part 6.
2725. gbpat60.seq - Patent sequence entries, part 60.
2726. gbpat61.seq - Patent sequence entries, part 61.
2727. gbpat62.seq - Patent sequence entries, part 62.
2728. gbpat63.seq - Patent sequence entries, part 63.
2729. gbpat64.seq - Patent sequence entries, part 64.
2730. gbpat65.seq - Patent sequence entries, part 65.
2731. gbpat66.seq - Patent sequence entries, part 66.
2732. gbpat67.seq - Patent sequence entries, part 67.
2733. gbpat68.seq - Patent sequence entries, part 68.
2734. gbpat69.seq - Patent sequence entries, part 69.
2735. gbpat7.seq - Patent sequence entries, part 7.
2736. gbpat70.seq - Patent sequence entries, part 70.
2737. gbpat71.seq - Patent sequence entries, part 71.
2738. gbpat72.seq - Patent sequence entries, part 72.
2739. gbpat73.seq - Patent sequence entries, part 73.
2740. gbpat74.seq - Patent sequence entries, part 74.
2741. gbpat75.seq - Patent sequence entries, part 75.
2742. gbpat76.seq - Patent sequence entries, part 76.
2743. gbpat77.seq - Patent sequence entries, part 77.
2744. gbpat78.seq - Patent sequence entries, part 78.
2745. gbpat79.seq - Patent sequence entries, part 79.
2746. gbpat8.seq - Patent sequence entries, part 8.
2747. gbpat80.seq - Patent sequence entries, part 80.
2748. gbpat81.seq - Patent sequence entries, part 81.
2749. gbpat82.seq - Patent sequence entries, part 82.
2750. gbpat83.seq - Patent sequence entries, part 83.
2751. gbpat84.seq - Patent sequence entries, part 84.
2752. gbpat85.seq - Patent sequence entries, part 85.
2753. gbpat86.seq - Patent sequence entries, part 86.
2754. gbpat87.seq - Patent sequence entries, part 87.
2755. gbpat88.seq - Patent sequence entries, part 88.
2756. gbpat89.seq - Patent sequence entries, part 89.
2757. gbpat9.seq - Patent sequence entries, part 9.
2758. gbpat90.seq - Patent sequence entries, part 90.
2759. gbpat91.seq - Patent sequence entries, part 91.
2760. gbpat92.seq - Patent sequence entries, part 92.
2761. gbpat93.seq - Patent sequence entries, part 93.
2762. gbpat94.seq - Patent sequence entries, part 94.
2763. gbpat95.seq - Patent sequence entries, part 95.
2764. gbpat96.seq - Patent sequence entries, part 96.
2765. gbpat97.seq - Patent sequence entries, part 97.
2766. gbpat98.seq - Patent sequence entries, part 98.
2767. gbpat99.seq - Patent sequence entries, part 99.
2768. gbphg1.seq - Phage sequence entries, part 1.
2769. gbphg2.seq - Phage sequence entries, part 2.
2770. gbphg3.seq - Phage sequence entries, part 3.
2771. gbphg4.seq - Phage sequence entries, part 4.
2772. gbphg5.seq - Phage sequence entries, part 5.
2773. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2774. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2775. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2776. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2777. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2778. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2779. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2780. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2781. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2782. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2783. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2784. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2785. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2786. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2787. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2788. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2789. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2790. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2791. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2792. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2793. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2794. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2795. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2796. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2797. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2798. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2799. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2800. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2801. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2802. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2803. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2804. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2805. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2806. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2807. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2808. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2809. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2810. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2811. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2812. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2813. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2814. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2815. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2816. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2817. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2818. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2819. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2820. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2821. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2822. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2823. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2824. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2825. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
2826. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
2827. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
2828. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
2829. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2830. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
2831. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
2832. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
2833. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
2834. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
2835. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
2836. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
2837. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
2838. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
2839. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
2840. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2841. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
2842. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
2843. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
2844. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
2845. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
2846. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
2847. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
2848. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
2849. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
2850. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
2851. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2852. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
2853. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
2854. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
2855. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
2856. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
2857. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
2858. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
2859. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
2860. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
2861. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
2862. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2863. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
2864. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
2865. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
2866. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
2867. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
2868. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
2869. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
2870. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
2871. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
2872. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
2873. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2874. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
2875. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
2876. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
2877. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
2878. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
2879. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
2880. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
2881. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
2882. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
2883. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
2884. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2885. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2886. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
2887. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
2888. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
2889. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
2890. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
2891. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
2892. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
2893. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
2894. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
2895. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
2896. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
2897. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
2898. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
2899. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
2900. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
2901. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
2902. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
2903. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
2904. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
2905. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
2906. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
2907. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
2908. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
2909. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
2910. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
2911. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
2912. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
2913. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
2914. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
2915. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
2916. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
2917. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
2918. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
2919. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
2920. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
2921. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
2922. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
2923. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
2924. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
2925. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
2926. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
2927. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
2928. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
2929. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
2930. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
2931. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
2932. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
2933. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
2934. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
2935. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
2936. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
2937. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
2938. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
2939. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
2940. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
2941. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
2942. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
2943. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
2944. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
2945. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
2946. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
2947. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
2948. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
2949. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
2950. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
2951. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
2952. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
2953. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
2954. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
2955. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
2956. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
2957. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
2958. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
2959. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
2960. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
2961. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
2962. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
2963. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
2964. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
2965. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
2966. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
2967. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
2968. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
2969. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
2970. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
2971. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
2972. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
2973. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
2974. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
2975. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
2976. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
2977. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
2978. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
2979. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
2980. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
2981. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
2982. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
2983. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
2984. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
2985. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
2986. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
2987. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
2988. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
2989. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
2990. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
2991. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
2992. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
2993. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
2994. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
2995. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
2996. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
2997. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
2998. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
2999. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
3000. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
3001. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
3002. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
3003. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
3004. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
3005. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
3006. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
3007. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
3008. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
3009. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
3010. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
3011. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
3012. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
3013. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
3014. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
3015. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
3016. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
3017. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
3018. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
3019. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
3020. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
3021. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
3022. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
3023. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
3024. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
3025. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
3026. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
3027. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
3028. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
3029. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
3030. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
3031. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
3032. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
3033. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
3034. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
3035. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
3036. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
3037. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
3038. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
3039. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
3040. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
3041. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
3042. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
3043. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
3044. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
3045. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
3046. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
3047. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
3048. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
3049. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
3050. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
3051. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
3052. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
3053. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
3054. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
3055. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
3056. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
3057. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
3058. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
3059. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
3060. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
3061. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
3062. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
3063. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
3064. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
3065. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
3066. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
3067. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
3068. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
3069. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
3070. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
3071. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
3072. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
3073. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
3074. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
3075. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
3076. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
3077. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
3078. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
3079. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
3080. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
3081. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
3082. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
3083. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
3084. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
3085. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
3086. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
3087. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
3088. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
3089. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
3090. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
3091. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
3092. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
3093. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
3094. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
3095. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
3096. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
3097. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
3098. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
3099. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
3100. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
3101. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
3102. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
3103. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
3104. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
3105. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
3106. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
3107. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
3108. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
3109. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
3110. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
3111. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
3112. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
3113. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
3114. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
3115. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
3116. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
3117. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
3118. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
3119. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
3120. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
3121. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
3122. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
3123. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
3124. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
3125. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
3126. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
3127. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
3128. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
3129. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
3130. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
3131. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
3132. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
3133. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
3134. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
3135. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
3136. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
3137. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
3138. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
3139. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
3140. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
3141. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
3142. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
3143. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
3144. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
3145. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
3146. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
3147. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
3148. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
3149. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
3150. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
3151. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
3152. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
3153. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
3154. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
3155. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
3156. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
3157. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
3158. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
3159. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
3160. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
3161. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
3162. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
3163. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
3164. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
3165. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
3166. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
3167. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
3168. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
3169. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
3170. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
3171. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
3172. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
3173. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
3174. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
3175. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
3176. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
3177. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
3178. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
3179. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
3180. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
3181. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
3182. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
3183. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
3184. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
3185. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
3186. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
3187. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
3188. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
3189. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
3190. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
3191. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
3192. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
3193. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
3194. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
3195. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
3196. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
3197. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
3198. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
3199. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
3200. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
3201. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
3202. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
3203. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
3204. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
3205. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
3206. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
3207. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
3208. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
3209. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
3210. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
3211. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
3212. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
3213. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
3214. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
3215. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
3216. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
3217. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
3218. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
3219. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
3220. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
3221. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
3222. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
3223. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
3224. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
3225. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
3226. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
3227. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
3228. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
3229. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
3230. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
3231. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
3232. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
3233. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
3234. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
3235. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
3236. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
3237. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
3238. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
3239. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
3240. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
3241. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
3242. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
3243. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
3244. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
3245. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
3246. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
3247. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
3248. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
3249. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
3250. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
3251. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
3252. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
3253. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
3254. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
3255. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
3256. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
3257. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
3258. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
3259. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
3260. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
3261. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
3262. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
3263. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
3264. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
3265. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
3266. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
3267. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
3268. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
3269. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
3270. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
3271. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548.
3272. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549.
3273. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
3274. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550.
3275. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551.
3276. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552.
3277. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553.
3278. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554.
3279. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555.
3280. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556.
3281. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557.
3282. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558.
3283. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559.
3284. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
3285. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560.
3286. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561.
3287. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562.
3288. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563.
3289. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564.
3290. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565.
3291. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566.
3292. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567.
3293. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568.
3294. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569.
3295. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
3296. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570.
3297. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571.
3298. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572.
3299. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573.
3300. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574.
3301. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575.
3302. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576.
3303. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577.
3304. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578.
3305. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579.
3306. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
3307. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580.
3308. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581.
3309. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582.
3310. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583.
3311. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584.
3312. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585.
3313. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586.
3314. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587.
3315. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588.
3316. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589.
3317. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
3318. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590.
3319. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591.
3320. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592.
3321. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593.
3322. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594.
3323. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595.
3324. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596.
3325. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597.
3326. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598.
3327. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599.
3328. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
3329. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
3330. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600.
3331. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601.
3332. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602.
3333. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603.
3334. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604.
3335. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605.
3336. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606.
3337. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607.
3338. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608.
3339. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609.
3340. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
3341. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610.
3342. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611.
3343. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612.
3344. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613.
3345. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614.
3346. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615.
3347. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616.
3348. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617.
3349. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618.
3350. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619.
3351. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
3352. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620.
3353. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621.
3354. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622.
3355. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623.
3356. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624.
3357. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625.
3358. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626.
3359. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627.
3360. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628.
3361. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629.
3362. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
3363. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630.
3364. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631.
3365. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632.
3366. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633.
3367. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634.
3368. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635.
3369. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636.
3370. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637.
3371. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638.
3372. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639.
3373. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
3374. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640.
3375. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641.
3376. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642.
3377. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643.
3378. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644.
3379. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645.
3380. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646.
3381. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647.
3382. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648.
3383. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649.
3384. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
3385. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650.
3386. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651.
3387. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652.
3388. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653.
3389. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654.
3390. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655.
3391. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656.
3392. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657.
3393. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658.
3394. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659.
3395. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
3396. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660.
3397. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661.
3398. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662.
3399. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663.
3400. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664.
3401. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665.
3402. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666.
3403. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667.
3404. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668.
3405. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669.
3406. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
3407. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670.
3408. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671.
3409. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672.
3410. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673.
3411. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674.
3412. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675.
3413. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676.
3414. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677.
3415. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678.
3416. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679.
3417. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
3418. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680.
3419. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681.
3420. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682.
3421. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683.
3422. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684.
3423. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685.
3424. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686.
3425. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687.
3426. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688.
3427. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689.
3428. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
3429. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690.
3430. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691.
3431. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692.
3432. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693.
3433. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694.
3434. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695.
3435. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696.
3436. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697.
3437. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698.
3438. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699.
3439. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
3440. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
3441. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700.
3442. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701.
3443. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702.
3444. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703.
3445. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704.
3446. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705.
3447. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706.
3448. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707.
3449. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708.
3450. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709.
3451. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
3452. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710.
3453. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711.
3454. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712.
3455. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713.
3456. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714.
3457. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715.
3458. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716.
3459. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717.
3460. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718.
3461. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719.
3462. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
3463. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720.
3464. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721.
3465. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722.
3466. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723.
3467. gbpln724.seq - Plant sequence entries (including fungi and algae), part 724.
3468. gbpln725.seq - Plant sequence entries (including fungi and algae), part 725.
3469. gbpln726.seq - Plant sequence entries (including fungi and algae), part 726.
3470. gbpln727.seq - Plant sequence entries (including fungi and algae), part 727.
3471. gbpln728.seq - Plant sequence entries (including fungi and algae), part 728.
3472. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
3473. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
3474. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
3475. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
3476. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
3477. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
3478. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
3479. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
3480. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
3481. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
3482. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
3483. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
3484. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
3485. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
3486. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
3487. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
3488. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
3489. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
3490. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
3491. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
3492. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
3493. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
3494. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
3495. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
3496. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
3497. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
3498. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
3499. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
3500. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
3501. gbpri1.seq - Primate sequence entries, part 1.
3502. gbpri10.seq - Primate sequence entries, part 10.
3503. gbpri11.seq - Primate sequence entries, part 11.
3504. gbpri12.seq - Primate sequence entries, part 12.
3505. gbpri13.seq - Primate sequence entries, part 13.
3506. gbpri14.seq - Primate sequence entries, part 14.
3507. gbpri15.seq - Primate sequence entries, part 15.
3508. gbpri16.seq - Primate sequence entries, part 16.
3509. gbpri17.seq - Primate sequence entries, part 17.
3510. gbpri18.seq - Primate sequence entries, part 18.
3511. gbpri19.seq - Primate sequence entries, part 19.
3512. gbpri2.seq - Primate sequence entries, part 2.
3513. gbpri20.seq - Primate sequence entries, part 20.
3514. gbpri21.seq - Primate sequence entries, part 21.
3515. gbpri22.seq - Primate sequence entries, part 22.
3516. gbpri23.seq - Primate sequence entries, part 23.
3517. gbpri24.seq - Primate sequence entries, part 24.
3518. gbpri25.seq - Primate sequence entries, part 25.
3519. gbpri26.seq - Primate sequence entries, part 26.
3520. gbpri27.seq - Primate sequence entries, part 27.
3521. gbpri28.seq - Primate sequence entries, part 28.
3522. gbpri29.seq - Primate sequence entries, part 29.
3523. gbpri3.seq - Primate sequence entries, part 3.
3524. gbpri30.seq - Primate sequence entries, part 30.
3525. gbpri31.seq - Primate sequence entries, part 31.
3526. gbpri32.seq - Primate sequence entries, part 32.
3527. gbpri33.seq - Primate sequence entries, part 33.
3528. gbpri34.seq - Primate sequence entries, part 34.
3529. gbpri35.seq - Primate sequence entries, part 35.
3530. gbpri36.seq - Primate sequence entries, part 36.
3531. gbpri37.seq - Primate sequence entries, part 37.
3532. gbpri38.seq - Primate sequence entries, part 38.
3533. gbpri39.seq - Primate sequence entries, part 39.
3534. gbpri4.seq - Primate sequence entries, part 4.
3535. gbpri40.seq - Primate sequence entries, part 40.
3536. gbpri41.seq - Primate sequence entries, part 41.
3537. gbpri42.seq - Primate sequence entries, part 42.
3538. gbpri43.seq - Primate sequence entries, part 43.
3539. gbpri44.seq - Primate sequence entries, part 44.
3540. gbpri45.seq - Primate sequence entries, part 45.
3541. gbpri46.seq - Primate sequence entries, part 46.
3542. gbpri47.seq - Primate sequence entries, part 47.
3543. gbpri48.seq - Primate sequence entries, part 48.
3544. gbpri49.seq - Primate sequence entries, part 49.
3545. gbpri5.seq - Primate sequence entries, part 5.
3546. gbpri50.seq - Primate sequence entries, part 50.
3547. gbpri51.seq - Primate sequence entries, part 51.
3548. gbpri52.seq - Primate sequence entries, part 52.
3549. gbpri53.seq - Primate sequence entries, part 53.
3550. gbpri54.seq - Primate sequence entries, part 54.
3551. gbpri55.seq - Primate sequence entries, part 55.
3552. gbpri56.seq - Primate sequence entries, part 56.
3553. gbpri6.seq - Primate sequence entries, part 6.
3554. gbpri7.seq - Primate sequence entries, part 7.
3555. gbpri8.seq - Primate sequence entries, part 8.
3556. gbpri9.seq - Primate sequence entries, part 9.
3557. gbrel.txt - Release notes (this document).
3558. gbrod1.seq - Rodent sequence entries, part 1.
3559. gbrod10.seq - Rodent sequence entries, part 10.
3560. gbrod11.seq - Rodent sequence entries, part 11.
3561. gbrod12.seq - Rodent sequence entries, part 12.
3562. gbrod13.seq - Rodent sequence entries, part 13.
3563. gbrod14.seq - Rodent sequence entries, part 14.
3564. gbrod15.seq - Rodent sequence entries, part 15.
3565. gbrod16.seq - Rodent sequence entries, part 16.
3566. gbrod17.seq - Rodent sequence entries, part 17.
3567. gbrod18.seq - Rodent sequence entries, part 18.
3568. gbrod19.seq - Rodent sequence entries, part 19.
3569. gbrod2.seq - Rodent sequence entries, part 2.
3570. gbrod20.seq - Rodent sequence entries, part 20.
3571. gbrod21.seq - Rodent sequence entries, part 21.
3572. gbrod22.seq - Rodent sequence entries, part 22.
3573. gbrod23.seq - Rodent sequence entries, part 23.
3574. gbrod24.seq - Rodent sequence entries, part 24.
3575. gbrod25.seq - Rodent sequence entries, part 25.
3576. gbrod26.seq - Rodent sequence entries, part 26.
3577. gbrod27.seq - Rodent sequence entries, part 27.
3578. gbrod28.seq - Rodent sequence entries, part 28.
3579. gbrod29.seq - Rodent sequence entries, part 29.
3580. gbrod3.seq - Rodent sequence entries, part 3.
3581. gbrod30.seq - Rodent sequence entries, part 30.
3582. gbrod31.seq - Rodent sequence entries, part 31.
3583. gbrod32.seq - Rodent sequence entries, part 32.
3584. gbrod33.seq - Rodent sequence entries, part 33.
3585. gbrod34.seq - Rodent sequence entries, part 34.
3586. gbrod35.seq - Rodent sequence entries, part 35.
3587. gbrod36.seq - Rodent sequence entries, part 36.
3588. gbrod37.seq - Rodent sequence entries, part 37.
3589. gbrod38.seq - Rodent sequence entries, part 38.
3590. gbrod39.seq - Rodent sequence entries, part 39.
3591. gbrod4.seq - Rodent sequence entries, part 4.
3592. gbrod40.seq - Rodent sequence entries, part 40.
3593. gbrod41.seq - Rodent sequence entries, part 41.
3594. gbrod42.seq - Rodent sequence entries, part 42.
3595. gbrod43.seq - Rodent sequence entries, part 43.
3596. gbrod44.seq - Rodent sequence entries, part 44.
3597. gbrod45.seq - Rodent sequence entries, part 45.
3598. gbrod46.seq - Rodent sequence entries, part 46.
3599. gbrod47.seq - Rodent sequence entries, part 47.
3600. gbrod48.seq - Rodent sequence entries, part 48.
3601. gbrod49.seq - Rodent sequence entries, part 49.
3602. gbrod5.seq - Rodent sequence entries, part 5.
3603. gbrod50.seq - Rodent sequence entries, part 50.
3604. gbrod51.seq - Rodent sequence entries, part 51.
3605. gbrod52.seq - Rodent sequence entries, part 52.
3606. gbrod53.seq - Rodent sequence entries, part 53.
3607. gbrod54.seq - Rodent sequence entries, part 54.
3608. gbrod55.seq - Rodent sequence entries, part 55.
3609. gbrod56.seq - Rodent sequence entries, part 56.
3610. gbrod57.seq - Rodent sequence entries, part 57.
3611. gbrod58.seq - Rodent sequence entries, part 58.
3612. gbrod59.seq - Rodent sequence entries, part 59.
3613. gbrod6.seq - Rodent sequence entries, part 6.
3614. gbrod60.seq - Rodent sequence entries, part 60.
3615. gbrod61.seq - Rodent sequence entries, part 61.
3616. gbrod62.seq - Rodent sequence entries, part 62.
3617. gbrod63.seq - Rodent sequence entries, part 63.
3618. gbrod64.seq - Rodent sequence entries, part 64.
3619. gbrod65.seq - Rodent sequence entries, part 65.
3620. gbrod66.seq - Rodent sequence entries, part 66.
3621. gbrod67.seq - Rodent sequence entries, part 67.
3622. gbrod68.seq - Rodent sequence entries, part 68.
3623. gbrod69.seq - Rodent sequence entries, part 69.
3624. gbrod7.seq - Rodent sequence entries, part 7.
3625. gbrod70.seq - Rodent sequence entries, part 70.
3626. gbrod71.seq - Rodent sequence entries, part 71.
3627. gbrod72.seq - Rodent sequence entries, part 72.
3628. gbrod73.seq - Rodent sequence entries, part 73.
3629. gbrod74.seq - Rodent sequence entries, part 74.
3630. gbrod75.seq - Rodent sequence entries, part 75.
3631. gbrod76.seq - Rodent sequence entries, part 76.
3632. gbrod77.seq - Rodent sequence entries, part 77.
3633. gbrod8.seq - Rodent sequence entries, part 8.
3634. gbrod9.seq - Rodent sequence entries, part 9.
3635. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
3636. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
3637. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
3638. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
3639. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
3640. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
3641. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
3642. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
3643. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
3644. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
3645. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
3646. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
3647. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
3648. gbsyn11.seq - Synthetic and chimeric sequence entries, part 11.
3649. gbsyn12.seq - Synthetic and chimeric sequence entries, part 12.
3650. gbsyn13.seq - Synthetic and chimeric sequence entries, part 13.
3651. gbsyn14.seq - Synthetic and chimeric sequence entries, part 14.
3652. gbsyn15.seq - Synthetic and chimeric sequence entries, part 15.
3653. gbsyn16.seq - Synthetic and chimeric sequence entries, part 16.
3654. gbsyn17.seq - Synthetic and chimeric sequence entries, part 17.
3655. gbsyn18.seq - Synthetic and chimeric sequence entries, part 18.
3656. gbsyn19.seq - Synthetic and chimeric sequence entries, part 19.
3657. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
3658. gbsyn20.seq - Synthetic and chimeric sequence entries, part 20.
3659. gbsyn21.seq - Synthetic and chimeric sequence entries, part 21.
3660. gbsyn22.seq - Synthetic and chimeric sequence entries, part 22.
3661. gbsyn23.seq - Synthetic and chimeric sequence entries, part 23.
3662. gbsyn24.seq - Synthetic and chimeric sequence entries, part 24.
3663. gbsyn25.seq - Synthetic and chimeric sequence entries, part 25.
3664. gbsyn26.seq - Synthetic and chimeric sequence entries, part 26.
3665. gbsyn27.seq - Synthetic and chimeric sequence entries, part 27.
3666. gbsyn28.seq - Synthetic and chimeric sequence entries, part 28.
3667. gbsyn29.seq - Synthetic and chimeric sequence entries, part 29.
3668. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
3669. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
3670. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
3671. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
3672. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
3673. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
3674. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
3675. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
3676. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
3677. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
3678. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
3679. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
3680. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
3681. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
3682. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
3683. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
3684. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
3685. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
3686. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
3687. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
3688. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
3689. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
3690. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
3691. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
3692. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
3693. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
3694. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
3695. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
3696. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
3697. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
3698. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
3699. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
3700. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
3701. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
3702. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
3703. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
3704. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
3705. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
3706. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
3707. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
3708. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
3709. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
3710. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
3711. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
3712. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
3713. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
3714. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
3715. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
3716. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
3717. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
3718. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
3719. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
3720. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
3721. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
3722. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
3723. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
3724. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
3725. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
3726. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
3727. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
3728. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
3729. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
3730. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
3731. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
3732. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
3733. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
3734. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
3735. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
3736. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
3737. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
3738. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
3739. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
3740. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
3741. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
3742. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
3743. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
3744. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
3745. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
3746. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
3747. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
3748. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
3749. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
3750. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
3751. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
3752. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
3753. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
3754. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
3755. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
3756. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
3757. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
3758. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
3759. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
3760. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
3761. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
3762. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
3763. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
3764. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
3765. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
3766. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
3767. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
3768. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
3769. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
3770. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
3771. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
3772. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
3773. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
3774. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
3775. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
3776. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
3777. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
3778. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
3779. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
3780. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
3781. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
3782. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
3783. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
3784. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
3785. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
3786. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
3787. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
3788. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
3789. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
3790. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
3791. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
3792. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
3793. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
3794. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
3795. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
3796. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
3797. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
3798. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
3799. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
3800. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
3801. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
3802. gbuna1.seq - Unannotated sequence entries, part 1.
3803. gbvrl1.seq - Viral sequence entries, part 1.
3804. gbvrl10.seq - Viral sequence entries, part 10.
3805. gbvrl100.seq - Viral sequence entries, part 100.
3806. gbvrl101.seq - Viral sequence entries, part 101.
3807. gbvrl102.seq - Viral sequence entries, part 102.
3808. gbvrl103.seq - Viral sequence entries, part 103.
3809. gbvrl104.seq - Viral sequence entries, part 104.
3810. gbvrl105.seq - Viral sequence entries, part 105.
3811. gbvrl106.seq - Viral sequence entries, part 106.
3812. gbvrl107.seq - Viral sequence entries, part 107.
3813. gbvrl108.seq - Viral sequence entries, part 108.
3814. gbvrl109.seq - Viral sequence entries, part 109.
3815. gbvrl11.seq - Viral sequence entries, part 11.
3816. gbvrl110.seq - Viral sequence entries, part 110.
3817. gbvrl111.seq - Viral sequence entries, part 111.
3818. gbvrl112.seq - Viral sequence entries, part 112.
3819. gbvrl113.seq - Viral sequence entries, part 113.
3820. gbvrl114.seq - Viral sequence entries, part 114.
3821. gbvrl115.seq - Viral sequence entries, part 115.
3822. gbvrl116.seq - Viral sequence entries, part 116.
3823. gbvrl117.seq - Viral sequence entries, part 117.
3824. gbvrl118.seq - Viral sequence entries, part 118.
3825. gbvrl119.seq - Viral sequence entries, part 119.
3826. gbvrl12.seq - Viral sequence entries, part 12.
3827. gbvrl120.seq - Viral sequence entries, part 120.
3828. gbvrl121.seq - Viral sequence entries, part 121.
3829. gbvrl122.seq - Viral sequence entries, part 122.
3830. gbvrl123.seq - Viral sequence entries, part 123.
3831. gbvrl124.seq - Viral sequence entries, part 124.
3832. gbvrl125.seq - Viral sequence entries, part 125.
3833. gbvrl126.seq - Viral sequence entries, part 126.
3834. gbvrl127.seq - Viral sequence entries, part 127.
3835. gbvrl128.seq - Viral sequence entries, part 128.
3836. gbvrl129.seq - Viral sequence entries, part 129.
3837. gbvrl13.seq - Viral sequence entries, part 13.
3838. gbvrl130.seq - Viral sequence entries, part 130.
3839. gbvrl131.seq - Viral sequence entries, part 131.
3840. gbvrl132.seq - Viral sequence entries, part 132.
3841. gbvrl133.seq - Viral sequence entries, part 133.
3842. gbvrl134.seq - Viral sequence entries, part 134.
3843. gbvrl135.seq - Viral sequence entries, part 135.
3844. gbvrl136.seq - Viral sequence entries, part 136.
3845. gbvrl137.seq - Viral sequence entries, part 137.
3846. gbvrl138.seq - Viral sequence entries, part 138.
3847. gbvrl139.seq - Viral sequence entries, part 139.
3848. gbvrl14.seq - Viral sequence entries, part 14.
3849. gbvrl140.seq - Viral sequence entries, part 140.
3850. gbvrl141.seq - Viral sequence entries, part 141.
3851. gbvrl142.seq - Viral sequence entries, part 142.
3852. gbvrl143.seq - Viral sequence entries, part 143.
3853. gbvrl144.seq - Viral sequence entries, part 144.
3854. gbvrl145.seq - Viral sequence entries, part 145.
3855. gbvrl146.seq - Viral sequence entries, part 146.
3856. gbvrl147.seq - Viral sequence entries, part 147.
3857. gbvrl148.seq - Viral sequence entries, part 148.
3858. gbvrl149.seq - Viral sequence entries, part 149.
3859. gbvrl15.seq - Viral sequence entries, part 15.
3860. gbvrl150.seq - Viral sequence entries, part 150.
3861. gbvrl151.seq - Viral sequence entries, part 151.
3862. gbvrl152.seq - Viral sequence entries, part 152.
3863. gbvrl153.seq - Viral sequence entries, part 153.
3864. gbvrl154.seq - Viral sequence entries, part 154.
3865. gbvrl155.seq - Viral sequence entries, part 155.
3866. gbvrl156.seq - Viral sequence entries, part 156.
3867. gbvrl157.seq - Viral sequence entries, part 157.
3868. gbvrl158.seq - Viral sequence entries, part 158.
3869. gbvrl159.seq - Viral sequence entries, part 159.
3870. gbvrl16.seq - Viral sequence entries, part 16.
3871. gbvrl160.seq - Viral sequence entries, part 160.
3872. gbvrl161.seq - Viral sequence entries, part 161.
3873. gbvrl162.seq - Viral sequence entries, part 162.
3874. gbvrl163.seq - Viral sequence entries, part 163.
3875. gbvrl164.seq - Viral sequence entries, part 164.
3876. gbvrl165.seq - Viral sequence entries, part 165.
3877. gbvrl166.seq - Viral sequence entries, part 166.
3878. gbvrl167.seq - Viral sequence entries, part 167.
3879. gbvrl168.seq - Viral sequence entries, part 168.
3880. gbvrl169.seq - Viral sequence entries, part 169.
3881. gbvrl17.seq - Viral sequence entries, part 17.
3882. gbvrl170.seq - Viral sequence entries, part 170.
3883. gbvrl171.seq - Viral sequence entries, part 171.
3884. gbvrl172.seq - Viral sequence entries, part 172.
3885. gbvrl173.seq - Viral sequence entries, part 173.
3886. gbvrl174.seq - Viral sequence entries, part 174.
3887. gbvrl175.seq - Viral sequence entries, part 175.
3888. gbvrl176.seq - Viral sequence entries, part 176.
3889. gbvrl177.seq - Viral sequence entries, part 177.
3890. gbvrl178.seq - Viral sequence entries, part 178.
3891. gbvrl179.seq - Viral sequence entries, part 179.
3892. gbvrl18.seq - Viral sequence entries, part 18.
3893. gbvrl180.seq - Viral sequence entries, part 180.
3894. gbvrl181.seq - Viral sequence entries, part 181.
3895. gbvrl182.seq - Viral sequence entries, part 182.
3896. gbvrl183.seq - Viral sequence entries, part 183.
3897. gbvrl184.seq - Viral sequence entries, part 184.
3898. gbvrl185.seq - Viral sequence entries, part 185.
3899. gbvrl186.seq - Viral sequence entries, part 186.
3900. gbvrl187.seq - Viral sequence entries, part 187.
3901. gbvrl188.seq - Viral sequence entries, part 188.
3902. gbvrl189.seq - Viral sequence entries, part 189.
3903. gbvrl19.seq - Viral sequence entries, part 19.
3904. gbvrl190.seq - Viral sequence entries, part 190.
3905. gbvrl191.seq - Viral sequence entries, part 191.
3906. gbvrl192.seq - Viral sequence entries, part 192.
3907. gbvrl193.seq - Viral sequence entries, part 193.
3908. gbvrl194.seq - Viral sequence entries, part 194.
3909. gbvrl195.seq - Viral sequence entries, part 195.
3910. gbvrl196.seq - Viral sequence entries, part 196.
3911. gbvrl197.seq - Viral sequence entries, part 197.
3912. gbvrl198.seq - Viral sequence entries, part 198.
3913. gbvrl199.seq - Viral sequence entries, part 199.
3914. gbvrl2.seq - Viral sequence entries, part 2.
3915. gbvrl20.seq - Viral sequence entries, part 20.
3916. gbvrl200.seq - Viral sequence entries, part 200.
3917. gbvrl201.seq - Viral sequence entries, part 201.
3918. gbvrl202.seq - Viral sequence entries, part 202.
3919. gbvrl203.seq - Viral sequence entries, part 203.
3920. gbvrl204.seq - Viral sequence entries, part 204.
3921. gbvrl205.seq - Viral sequence entries, part 205.
3922. gbvrl206.seq - Viral sequence entries, part 206.
3923. gbvrl207.seq - Viral sequence entries, part 207.
3924. gbvrl208.seq - Viral sequence entries, part 208.
3925. gbvrl209.seq - Viral sequence entries, part 209.
3926. gbvrl21.seq - Viral sequence entries, part 21.
3927. gbvrl210.seq - Viral sequence entries, part 210.
3928. gbvrl211.seq - Viral sequence entries, part 211.
3929. gbvrl212.seq - Viral sequence entries, part 212.
3930. gbvrl213.seq - Viral sequence entries, part 213.
3931. gbvrl214.seq - Viral sequence entries, part 214.
3932. gbvrl215.seq - Viral sequence entries, part 215.
3933. gbvrl216.seq - Viral sequence entries, part 216.
3934. gbvrl217.seq - Viral sequence entries, part 217.
3935. gbvrl218.seq - Viral sequence entries, part 218.
3936. gbvrl219.seq - Viral sequence entries, part 219.
3937. gbvrl22.seq - Viral sequence entries, part 22.
3938. gbvrl220.seq - Viral sequence entries, part 220.
3939. gbvrl221.seq - Viral sequence entries, part 221.
3940. gbvrl222.seq - Viral sequence entries, part 222.
3941. gbvrl223.seq - Viral sequence entries, part 223.
3942. gbvrl224.seq - Viral sequence entries, part 224.
3943. gbvrl225.seq - Viral sequence entries, part 225.
3944. gbvrl226.seq - Viral sequence entries, part 226.
3945. gbvrl227.seq - Viral sequence entries, part 227.
3946. gbvrl228.seq - Viral sequence entries, part 228.
3947. gbvrl229.seq - Viral sequence entries, part 229.
3948. gbvrl23.seq - Viral sequence entries, part 23.
3949. gbvrl230.seq - Viral sequence entries, part 230.
3950. gbvrl231.seq - Viral sequence entries, part 231.
3951. gbvrl232.seq - Viral sequence entries, part 232.
3952. gbvrl233.seq - Viral sequence entries, part 233.
3953. gbvrl234.seq - Viral sequence entries, part 234.
3954. gbvrl235.seq - Viral sequence entries, part 235.
3955. gbvrl236.seq - Viral sequence entries, part 236.
3956. gbvrl237.seq - Viral sequence entries, part 237.
3957. gbvrl238.seq - Viral sequence entries, part 238.
3958. gbvrl239.seq - Viral sequence entries, part 239.
3959. gbvrl24.seq - Viral sequence entries, part 24.
3960. gbvrl240.seq - Viral sequence entries, part 240.
3961. gbvrl241.seq - Viral sequence entries, part 241.
3962. gbvrl242.seq - Viral sequence entries, part 242.
3963. gbvrl243.seq - Viral sequence entries, part 243.
3964. gbvrl244.seq - Viral sequence entries, part 244.
3965. gbvrl245.seq - Viral sequence entries, part 245.
3966. gbvrl246.seq - Viral sequence entries, part 246.
3967. gbvrl247.seq - Viral sequence entries, part 247.
3968. gbvrl248.seq - Viral sequence entries, part 248.
3969. gbvrl249.seq - Viral sequence entries, part 249.
3970. gbvrl25.seq - Viral sequence entries, part 25.
3971. gbvrl250.seq - Viral sequence entries, part 250.
3972. gbvrl251.seq - Viral sequence entries, part 251.
3973. gbvrl252.seq - Viral sequence entries, part 252.
3974. gbvrl253.seq - Viral sequence entries, part 253.
3975. gbvrl254.seq - Viral sequence entries, part 254.
3976. gbvrl255.seq - Viral sequence entries, part 255.
3977. gbvrl256.seq - Viral sequence entries, part 256.
3978. gbvrl257.seq - Viral sequence entries, part 257.
3979. gbvrl258.seq - Viral sequence entries, part 258.
3980. gbvrl259.seq - Viral sequence entries, part 259.
3981. gbvrl26.seq - Viral sequence entries, part 26.
3982. gbvrl260.seq - Viral sequence entries, part 260.
3983. gbvrl261.seq - Viral sequence entries, part 261.
3984. gbvrl262.seq - Viral sequence entries, part 262.
3985. gbvrl263.seq - Viral sequence entries, part 263.
3986. gbvrl264.seq - Viral sequence entries, part 264.
3987. gbvrl265.seq - Viral sequence entries, part 265.
3988. gbvrl266.seq - Viral sequence entries, part 266.
3989. gbvrl267.seq - Viral sequence entries, part 267.
3990. gbvrl268.seq - Viral sequence entries, part 268.
3991. gbvrl269.seq - Viral sequence entries, part 269.
3992. gbvrl27.seq - Viral sequence entries, part 27.
3993. gbvrl270.seq - Viral sequence entries, part 270.
3994. gbvrl271.seq - Viral sequence entries, part 271.
3995. gbvrl272.seq - Viral sequence entries, part 272.
3996. gbvrl273.seq - Viral sequence entries, part 273.
3997. gbvrl274.seq - Viral sequence entries, part 274.
3998. gbvrl275.seq - Viral sequence entries, part 275.
3999. gbvrl276.seq - Viral sequence entries, part 276.
4000. gbvrl277.seq - Viral sequence entries, part 277.
4001. gbvrl278.seq - Viral sequence entries, part 278.
4002. gbvrl279.seq - Viral sequence entries, part 279.
4003. gbvrl28.seq - Viral sequence entries, part 28.
4004. gbvrl280.seq - Viral sequence entries, part 280.
4005. gbvrl281.seq - Viral sequence entries, part 281.
4006. gbvrl282.seq - Viral sequence entries, part 282.
4007. gbvrl283.seq - Viral sequence entries, part 283.
4008. gbvrl284.seq - Viral sequence entries, part 284.
4009. gbvrl285.seq - Viral sequence entries, part 285.
4010. gbvrl286.seq - Viral sequence entries, part 286.
4011. gbvrl287.seq - Viral sequence entries, part 287.
4012. gbvrl288.seq - Viral sequence entries, part 288.
4013. gbvrl289.seq - Viral sequence entries, part 289.
4014. gbvrl29.seq - Viral sequence entries, part 29.
4015. gbvrl290.seq - Viral sequence entries, part 290.
4016. gbvrl291.seq - Viral sequence entries, part 291.
4017. gbvrl292.seq - Viral sequence entries, part 292.
4018. gbvrl293.seq - Viral sequence entries, part 293.
4019. gbvrl294.seq - Viral sequence entries, part 294.
4020. gbvrl295.seq - Viral sequence entries, part 295.
4021. gbvrl296.seq - Viral sequence entries, part 296.
4022. gbvrl297.seq - Viral sequence entries, part 297.
4023. gbvrl298.seq - Viral sequence entries, part 298.
4024. gbvrl299.seq - Viral sequence entries, part 299.
4025. gbvrl3.seq - Viral sequence entries, part 3.
4026. gbvrl30.seq - Viral sequence entries, part 30.
4027. gbvrl300.seq - Viral sequence entries, part 300.
4028. gbvrl301.seq - Viral sequence entries, part 301.
4029. gbvrl302.seq - Viral sequence entries, part 302.
4030. gbvrl303.seq - Viral sequence entries, part 303.
4031. gbvrl304.seq - Viral sequence entries, part 304.
4032. gbvrl305.seq - Viral sequence entries, part 305.
4033. gbvrl306.seq - Viral sequence entries, part 306.
4034. gbvrl307.seq - Viral sequence entries, part 307.
4035. gbvrl308.seq - Viral sequence entries, part 308.
4036. gbvrl309.seq - Viral sequence entries, part 309.
4037. gbvrl31.seq - Viral sequence entries, part 31.
4038. gbvrl310.seq - Viral sequence entries, part 310.
4039. gbvrl311.seq - Viral sequence entries, part 311.
4040. gbvrl312.seq - Viral sequence entries, part 312.
4041. gbvrl313.seq - Viral sequence entries, part 313.
4042. gbvrl314.seq - Viral sequence entries, part 314.
4043. gbvrl315.seq - Viral sequence entries, part 315.
4044. gbvrl316.seq - Viral sequence entries, part 316.
4045. gbvrl317.seq - Viral sequence entries, part 317.
4046. gbvrl318.seq - Viral sequence entries, part 318.
4047. gbvrl319.seq - Viral sequence entries, part 319.
4048. gbvrl32.seq - Viral sequence entries, part 32.
4049. gbvrl320.seq - Viral sequence entries, part 320.
4050. gbvrl321.seq - Viral sequence entries, part 321.
4051. gbvrl322.seq - Viral sequence entries, part 322.
4052. gbvrl323.seq - Viral sequence entries, part 323.
4053. gbvrl324.seq - Viral sequence entries, part 324.
4054. gbvrl325.seq - Viral sequence entries, part 325.
4055. gbvrl326.seq - Viral sequence entries, part 326.
4056. gbvrl327.seq - Viral sequence entries, part 327.
4057. gbvrl328.seq - Viral sequence entries, part 328.
4058. gbvrl329.seq - Viral sequence entries, part 329.
4059. gbvrl33.seq - Viral sequence entries, part 33.
4060. gbvrl330.seq - Viral sequence entries, part 330.
4061. gbvrl331.seq - Viral sequence entries, part 331.
4062. gbvrl332.seq - Viral sequence entries, part 332.
4063. gbvrl333.seq - Viral sequence entries, part 333.
4064. gbvrl334.seq - Viral sequence entries, part 334.
4065. gbvrl335.seq - Viral sequence entries, part 335.
4066. gbvrl336.seq - Viral sequence entries, part 336.
4067. gbvrl337.seq - Viral sequence entries, part 337.
4068. gbvrl338.seq - Viral sequence entries, part 338.
4069. gbvrl339.seq - Viral sequence entries, part 339.
4070. gbvrl34.seq - Viral sequence entries, part 34.
4071. gbvrl340.seq - Viral sequence entries, part 340.
4072. gbvrl341.seq - Viral sequence entries, part 341.
4073. gbvrl342.seq - Viral sequence entries, part 342.
4074. gbvrl343.seq - Viral sequence entries, part 343.
4075. gbvrl344.seq - Viral sequence entries, part 344.
4076. gbvrl345.seq - Viral sequence entries, part 345.
4077. gbvrl346.seq - Viral sequence entries, part 346.
4078. gbvrl347.seq - Viral sequence entries, part 347.
4079. gbvrl348.seq - Viral sequence entries, part 348.
4080. gbvrl349.seq - Viral sequence entries, part 349.
4081. gbvrl35.seq - Viral sequence entries, part 35.
4082. gbvrl350.seq - Viral sequence entries, part 350.
4083. gbvrl351.seq - Viral sequence entries, part 351.
4084. gbvrl352.seq - Viral sequence entries, part 352.
4085. gbvrl353.seq - Viral sequence entries, part 353.
4086. gbvrl354.seq - Viral sequence entries, part 354.
4087. gbvrl355.seq - Viral sequence entries, part 355.
4088. gbvrl356.seq - Viral sequence entries, part 356.
4089. gbvrl357.seq - Viral sequence entries, part 357.
4090. gbvrl358.seq - Viral sequence entries, part 358.
4091. gbvrl359.seq - Viral sequence entries, part 359.
4092. gbvrl36.seq - Viral sequence entries, part 36.
4093. gbvrl360.seq - Viral sequence entries, part 360.
4094. gbvrl361.seq - Viral sequence entries, part 361.
4095. gbvrl362.seq - Viral sequence entries, part 362.
4096. gbvrl363.seq - Viral sequence entries, part 363.
4097. gbvrl364.seq - Viral sequence entries, part 364.
4098. gbvrl365.seq - Viral sequence entries, part 365.
4099. gbvrl366.seq - Viral sequence entries, part 366.
4100. gbvrl367.seq - Viral sequence entries, part 367.
4101. gbvrl368.seq - Viral sequence entries, part 368.
4102. gbvrl369.seq - Viral sequence entries, part 369.
4103. gbvrl37.seq - Viral sequence entries, part 37.
4104. gbvrl370.seq - Viral sequence entries, part 370.
4105. gbvrl371.seq - Viral sequence entries, part 371.
4106. gbvrl372.seq - Viral sequence entries, part 372.
4107. gbvrl373.seq - Viral sequence entries, part 373.
4108. gbvrl374.seq - Viral sequence entries, part 374.
4109. gbvrl375.seq - Viral sequence entries, part 375.
4110. gbvrl38.seq - Viral sequence entries, part 38.
4111. gbvrl39.seq - Viral sequence entries, part 39.
4112. gbvrl4.seq - Viral sequence entries, part 4.
4113. gbvrl40.seq - Viral sequence entries, part 40.
4114. gbvrl41.seq - Viral sequence entries, part 41.
4115. gbvrl42.seq - Viral sequence entries, part 42.
4116. gbvrl43.seq - Viral sequence entries, part 43.
4117. gbvrl44.seq - Viral sequence entries, part 44.
4118. gbvrl45.seq - Viral sequence entries, part 45.
4119. gbvrl46.seq - Viral sequence entries, part 46.
4120. gbvrl47.seq - Viral sequence entries, part 47.
4121. gbvrl48.seq - Viral sequence entries, part 48.
4122. gbvrl49.seq - Viral sequence entries, part 49.
4123. gbvrl5.seq - Viral sequence entries, part 5.
4124. gbvrl50.seq - Viral sequence entries, part 50.
4125. gbvrl51.seq - Viral sequence entries, part 51.
4126. gbvrl52.seq - Viral sequence entries, part 52.
4127. gbvrl53.seq - Viral sequence entries, part 53.
4128. gbvrl54.seq - Viral sequence entries, part 54.
4129. gbvrl55.seq - Viral sequence entries, part 55.
4130. gbvrl56.seq - Viral sequence entries, part 56.
4131. gbvrl57.seq - Viral sequence entries, part 57.
4132. gbvrl58.seq - Viral sequence entries, part 58.
4133. gbvrl59.seq - Viral sequence entries, part 59.
4134. gbvrl6.seq - Viral sequence entries, part 6.
4135. gbvrl60.seq - Viral sequence entries, part 60.
4136. gbvrl61.seq - Viral sequence entries, part 61.
4137. gbvrl62.seq - Viral sequence entries, part 62.
4138. gbvrl63.seq - Viral sequence entries, part 63.
4139. gbvrl64.seq - Viral sequence entries, part 64.
4140. gbvrl65.seq - Viral sequence entries, part 65.
4141. gbvrl66.seq - Viral sequence entries, part 66.
4142. gbvrl67.seq - Viral sequence entries, part 67.
4143. gbvrl68.seq - Viral sequence entries, part 68.
4144. gbvrl69.seq - Viral sequence entries, part 69.
4145. gbvrl7.seq - Viral sequence entries, part 7.
4146. gbvrl70.seq - Viral sequence entries, part 70.
4147. gbvrl71.seq - Viral sequence entries, part 71.
4148. gbvrl72.seq - Viral sequence entries, part 72.
4149. gbvrl73.seq - Viral sequence entries, part 73.
4150. gbvrl74.seq - Viral sequence entries, part 74.
4151. gbvrl75.seq - Viral sequence entries, part 75.
4152. gbvrl76.seq - Viral sequence entries, part 76.
4153. gbvrl77.seq - Viral sequence entries, part 77.
4154. gbvrl78.seq - Viral sequence entries, part 78.
4155. gbvrl79.seq - Viral sequence entries, part 79.
4156. gbvrl8.seq - Viral sequence entries, part 8.
4157. gbvrl80.seq - Viral sequence entries, part 80.
4158. gbvrl81.seq - Viral sequence entries, part 81.
4159. gbvrl82.seq - Viral sequence entries, part 82.
4160. gbvrl83.seq - Viral sequence entries, part 83.
4161. gbvrl84.seq - Viral sequence entries, part 84.
4162. gbvrl85.seq - Viral sequence entries, part 85.
4163. gbvrl86.seq - Viral sequence entries, part 86.
4164. gbvrl87.seq - Viral sequence entries, part 87.
4165. gbvrl88.seq - Viral sequence entries, part 88.
4166. gbvrl89.seq - Viral sequence entries, part 89.
4167. gbvrl9.seq - Viral sequence entries, part 9.
4168. gbvrl90.seq - Viral sequence entries, part 90.
4169. gbvrl91.seq - Viral sequence entries, part 91.
4170. gbvrl92.seq - Viral sequence entries, part 92.
4171. gbvrl93.seq - Viral sequence entries, part 93.
4172. gbvrl94.seq - Viral sequence entries, part 94.
4173. gbvrl95.seq - Viral sequence entries, part 95.
4174. gbvrl96.seq - Viral sequence entries, part 96.
4175. gbvrl97.seq - Viral sequence entries, part 97.
4176. gbvrl98.seq - Viral sequence entries, part 98.
4177. gbvrl99.seq - Viral sequence entries, part 99.
4178. gbvrt1.seq - Other vertebrate sequence entries, part 1.
4179. gbvrt10.seq - Other vertebrate sequence entries, part 10.
4180. gbvrt100.seq - Other vertebrate sequence entries, part 100.
4181. gbvrt101.seq - Other vertebrate sequence entries, part 101.
4182. gbvrt102.seq - Other vertebrate sequence entries, part 102.
4183. gbvrt103.seq - Other vertebrate sequence entries, part 103.
4184. gbvrt104.seq - Other vertebrate sequence entries, part 104.
4185. gbvrt105.seq - Other vertebrate sequence entries, part 105.
4186. gbvrt106.seq - Other vertebrate sequence entries, part 106.
4187. gbvrt107.seq - Other vertebrate sequence entries, part 107.
4188. gbvrt108.seq - Other vertebrate sequence entries, part 108.
4189. gbvrt109.seq - Other vertebrate sequence entries, part 109.
4190. gbvrt11.seq - Other vertebrate sequence entries, part 11.
4191. gbvrt110.seq - Other vertebrate sequence entries, part 110.
4192. gbvrt111.seq - Other vertebrate sequence entries, part 111.
4193. gbvrt112.seq - Other vertebrate sequence entries, part 112.
4194. gbvrt113.seq - Other vertebrate sequence entries, part 113.
4195. gbvrt114.seq - Other vertebrate sequence entries, part 114.
4196. gbvrt115.seq - Other vertebrate sequence entries, part 115.
4197. gbvrt116.seq - Other vertebrate sequence entries, part 116.
4198. gbvrt117.seq - Other vertebrate sequence entries, part 117.
4199. gbvrt118.seq - Other vertebrate sequence entries, part 118.
4200. gbvrt119.seq - Other vertebrate sequence entries, part 119.
4201. gbvrt12.seq - Other vertebrate sequence entries, part 12.
4202. gbvrt120.seq - Other vertebrate sequence entries, part 120.
4203. gbvrt121.seq - Other vertebrate sequence entries, part 121.
4204. gbvrt122.seq - Other vertebrate sequence entries, part 122.
4205. gbvrt123.seq - Other vertebrate sequence entries, part 123.
4206. gbvrt124.seq - Other vertebrate sequence entries, part 124.
4207. gbvrt125.seq - Other vertebrate sequence entries, part 125.
4208. gbvrt126.seq - Other vertebrate sequence entries, part 126.
4209. gbvrt127.seq - Other vertebrate sequence entries, part 127.
4210. gbvrt128.seq - Other vertebrate sequence entries, part 128.
4211. gbvrt129.seq - Other vertebrate sequence entries, part 129.
4212. gbvrt13.seq - Other vertebrate sequence entries, part 13.
4213. gbvrt130.seq - Other vertebrate sequence entries, part 130.
4214. gbvrt131.seq - Other vertebrate sequence entries, part 131.
4215. gbvrt132.seq - Other vertebrate sequence entries, part 132.
4216. gbvrt133.seq - Other vertebrate sequence entries, part 133.
4217. gbvrt134.seq - Other vertebrate sequence entries, part 134.
4218. gbvrt135.seq - Other vertebrate sequence entries, part 135.
4219. gbvrt136.seq - Other vertebrate sequence entries, part 136.
4220. gbvrt137.seq - Other vertebrate sequence entries, part 137.
4221. gbvrt138.seq - Other vertebrate sequence entries, part 138.
4222. gbvrt139.seq - Other vertebrate sequence entries, part 139.
4223. gbvrt14.seq - Other vertebrate sequence entries, part 14.
4224. gbvrt140.seq - Other vertebrate sequence entries, part 140.
4225. gbvrt141.seq - Other vertebrate sequence entries, part 141.
4226. gbvrt142.seq - Other vertebrate sequence entries, part 142.
4227. gbvrt143.seq - Other vertebrate sequence entries, part 143.
4228. gbvrt144.seq - Other vertebrate sequence entries, part 144.
4229. gbvrt145.seq - Other vertebrate sequence entries, part 145.
4230. gbvrt146.seq - Other vertebrate sequence entries, part 146.
4231. gbvrt147.seq - Other vertebrate sequence entries, part 147.
4232. gbvrt148.seq - Other vertebrate sequence entries, part 148.
4233. gbvrt149.seq - Other vertebrate sequence entries, part 149.
4234. gbvrt15.seq - Other vertebrate sequence entries, part 15.
4235. gbvrt150.seq - Other vertebrate sequence entries, part 150.
4236. gbvrt151.seq - Other vertebrate sequence entries, part 151.
4237. gbvrt152.seq - Other vertebrate sequence entries, part 152.
4238. gbvrt153.seq - Other vertebrate sequence entries, part 153.
4239. gbvrt154.seq - Other vertebrate sequence entries, part 154.
4240. gbvrt155.seq - Other vertebrate sequence entries, part 155.
4241. gbvrt156.seq - Other vertebrate sequence entries, part 156.
4242. gbvrt157.seq - Other vertebrate sequence entries, part 157.
4243. gbvrt158.seq - Other vertebrate sequence entries, part 158.
4244. gbvrt159.seq - Other vertebrate sequence entries, part 159.
4245. gbvrt16.seq - Other vertebrate sequence entries, part 16.
4246. gbvrt160.seq - Other vertebrate sequence entries, part 160.
4247. gbvrt161.seq - Other vertebrate sequence entries, part 161.
4248. gbvrt162.seq - Other vertebrate sequence entries, part 162.
4249. gbvrt163.seq - Other vertebrate sequence entries, part 163.
4250. gbvrt164.seq - Other vertebrate sequence entries, part 164.
4251. gbvrt165.seq - Other vertebrate sequence entries, part 165.
4252. gbvrt166.seq - Other vertebrate sequence entries, part 166.
4253. gbvrt167.seq - Other vertebrate sequence entries, part 167.
4254. gbvrt168.seq - Other vertebrate sequence entries, part 168.
4255. gbvrt169.seq - Other vertebrate sequence entries, part 169.
4256. gbvrt17.seq - Other vertebrate sequence entries, part 17.
4257. gbvrt170.seq - Other vertebrate sequence entries, part 170.
4258. gbvrt171.seq - Other vertebrate sequence entries, part 171.
4259. gbvrt172.seq - Other vertebrate sequence entries, part 172.
4260. gbvrt173.seq - Other vertebrate sequence entries, part 173.
4261. gbvrt174.seq - Other vertebrate sequence entries, part 174.
4262. gbvrt175.seq - Other vertebrate sequence entries, part 175.
4263. gbvrt176.seq - Other vertebrate sequence entries, part 176.
4264. gbvrt177.seq - Other vertebrate sequence entries, part 177.
4265. gbvrt178.seq - Other vertebrate sequence entries, part 178.
4266. gbvrt179.seq - Other vertebrate sequence entries, part 179.
4267. gbvrt18.seq - Other vertebrate sequence entries, part 18.
4268. gbvrt180.seq - Other vertebrate sequence entries, part 180.
4269. gbvrt181.seq - Other vertebrate sequence entries, part 181.
4270. gbvrt182.seq - Other vertebrate sequence entries, part 182.
4271. gbvrt183.seq - Other vertebrate sequence entries, part 183.
4272. gbvrt184.seq - Other vertebrate sequence entries, part 184.
4273. gbvrt185.seq - Other vertebrate sequence entries, part 185.
4274. gbvrt186.seq - Other vertebrate sequence entries, part 186.
4275. gbvrt187.seq - Other vertebrate sequence entries, part 187.
4276. gbvrt188.seq - Other vertebrate sequence entries, part 188.
4277. gbvrt189.seq - Other vertebrate sequence entries, part 189.
4278. gbvrt19.seq - Other vertebrate sequence entries, part 19.
4279. gbvrt190.seq - Other vertebrate sequence entries, part 190.
4280. gbvrt191.seq - Other vertebrate sequence entries, part 191.
4281. gbvrt192.seq - Other vertebrate sequence entries, part 192.
4282. gbvrt193.seq - Other vertebrate sequence entries, part 193.
4283. gbvrt194.seq - Other vertebrate sequence entries, part 194.
4284. gbvrt195.seq - Other vertebrate sequence entries, part 195.
4285. gbvrt196.seq - Other vertebrate sequence entries, part 196.
4286. gbvrt197.seq - Other vertebrate sequence entries, part 197.
4287. gbvrt198.seq - Other vertebrate sequence entries, part 198.
4288. gbvrt199.seq - Other vertebrate sequence entries, part 199.
4289. gbvrt2.seq - Other vertebrate sequence entries, part 2.
4290. gbvrt20.seq - Other vertebrate sequence entries, part 20.
4291. gbvrt200.seq - Other vertebrate sequence entries, part 200.
4292. gbvrt201.seq - Other vertebrate sequence entries, part 201.
4293. gbvrt202.seq - Other vertebrate sequence entries, part 202.
4294. gbvrt203.seq - Other vertebrate sequence entries, part 203.
4295. gbvrt204.seq - Other vertebrate sequence entries, part 204.
4296. gbvrt205.seq - Other vertebrate sequence entries, part 205.
4297. gbvrt206.seq - Other vertebrate sequence entries, part 206.
4298. gbvrt207.seq - Other vertebrate sequence entries, part 207.
4299. gbvrt208.seq - Other vertebrate sequence entries, part 208.
4300. gbvrt209.seq - Other vertebrate sequence entries, part 209.
4301. gbvrt21.seq - Other vertebrate sequence entries, part 21.
4302. gbvrt210.seq - Other vertebrate sequence entries, part 210.
4303. gbvrt211.seq - Other vertebrate sequence entries, part 211.
4304. gbvrt212.seq - Other vertebrate sequence entries, part 212.
4305. gbvrt213.seq - Other vertebrate sequence entries, part 213.
4306. gbvrt214.seq - Other vertebrate sequence entries, part 214.
4307. gbvrt215.seq - Other vertebrate sequence entries, part 215.
4308. gbvrt216.seq - Other vertebrate sequence entries, part 216.
4309. gbvrt217.seq - Other vertebrate sequence entries, part 217.
4310. gbvrt218.seq - Other vertebrate sequence entries, part 218.
4311. gbvrt219.seq - Other vertebrate sequence entries, part 219.
4312. gbvrt22.seq - Other vertebrate sequence entries, part 22.
4313. gbvrt220.seq - Other vertebrate sequence entries, part 220.
4314. gbvrt221.seq - Other vertebrate sequence entries, part 221.
4315. gbvrt222.seq - Other vertebrate sequence entries, part 222.
4316. gbvrt223.seq - Other vertebrate sequence entries, part 223.
4317. gbvrt224.seq - Other vertebrate sequence entries, part 224.
4318. gbvrt225.seq - Other vertebrate sequence entries, part 225.
4319. gbvrt226.seq - Other vertebrate sequence entries, part 226.
4320. gbvrt227.seq - Other vertebrate sequence entries, part 227.
4321. gbvrt228.seq - Other vertebrate sequence entries, part 228.
4322. gbvrt229.seq - Other vertebrate sequence entries, part 229.
4323. gbvrt23.seq - Other vertebrate sequence entries, part 23.
4324. gbvrt230.seq - Other vertebrate sequence entries, part 230.
4325. gbvrt231.seq - Other vertebrate sequence entries, part 231.
4326. gbvrt232.seq - Other vertebrate sequence entries, part 232.
4327. gbvrt233.seq - Other vertebrate sequence entries, part 233.
4328. gbvrt234.seq - Other vertebrate sequence entries, part 234.
4329. gbvrt235.seq - Other vertebrate sequence entries, part 235.
4330. gbvrt236.seq - Other vertebrate sequence entries, part 236.
4331. gbvrt237.seq - Other vertebrate sequence entries, part 237.
4332. gbvrt238.seq - Other vertebrate sequence entries, part 238.
4333. gbvrt239.seq - Other vertebrate sequence entries, part 239.
4334. gbvrt24.seq - Other vertebrate sequence entries, part 24.
4335. gbvrt240.seq - Other vertebrate sequence entries, part 240.
4336. gbvrt241.seq - Other vertebrate sequence entries, part 241.
4337. gbvrt242.seq - Other vertebrate sequence entries, part 242.
4338. gbvrt243.seq - Other vertebrate sequence entries, part 243.
4339. gbvrt244.seq - Other vertebrate sequence entries, part 244.
4340. gbvrt245.seq - Other vertebrate sequence entries, part 245.
4341. gbvrt246.seq - Other vertebrate sequence entries, part 246.
4342. gbvrt247.seq - Other vertebrate sequence entries, part 247.
4343. gbvrt248.seq - Other vertebrate sequence entries, part 248.
4344. gbvrt249.seq - Other vertebrate sequence entries, part 249.
4345. gbvrt25.seq - Other vertebrate sequence entries, part 25.
4346. gbvrt250.seq - Other vertebrate sequence entries, part 250.
4347. gbvrt251.seq - Other vertebrate sequence entries, part 251.
4348. gbvrt252.seq - Other vertebrate sequence entries, part 252.
4349. gbvrt253.seq - Other vertebrate sequence entries, part 253.
4350. gbvrt254.seq - Other vertebrate sequence entries, part 254.
4351. gbvrt255.seq - Other vertebrate sequence entries, part 255.
4352. gbvrt256.seq - Other vertebrate sequence entries, part 256.
4353. gbvrt257.seq - Other vertebrate sequence entries, part 257.
4354. gbvrt258.seq - Other vertebrate sequence entries, part 258.
4355. gbvrt259.seq - Other vertebrate sequence entries, part 259.
4356. gbvrt26.seq - Other vertebrate sequence entries, part 26.
4357. gbvrt260.seq - Other vertebrate sequence entries, part 260.
4358. gbvrt261.seq - Other vertebrate sequence entries, part 261.
4359. gbvrt262.seq - Other vertebrate sequence entries, part 262.
4360. gbvrt263.seq - Other vertebrate sequence entries, part 263.
4361. gbvrt264.seq - Other vertebrate sequence entries, part 264.
4362. gbvrt265.seq - Other vertebrate sequence entries, part 265.
4363. gbvrt266.seq - Other vertebrate sequence entries, part 266.
4364. gbvrt267.seq - Other vertebrate sequence entries, part 267.
4365. gbvrt268.seq - Other vertebrate sequence entries, part 268.
4366. gbvrt269.seq - Other vertebrate sequence entries, part 269.
4367. gbvrt27.seq - Other vertebrate sequence entries, part 27.
4368. gbvrt270.seq - Other vertebrate sequence entries, part 270.
4369. gbvrt271.seq - Other vertebrate sequence entries, part 271.
4370. gbvrt272.seq - Other vertebrate sequence entries, part 272.
4371. gbvrt273.seq - Other vertebrate sequence entries, part 273.
4372. gbvrt274.seq - Other vertebrate sequence entries, part 274.
4373. gbvrt275.seq - Other vertebrate sequence entries, part 275.
4374. gbvrt276.seq - Other vertebrate sequence entries, part 276.
4375. gbvrt277.seq - Other vertebrate sequence entries, part 277.
4376. gbvrt28.seq - Other vertebrate sequence entries, part 28.
4377. gbvrt29.seq - Other vertebrate sequence entries, part 29.
4378. gbvrt3.seq - Other vertebrate sequence entries, part 3.
4379. gbvrt30.seq - Other vertebrate sequence entries, part 30.
4380. gbvrt31.seq - Other vertebrate sequence entries, part 31.
4381. gbvrt32.seq - Other vertebrate sequence entries, part 32.
4382. gbvrt33.seq - Other vertebrate sequence entries, part 33.
4383. gbvrt34.seq - Other vertebrate sequence entries, part 34.
4384. gbvrt35.seq - Other vertebrate sequence entries, part 35.
4385. gbvrt36.seq - Other vertebrate sequence entries, part 36.
4386. gbvrt37.seq - Other vertebrate sequence entries, part 37.
4387. gbvrt38.seq - Other vertebrate sequence entries, part 38.
4388. gbvrt39.seq - Other vertebrate sequence entries, part 39.
4389. gbvrt4.seq - Other vertebrate sequence entries, part 4.
4390. gbvrt40.seq - Other vertebrate sequence entries, part 40.
4391. gbvrt41.seq - Other vertebrate sequence entries, part 41.
4392. gbvrt42.seq - Other vertebrate sequence entries, part 42.
4393. gbvrt43.seq - Other vertebrate sequence entries, part 43.
4394. gbvrt44.seq - Other vertebrate sequence entries, part 44.
4395. gbvrt45.seq - Other vertebrate sequence entries, part 45.
4396. gbvrt46.seq - Other vertebrate sequence entries, part 46.
4397. gbvrt47.seq - Other vertebrate sequence entries, part 47.
4398. gbvrt48.seq - Other vertebrate sequence entries, part 48.
4399. gbvrt49.seq - Other vertebrate sequence entries, part 49.
4400. gbvrt5.seq - Other vertebrate sequence entries, part 5.
4401. gbvrt50.seq - Other vertebrate sequence entries, part 50.
4402. gbvrt51.seq - Other vertebrate sequence entries, part 51.
4403. gbvrt52.seq - Other vertebrate sequence entries, part 52.
4404. gbvrt53.seq - Other vertebrate sequence entries, part 53.
4405. gbvrt54.seq - Other vertebrate sequence entries, part 54.
4406. gbvrt55.seq - Other vertebrate sequence entries, part 55.
4407. gbvrt56.seq - Other vertebrate sequence entries, part 56.
4408. gbvrt57.seq - Other vertebrate sequence entries, part 57.
4409. gbvrt58.seq - Other vertebrate sequence entries, part 58.
4410. gbvrt59.seq - Other vertebrate sequence entries, part 59.
4411. gbvrt6.seq - Other vertebrate sequence entries, part 6.
4412. gbvrt60.seq - Other vertebrate sequence entries, part 60.
4413. gbvrt61.seq - Other vertebrate sequence entries, part 61.
4414. gbvrt62.seq - Other vertebrate sequence entries, part 62.
4415. gbvrt63.seq - Other vertebrate sequence entries, part 63.
4416. gbvrt64.seq - Other vertebrate sequence entries, part 64.
4417. gbvrt65.seq - Other vertebrate sequence entries, part 65.
4418. gbvrt66.seq - Other vertebrate sequence entries, part 66.
4419. gbvrt67.seq - Other vertebrate sequence entries, part 67.
4420. gbvrt68.seq - Other vertebrate sequence entries, part 68.
4421. gbvrt69.seq - Other vertebrate sequence entries, part 69.
4422. gbvrt7.seq - Other vertebrate sequence entries, part 7.
4423. gbvrt70.seq - Other vertebrate sequence entries, part 70.
4424. gbvrt71.seq - Other vertebrate sequence entries, part 71.
4425. gbvrt72.seq - Other vertebrate sequence entries, part 72.
4426. gbvrt73.seq - Other vertebrate sequence entries, part 73.
4427. gbvrt74.seq - Other vertebrate sequence entries, part 74.
4428. gbvrt75.seq - Other vertebrate sequence entries, part 75.
4429. gbvrt76.seq - Other vertebrate sequence entries, part 76.
4430. gbvrt77.seq - Other vertebrate sequence entries, part 77.
4431. gbvrt78.seq - Other vertebrate sequence entries, part 78.
4432. gbvrt79.seq - Other vertebrate sequence entries, part 79.
4433. gbvrt8.seq - Other vertebrate sequence entries, part 8.
4434. gbvrt80.seq - Other vertebrate sequence entries, part 80.
4435. gbvrt81.seq - Other vertebrate sequence entries, part 81.
4436. gbvrt82.seq - Other vertebrate sequence entries, part 82.
4437. gbvrt83.seq - Other vertebrate sequence entries, part 83.
4438. gbvrt84.seq - Other vertebrate sequence entries, part 84.
4439. gbvrt85.seq - Other vertebrate sequence entries, part 85.
4440. gbvrt86.seq - Other vertebrate sequence entries, part 86.
4441. gbvrt87.seq - Other vertebrate sequence entries, part 87.
4442. gbvrt88.seq - Other vertebrate sequence entries, part 88.
4443. gbvrt89.seq - Other vertebrate sequence entries, part 89.
4444. gbvrt9.seq - Other vertebrate sequence entries, part 9.
4445. gbvrt90.seq - Other vertebrate sequence entries, part 90.
4446. gbvrt91.seq - Other vertebrate sequence entries, part 91.
4447. gbvrt92.seq - Other vertebrate sequence entries, part 92.
4448. gbvrt93.seq - Other vertebrate sequence entries, part 93.
4449. gbvrt94.seq - Other vertebrate sequence entries, part 94.
4450. gbvrt95.seq - Other vertebrate sequence entries, part 95.
4451. gbvrt96.seq - Other vertebrate sequence entries, part 96.
4452. gbvrt97.seq - Other vertebrate sequence entries, part 97.
4453. gbvrt98.seq - Other vertebrate sequence entries, part 98.
4454. gbvrt99.seq - Other vertebrate sequence entries, part 99.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 247.0 flatfiles require roughly 2072 GB,
including the sequence files and the *.txt files.
The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
499259480 gbbct1.seq
496612960 gbbct10.seq
499324167 gbbct100.seq
499932129 gbbct101.seq
389028332 gbbct102.seq
499874269 gbbct103.seq
498124390 gbbct104.seq
499292813 gbbct105.seq
491408395 gbbct106.seq
13752576 gbbct107.seq
493589462 gbbct108.seq
494745656 gbbct109.seq
498136987 gbbct11.seq
495417091 gbbct110.seq
491069767 gbbct111.seq
195549944 gbbct112.seq
494137200 gbbct113.seq
492532604 gbbct114.seq
493222616 gbbct115.seq
497237544 gbbct116.seq
99480457 gbbct117.seq
499011099 gbbct118.seq
494100520 gbbct119.seq
498756045 gbbct12.seq
498830192 gbbct120.seq
333298131 gbbct121.seq
490710901 gbbct122.seq
498618623 gbbct123.seq
499996414 gbbct124.seq
426871894 gbbct125.seq
491476756 gbbct126.seq
489083565 gbbct127.seq
487156164 gbbct128.seq
498575686 gbbct129.seq
27848759 gbbct13.seq
490822708 gbbct130.seq
488628042 gbbct131.seq
425698283 gbbct132.seq
498287600 gbbct133.seq
489448148 gbbct134.seq
499734618 gbbct135.seq
461301978 gbbct136.seq
495776368 gbbct137.seq
493829163 gbbct138.seq
491661079 gbbct139.seq
499887466 gbbct14.seq
498685040 gbbct140.seq
499806039 gbbct141.seq
147979248 gbbct142.seq
496896898 gbbct143.seq
494838871 gbbct144.seq
493251880 gbbct145.seq
494975862 gbbct146.seq
404787526 gbbct147.seq
489367453 gbbct148.seq
490447002 gbbct149.seq
496454456 gbbct15.seq
498396095 gbbct150.seq
497204439 gbbct151.seq
492635401 gbbct152.seq
341076607 gbbct153.seq
497655705 gbbct154.seq
494967400 gbbct155.seq
496951858 gbbct156.seq
489042983 gbbct157.seq
493287316 gbbct158.seq
496052394 gbbct159.seq
496649883 gbbct16.seq
159717876 gbbct160.seq
494733255 gbbct161.seq
491514117 gbbct162.seq
495160140 gbbct163.seq
475148166 gbbct164.seq
497456266 gbbct165.seq
493190416 gbbct166.seq
492199036 gbbct167.seq
491123378 gbbct168.seq
493968202 gbbct169.seq
492249028 gbbct17.seq
489220638 gbbct170.seq
497866775 gbbct171.seq
493887547 gbbct172.seq
185980584 gbbct173.seq
493674830 gbbct174.seq
491173897 gbbct175.seq
499375473 gbbct176.seq
273476308 gbbct177.seq
495005879 gbbct178.seq
495932708 gbbct179.seq
10689912 gbbct18.seq
489790180 gbbct180.seq
303707273 gbbct181.seq
499225752 gbbct182.seq
489058640 gbbct183.seq
495424960 gbbct184.seq
496021735 gbbct185.seq
67162117 gbbct186.seq
498036470 gbbct187.seq
497779458 gbbct188.seq
496082556 gbbct189.seq
498898071 gbbct19.seq
496491420 gbbct190.seq
499747522 gbbct191.seq
192261371 gbbct192.seq
498767524 gbbct193.seq
497238511 gbbct194.seq
493962900 gbbct195.seq
497330771 gbbct196.seq
275862662 gbbct197.seq
495095202 gbbct198.seq
495971863 gbbct199.seq
497213550 gbbct2.seq
494174935 gbbct20.seq
496079271 gbbct200.seq
493223749 gbbct201.seq
246412464 gbbct202.seq
499817107 gbbct203.seq
497426553 gbbct204.seq
497029420 gbbct205.seq
484791693 gbbct206.seq
440229810 gbbct207.seq
499900270 gbbct208.seq
496011603 gbbct209.seq
499430669 gbbct21.seq
481293325 gbbct210.seq
496168589 gbbct211.seq
495262662 gbbct212.seq
499946384 gbbct213.seq
318928688 gbbct214.seq
497109748 gbbct215.seq
493797358 gbbct216.seq
496714951 gbbct217.seq
378276833 gbbct218.seq
484833376 gbbct219.seq
494264055 gbbct22.seq
495646244 gbbct220.seq
499615273 gbbct221.seq
497011341 gbbct222.seq
228371678 gbbct223.seq
493989285 gbbct224.seq
489510996 gbbct225.seq
488962683 gbbct226.seq
173357137 gbbct227.seq
493892623 gbbct228.seq
492907486 gbbct229.seq
65823472 gbbct23.seq
493520883 gbbct230.seq
496872338 gbbct231.seq
136681481 gbbct232.seq
494063240 gbbct233.seq
488280336 gbbct234.seq
489824993 gbbct235.seq
489987006 gbbct236.seq
145652118 gbbct237.seq
483161615 gbbct238.seq
496790685 gbbct239.seq
492477723 gbbct24.seq
489571129 gbbct240.seq
446057099 gbbct241.seq
492193861 gbbct242.seq
487559567 gbbct243.seq
492444359 gbbct244.seq
457216212 gbbct245.seq
498159153 gbbct246.seq
490705855 gbbct247.seq
496101905 gbbct248.seq
492720782 gbbct249.seq
490124422 gbbct25.seq
495668456 gbbct250.seq
131796901 gbbct251.seq
491982944 gbbct252.seq
488305773 gbbct253.seq
484960307 gbbct254.seq
448261511 gbbct255.seq
496469902 gbbct256.seq
495798379 gbbct257.seq
499577661 gbbct258.seq
448624123 gbbct259.seq
498214368 gbbct26.seq
496061094 gbbct260.seq
499419753 gbbct261.seq
488828327 gbbct262.seq
496557702 gbbct263.seq
496529316 gbbct264.seq
497207070 gbbct265.seq
157062365 gbbct266.seq
491163381 gbbct267.seq
488410881 gbbct268.seq
497409217 gbbct269.seq
497675432 gbbct27.seq
495127243 gbbct270.seq
24400806 gbbct271.seq
497188850 gbbct272.seq
496648193 gbbct273.seq
496913586 gbbct274.seq
458244617 gbbct275.seq
498862100 gbbct276.seq
493444482 gbbct277.seq
499643473 gbbct278.seq
486051956 gbbct279.seq
206962983 gbbct28.seq
492091412 gbbct280.seq
498417795 gbbct281.seq
498412550 gbbct282.seq
481644647 gbbct283.seq
487661791 gbbct284.seq
490839877 gbbct285.seq
497466942 gbbct286.seq
496515382 gbbct287.seq
498703086 gbbct288.seq
491043235 gbbct289.seq
497340655 gbbct29.seq
243311482 gbbct290.seq
492633179 gbbct291.seq
498721787 gbbct292.seq
496314451 gbbct293.seq
495824074 gbbct294.seq
358381811 gbbct295.seq
498732025 gbbct296.seq
495863974 gbbct297.seq
496227294 gbbct298.seq
496935580 gbbct299.seq
301461507 gbbct3.seq
497861790 gbbct30.seq
387482713 gbbct300.seq
494855877 gbbct301.seq
494741752 gbbct302.seq
499982911 gbbct303.seq
489769297 gbbct304.seq
413163493 gbbct305.seq
498785469 gbbct306.seq
497116078 gbbct307.seq
488501771 gbbct308.seq
497888982 gbbct309.seq
492727160 gbbct31.seq
389355908 gbbct310.seq
491217074 gbbct311.seq
497116159 gbbct312.seq
497052465 gbbct313.seq
494542416 gbbct314.seq
433978422 gbbct315.seq
497529569 gbbct316.seq
493930050 gbbct317.seq
499363443 gbbct318.seq
496245689 gbbct319.seq
479354454 gbbct32.seq
232180401 gbbct320.seq
495594905 gbbct321.seq
498470636 gbbct322.seq
492943609 gbbct323.seq
495557340 gbbct324.seq
396883322 gbbct325.seq
490874808 gbbct326.seq
499740580 gbbct327.seq
495156285 gbbct328.seq
496472836 gbbct329.seq
499615969 gbbct33.seq
497532835 gbbct330.seq
497318169 gbbct331.seq
494052623 gbbct332.seq
200007003 gbbct333.seq
488777141 gbbct334.seq
496209304 gbbct335.seq
492689061 gbbct336.seq
495895791 gbbct337.seq
492154954 gbbct338.seq
495701158 gbbct339.seq
496530149 gbbct34.seq
200905335 gbbct340.seq
493830573 gbbct341.seq
499628676 gbbct342.seq
499949000 gbbct343.seq
499387139 gbbct344.seq
346576950 gbbct345.seq
497565034 gbbct346.seq
499825673 gbbct347.seq
490104239 gbbct348.seq
486817395 gbbct349.seq
487951351 gbbct35.seq
496051375 gbbct350.seq
499501315 gbbct351.seq
495843948 gbbct352.seq
6565056 gbbct353.seq
488618122 gbbct354.seq
488289848 gbbct355.seq
497016570 gbbct356.seq
499548856 gbbct357.seq
136114841 gbbct358.seq
495699614 gbbct359.seq
499261465 gbbct36.seq
499901696 gbbct360.seq
493828023 gbbct361.seq
496877473 gbbct362.seq
139086569 gbbct363.seq
492034210 gbbct364.seq
496396132 gbbct365.seq
492762556 gbbct366.seq
498390460 gbbct367.seq
493564294 gbbct368.seq
491470762 gbbct369.seq
412319882 gbbct37.seq
78679756 gbbct370.seq
497084397 gbbct371.seq
496693486 gbbct372.seq
498025876 gbbct373.seq
496976675 gbbct374.seq
492020214 gbbct375.seq
494507374 gbbct376.seq
272891762 gbbct377.seq
490502556 gbbct378.seq
498185513 gbbct379.seq
21422275 gbbct38.seq
493195301 gbbct380.seq
498843190 gbbct381.seq
497203253 gbbct382.seq
175983756 gbbct383.seq
495693150 gbbct384.seq
493701177 gbbct385.seq
497742378 gbbct386.seq
495114023 gbbct387.seq
490532237 gbbct388.seq
400797089 gbbct389.seq
38670853 gbbct39.seq
496813684 gbbct390.seq
491384339 gbbct391.seq
497873487 gbbct392.seq
497522835 gbbct393.seq
493728607 gbbct394.seq
496204168 gbbct395.seq
244097822 gbbct396.seq
491413692 gbbct397.seq
493169126 gbbct398.seq
496244710 gbbct399.seq
394605700 gbbct4.seq
499518955 gbbct40.seq
495287815 gbbct400.seq
142636038 gbbct401.seq
484011784 gbbct402.seq
494094195 gbbct403.seq
498211901 gbbct404.seq
498467296 gbbct405.seq
365378913 gbbct406.seq
497736167 gbbct407.seq
495588675 gbbct408.seq
492255322 gbbct409.seq
495920377 gbbct41.seq
492578950 gbbct410.seq
219936688 gbbct411.seq
493594425 gbbct412.seq
495578034 gbbct413.seq
495904326 gbbct414.seq
493958546 gbbct415.seq
147493880 gbbct416.seq
499863872 gbbct417.seq
493319269 gbbct418.seq
487924223 gbbct419.seq
497800129 gbbct42.seq
497771554 gbbct420.seq
24099917 gbbct421.seq
494159595 gbbct422.seq
498759724 gbbct423.seq
498971511 gbbct424.seq
487259151 gbbct425.seq
493426836 gbbct426.seq
490784326 gbbct427.seq
495843655 gbbct428.seq
497846877 gbbct429.seq
446397825 gbbct43.seq
494199224 gbbct430.seq
216229141 gbbct431.seq
496382730 gbbct432.seq
492218238 gbbct433.seq
493701457 gbbct434.seq
499598941 gbbct435.seq
401883704 gbbct436.seq
492735773 gbbct437.seq
491656794 gbbct438.seq
498341617 gbbct439.seq
497462651 gbbct44.seq
492422446 gbbct440.seq
497905612 gbbct441.seq
495142621 gbbct442.seq
26230577 gbbct443.seq
494893698 gbbct444.seq
494078686 gbbct445.seq
497060323 gbbct446.seq
497397465 gbbct447.seq
495245242 gbbct448.seq
488504791 gbbct449.seq
491184025 gbbct45.seq
104824017 gbbct450.seq
488324528 gbbct451.seq
497533793 gbbct452.seq
493548787 gbbct453.seq
499403536 gbbct454.seq
490776009 gbbct455.seq
457647469 gbbct456.seq
494298101 gbbct457.seq
493347926 gbbct458.seq
495710628 gbbct459.seq
499082429 gbbct46.seq
488828204 gbbct460.seq
115773954 gbbct461.seq
496594910 gbbct462.seq
499149912 gbbct463.seq
499125261 gbbct464.seq
499944936 gbbct465.seq
490800718 gbbct466.seq
494864784 gbbct467.seq
248271795 gbbct468.seq
490780784 gbbct469.seq
495738282 gbbct47.seq
488637491 gbbct470.seq
486173029 gbbct471.seq
499840113 gbbct472.seq
496320739 gbbct473.seq
498128900 gbbct474.seq
7085764 gbbct475.seq
489159851 gbbct476.seq
489835660 gbbct477.seq
497847102 gbbct478.seq
495450447 gbbct479.seq
488459731 gbbct48.seq
497974388 gbbct480.seq
300531746 gbbct481.seq
499164493 gbbct482.seq
487164463 gbbct483.seq
495032510 gbbct484.seq
492976639 gbbct485.seq
495031093 gbbct486.seq
494983718 gbbct487.seq
172358845 gbbct488.seq
495524387 gbbct489.seq
274679466 gbbct49.seq
490687905 gbbct490.seq
499771768 gbbct491.seq
495829156 gbbct492.seq
499851351 gbbct493.seq
335428627 gbbct494.seq
486521490 gbbct495.seq
492583395 gbbct496.seq
497515436 gbbct497.seq
493698334 gbbct498.seq
499460732 gbbct499.seq
459635489 gbbct5.seq
496358754 gbbct50.seq
162678193 gbbct500.seq
495672213 gbbct501.seq
492539722 gbbct502.seq
499660823 gbbct503.seq
499303338 gbbct504.seq
332085515 gbbct505.seq
495965397 gbbct506.seq
489288126 gbbct507.seq
491026355 gbbct508.seq
495680320 gbbct509.seq
499742179 gbbct51.seq
498487247 gbbct510.seq
428017441 gbbct511.seq
491800376 gbbct512.seq
496310295 gbbct513.seq
485849974 gbbct514.seq
493461273 gbbct515.seq
313040872 gbbct516.seq
495818347 gbbct517.seq
494012499 gbbct518.seq
492318964 gbbct519.seq
499660484 gbbct52.seq
497437056 gbbct520.seq
353456945 gbbct521.seq
497870951 gbbct522.seq
497926061 gbbct523.seq
498555781 gbbct524.seq
491177451 gbbct525.seq
439916488 gbbct526.seq
490256701 gbbct527.seq
495352494 gbbct528.seq
490394427 gbbct529.seq
499517346 gbbct53.seq
497144021 gbbct530.seq
495280243 gbbct531.seq
495434762 gbbct532.seq
494508342 gbbct533.seq
497077552 gbbct534.seq
498042992 gbbct535.seq
422660336 gbbct536.seq
493233075 gbbct537.seq
498383177 gbbct538.seq
491978104 gbbct539.seq
491852124 gbbct54.seq
499381634 gbbct540.seq
472571076 gbbct541.seq
492719104 gbbct542.seq
488680115 gbbct543.seq
492109864 gbbct544.seq
499745708 gbbct545.seq
468205713 gbbct546.seq
490321550 gbbct547.seq
494880340 gbbct548.seq
498767552 gbbct549.seq
327207257 gbbct55.seq
491330833 gbbct550.seq
493222164 gbbct551.seq
325516981 gbbct552.seq
492008712 gbbct553.seq
498724711 gbbct554.seq
492669894 gbbct555.seq
496501844 gbbct556.seq
317469466 gbbct557.seq
489172787 gbbct558.seq
495720623 gbbct559.seq
499974669 gbbct56.seq
490283945 gbbct560.seq
496658970 gbbct561.seq
498307920 gbbct562.seq
292744921 gbbct563.seq
488171879 gbbct564.seq
491599972 gbbct565.seq
490702609 gbbct566.seq
493768521 gbbct567.seq
127994869 gbbct568.seq
498308197 gbbct569.seq
492293149 gbbct57.seq
496917099 gbbct570.seq
492714293 gbbct571.seq
495117201 gbbct572.seq
499547922 gbbct573.seq
488586301 gbbct574.seq
69517436 gbbct575.seq
493502195 gbbct576.seq
495907098 gbbct577.seq
489805316 gbbct578.seq
493999235 gbbct579.seq
489450337 gbbct58.seq
130319158 gbbct580.seq
491930852 gbbct581.seq
488648691 gbbct582.seq
494755059 gbbct583.seq
491068814 gbbct584.seq
493047324 gbbct585.seq
100400767 gbbct586.seq
497863536 gbbct587.seq
498962216 gbbct588.seq
499817289 gbbct589.seq
497371491 gbbct59.seq
496295481 gbbct590.seq
108708425 gbbct591.seq
490580638 gbbct592.seq
497703337 gbbct593.seq
491079551 gbbct594.seq
493503843 gbbct595.seq
36625246 gbbct596.seq
495779279 gbbct597.seq
491327650 gbbct598.seq
490677322 gbbct599.seq
102231227 gbbct6.seq
499930372 gbbct60.seq
495667068 gbbct600.seq
63280077 gbbct601.seq
496199725 gbbct602.seq
493531855 gbbct603.seq
494756636 gbbct604.seq
494106266 gbbct605.seq
291541528 gbbct606.seq
491839080 gbbct607.seq
499990633 gbbct608.seq
498927443 gbbct609.seq
495180468 gbbct61.seq
489118564 gbbct610.seq
488185233 gbbct611.seq
348336361 gbbct612.seq
305795072 gbbct613.seq
6889743 gbbct614.seq
14165487 gbbct615.seq
22795937 gbbct616.seq
44486451 gbbct617.seq
86608120 gbbct618.seq
168532685 gbbct619.seq
112142395 gbbct62.seq
499998953 gbbct620.seq
492658247 gbbct621.seq
499477361 gbbct622.seq
499964784 gbbct623.seq
498194733 gbbct624.seq
499998552 gbbct625.seq
131034050 gbbct626.seq
493357177 gbbct627.seq
499344297 gbbct628.seq
484371840 gbbct629.seq
494607843 gbbct63.seq
499999529 gbbct630.seq
218593740 gbbct631.seq
499999447 gbbct632.seq
290354752 gbbct633.seq
500000144 gbbct634.seq
85322943 gbbct635.seq
499997375 gbbct636.seq
125260141 gbbct637.seq
499998196 gbbct638.seq
44499956 gbbct639.seq
499071306 gbbct64.seq
146513292 gbbct640.seq
499088688 gbbct641.seq
499334296 gbbct642.seq
497110345 gbbct643.seq
489926396 gbbct644.seq
493050028 gbbct645.seq
497933391 gbbct646.seq
497254622 gbbct647.seq
488464412 gbbct648.seq
305471094 gbbct649.seq
496563653 gbbct65.seq
495496742 gbbct650.seq
498011072 gbbct651.seq
498177095 gbbct652.seq
168612837 gbbct653.seq
472461375 gbbct654.seq
497338619 gbbct655.seq
497109977 gbbct656.seq
499753219 gbbct657.seq
126536669 gbbct658.seq
488194545 gbbct659.seq
497567607 gbbct66.seq
496058636 gbbct660.seq
495758797 gbbct661.seq
330366148 gbbct662.seq
498499361 gbbct663.seq
497461802 gbbct664.seq
491671404 gbbct665.seq
325905521 gbbct666.seq
496306969 gbbct667.seq
497541981 gbbct668.seq
499037514 gbbct669.seq
499752515 gbbct67.seq
243471317 gbbct670.seq
492626672 gbbct671.seq
496920919 gbbct672.seq
498726058 gbbct673.seq
498559022 gbbct674.seq
105681578 gbbct675.seq
496393319 gbbct676.seq
489823041 gbbct677.seq
498850470 gbbct678.seq
457162623 gbbct679.seq
490382212 gbbct68.seq
51232093 gbbct680.seq
107838107 gbbct681.seq
499999156 gbbct682.seq
499999059 gbbct683.seq
349482112 gbbct684.seq
499999049 gbbct685.seq
496966385 gbbct686.seq
499993942 gbbct687.seq
62448765 gbbct688.seq
257413019 gbbct69.seq
282435513 gbbct7.seq
499969319 gbbct70.seq
495193643 gbbct71.seq
486287619 gbbct72.seq
493007117 gbbct73.seq
475857706 gbbct74.seq
490138187 gbbct75.seq
485838566 gbbct76.seq
497985729 gbbct77.seq
498936924 gbbct78.seq
306897163 gbbct79.seq
493057045 gbbct8.seq
491474134 gbbct80.seq
494313903 gbbct81.seq
495819854 gbbct82.seq
498720135 gbbct83.seq
499103525 gbbct84.seq
261686678 gbbct85.seq
498131156 gbbct86.seq
499518120 gbbct87.seq
498962667 gbbct88.seq
488108298 gbbct89.seq
493341951 gbbct9.seq
397950605 gbbct90.seq
498261726 gbbct91.seq
492775588 gbbct92.seq
495523568 gbbct93.seq
300972613 gbbct94.seq
499886298 gbbct95.seq
495464581 gbbct96.seq
496856415 gbbct97.seq
74937857 gbbct98.seq
489628381 gbbct99.seq
1197444 gbchg.txt
499829089 gbcon1.seq
499996911 gbcon10.seq
499997716 gbcon100.seq
499998282 gbcon101.seq
169085272 gbcon102.seq
499871153 gbcon103.seq
498434527 gbcon104.seq
499996134 gbcon105.seq
499909892 gbcon106.seq
295511616 gbcon107.seq
499997195 gbcon108.seq
499998885 gbcon109.seq
498633689 gbcon11.seq
302127481 gbcon110.seq
499998740 gbcon111.seq
499998794 gbcon112.seq
129719889 gbcon113.seq
499879850 gbcon114.seq
499997696 gbcon115.seq
499544011 gbcon116.seq
277040672 gbcon117.seq
499999876 gbcon118.seq
499999395 gbcon119.seq
499993720 gbcon12.seq
222253215 gbcon120.seq
45836617 gbcon121.seq
499942457 gbcon122.seq
499998578 gbcon123.seq
447238322 gbcon124.seq
499997943 gbcon125.seq
499998025 gbcon126.seq
499991213 gbcon127.seq
196447274 gbcon128.seq
499995599 gbcon129.seq
498148333 gbcon13.seq
499998307 gbcon130.seq
238753423 gbcon131.seq
499998967 gbcon132.seq
466835842 gbcon133.seq
499997535 gbcon134.seq
499997800 gbcon135.seq
258872277 gbcon136.seq
499997740 gbcon137.seq
500000223 gbcon138.seq
497457444 gbcon139.seq
496523559 gbcon14.seq
499999139 gbcon140.seq
499997145 gbcon141.seq
179142419 gbcon142.seq
499998220 gbcon143.seq
499999267 gbcon144.seq
22767123 gbcon145.seq
499889958 gbcon146.seq
499998779 gbcon147.seq
410562055 gbcon148.seq
499942667 gbcon149.seq
498686185 gbcon15.seq
499902113 gbcon150.seq
376962139 gbcon151.seq
499993470 gbcon152.seq
499997683 gbcon153.seq
264124522 gbcon154.seq
499999522 gbcon155.seq
499998021 gbcon156.seq
81972538 gbcon157.seq
499997754 gbcon158.seq
499943102 gbcon159.seq
499917848 gbcon16.seq
499994720 gbcon160.seq
141101720 gbcon161.seq
499830763 gbcon162.seq
499983832 gbcon163.seq
499968068 gbcon164.seq
336326273 gbcon165.seq
499999379 gbcon166.seq
499966894 gbcon167.seq
398621359 gbcon168.seq
499999531 gbcon169.seq
496600854 gbcon17.seq
499999335 gbcon170.seq
499998743 gbcon171.seq
271485755 gbcon172.seq
499999711 gbcon173.seq
499998667 gbcon174.seq
499389044 gbcon175.seq
499999294 gbcon176.seq
154734611 gbcon177.seq
500000168 gbcon178.seq
499996814 gbcon179.seq
497306457 gbcon18.seq
137316083 gbcon180.seq
499992702 gbcon181.seq
499997814 gbcon182.seq
499998639 gbcon183.seq
302177094 gbcon184.seq
499943286 gbcon185.seq
499999013 gbcon186.seq
478528460 gbcon187.seq
499997013 gbcon188.seq
499981253 gbcon189.seq
261542820 gbcon19.seq
397710774 gbcon190.seq
499934774 gbcon191.seq
499994397 gbcon192.seq
499983792 gbcon193.seq
156248302 gbcon194.seq
499998392 gbcon195.seq
499998372 gbcon196.seq
37871910 gbcon197.seq
499997011 gbcon198.seq
499996786 gbcon199.seq
499999472 gbcon2.seq
499997687 gbcon20.seq
499999881 gbcon200.seq
499999652 gbcon201.seq
499994377 gbcon202.seq
266871190 gbcon203.seq
499999224 gbcon204.seq
452407112 gbcon205.seq
499990515 gbcon206.seq
499996980 gbcon207.seq
485368790 gbcon208.seq
499997937 gbcon209.seq
499999250 gbcon21.seq
499998820 gbcon210.seq
500000009 gbcon211.seq
16855954 gbcon212.seq
499996297 gbcon213.seq
499974143 gbcon214.seq
499998652 gbcon215.seq
276851584 gbcon216.seq
499898455 gbcon217.seq
499848353 gbcon218.seq
499989359 gbcon219.seq
499998925 gbcon22.seq
499956233 gbcon220.seq
499999416 gbcon221.seq
499998536 gbcon222.seq
83532924 gbcon223.seq
81416614 gbcon23.seq
499998430 gbcon24.seq
499999189 gbcon25.seq
499549271 gbcon26.seq
286871419 gbcon27.seq
499486419 gbcon28.seq
125749326 gbcon29.seq
499993648 gbcon3.seq
126444500 gbcon30.seq
499925023 gbcon31.seq
499992465 gbcon32.seq
26152220 gbcon33.seq
499999414 gbcon34.seq
499998297 gbcon35.seq
443990166 gbcon36.seq
499999057 gbcon37.seq
499998568 gbcon38.seq
499999100 gbcon39.seq
106310391 gbcon4.seq
41918782 gbcon40.seq
500000081 gbcon41.seq
499998540 gbcon42.seq
277009775 gbcon43.seq
499996336 gbcon44.seq
499998469 gbcon45.seq
270612827 gbcon46.seq
499996532 gbcon47.seq
499996905 gbcon48.seq
385374935 gbcon49.seq
499940282 gbcon5.seq
499997390 gbcon50.seq
499999185 gbcon51.seq
176580283 gbcon52.seq
499999848 gbcon53.seq
499997718 gbcon54.seq
238773972 gbcon55.seq
499997628 gbcon56.seq
499995125 gbcon57.seq
335698760 gbcon58.seq
499996299 gbcon59.seq
494453997 gbcon6.seq
499999132 gbcon60.seq
298461041 gbcon61.seq
499995314 gbcon62.seq
499999014 gbcon63.seq
259899669 gbcon64.seq
499996880 gbcon65.seq
499997062 gbcon66.seq
187377116 gbcon67.seq
499996720 gbcon68.seq
499999826 gbcon69.seq
494750151 gbcon7.seq
364586197 gbcon70.seq
499993696 gbcon71.seq
499999904 gbcon72.seq
386119955 gbcon73.seq
499993762 gbcon74.seq
472811181 gbcon75.seq
174082386 gbcon76.seq
499941095 gbcon77.seq
23944933 gbcon78.seq
499987096 gbcon79.seq
499998869 gbcon8.seq
203666963 gbcon80.seq
199581356 gbcon81.seq
499495651 gbcon82.seq
499985020 gbcon83.seq
337640522 gbcon84.seq
499532057 gbcon85.seq
495874659 gbcon86.seq
499843567 gbcon87.seq
337606451 gbcon88.seq
499974953 gbcon89.seq
61944908 gbcon9.seq
499999158 gbcon90.seq
499929470 gbcon91.seq
167922702 gbcon92.seq
499999160 gbcon93.seq
499999139 gbcon94.seq
132412701 gbcon95.seq
499987021 gbcon96.seq
500000082 gbcon97.seq
499997622 gbcon98.seq
266010665 gbcon99.seq
97817 gbdel.txt
500000248 gbenv1.seq
499996419 gbenv10.seq
149836713 gbenv11.seq
499997485 gbenv12.seq
499998230 gbenv13.seq
53792036 gbenv14.seq
499998528 gbenv15.seq
499999141 gbenv16.seq
500000256 gbenv17.seq
499996961 gbenv18.seq
5907179 gbenv19.seq
499999077 gbenv2.seq
499999149 gbenv20.seq
499999644 gbenv21.seq
173647211 gbenv22.seq
499962777 gbenv23.seq
499999731 gbenv24.seq
499999729 gbenv25.seq
82913024 gbenv26.seq
499998492 gbenv27.seq
499997232 gbenv28.seq
177807424 gbenv29.seq
352032590 gbenv3.seq
499998363 gbenv30.seq
499998925 gbenv31.seq
499999554 gbenv32.seq
46355793 gbenv33.seq
500000184 gbenv34.seq
500000087 gbenv35.seq
192748245 gbenv36.seq
499996215 gbenv37.seq
499998246 gbenv38.seq
334820848 gbenv39.seq
494542413 gbenv4.seq
499997731 gbenv40.seq
499998068 gbenv41.seq
470562694 gbenv42.seq
499998449 gbenv43.seq
499997688 gbenv44.seq
338452219 gbenv45.seq
499999850 gbenv46.seq
499998560 gbenv47.seq
394387252 gbenv48.seq
499998348 gbenv49.seq
496523175 gbenv5.seq
499999171 gbenv50.seq
345212973 gbenv51.seq
499998913 gbenv52.seq
499998645 gbenv53.seq
237943091 gbenv54.seq
499998678 gbenv55.seq
499999332 gbenv56.seq
391022918 gbenv57.seq
499998407 gbenv58.seq
499995620 gbenv59.seq
499830461 gbenv6.seq
499997753 gbenv60.seq
86193299 gbenv61.seq
499943171 gbenv62.seq
499999411 gbenv63.seq
499788119 gbenv64.seq
181115250 gbenv65.seq
499998117 gbenv66.seq
499999713 gbenv67.seq
499837509 gbenv68.seq
499998963 gbenv69.seq
466426908 gbenv7.seq
135703487 gbenv70.seq
497119813 gbenv8.seq
499931552 gbenv9.seq
499998581 gbest1.seq
499999733 gbest10.seq
499999220 gbest100.seq
499998662 gbest101.seq
499997815 gbest102.seq
499999077 gbest103.seq
26280962 gbest104.seq
499997739 gbest105.seq
499996559 gbest106.seq
499999711 gbest107.seq
499996203 gbest108.seq
9426180 gbest109.seq
499999011 gbest11.seq
499999283 gbest110.seq
499998031 gbest111.seq
499998955 gbest112.seq
499998225 gbest113.seq
19921978 gbest114.seq
500000014 gbest115.seq
499998435 gbest116.seq
499999531 gbest117.seq
9147880 gbest118.seq
499997606 gbest119.seq
474289011 gbest12.seq
499998781 gbest120.seq
499999893 gbest121.seq
69282352 gbest122.seq
499999961 gbest123.seq
499998214 gbest124.seq
223712939 gbest125.seq
499997461 gbest126.seq
499998633 gbest127.seq
195307357 gbest128.seq
499997173 gbest129.seq
499999658 gbest13.seq
499998792 gbest130.seq
499995025 gbest131.seq
499996839 gbest132.seq
85321549 gbest133.seq
499999011 gbest134.seq
500000103 gbest135.seq
499999730 gbest136.seq
499997714 gbest137.seq
99246406 gbest138.seq
500000002 gbest139.seq
249788691 gbest14.seq
499997959 gbest140.seq
499998236 gbest141.seq
499999192 gbest142.seq
24946687 gbest143.seq
499997817 gbest144.seq
499996032 gbest145.seq
499999717 gbest146.seq
499999913 gbest147.seq
30453490 gbest148.seq
499998561 gbest149.seq
499999689 gbest15.seq
499999358 gbest150.seq
499998219 gbest151.seq
322834163 gbest152.seq
499996387 gbest153.seq
499998779 gbest154.seq
499995778 gbest155.seq
499998742 gbest156.seq
22334741 gbest157.seq
500000171 gbest158.seq
499999919 gbest159.seq
499998336 gbest16.seq
499996596 gbest160.seq
499997385 gbest161.seq
10491991 gbest162.seq
500000079 gbest163.seq
500000003 gbest164.seq
499998995 gbest165.seq
499998660 gbest166.seq
83859383 gbest167.seq
500000180 gbest168.seq
499996624 gbest169.seq
420910306 gbest17.seq
499997982 gbest170.seq
499996832 gbest171.seq
120388331 gbest172.seq
499998796 gbest173.seq
499996875 gbest174.seq
499998096 gbest175.seq
500000066 gbest176.seq
66109540 gbest177.seq
499999609 gbest178.seq
403619645 gbest179.seq
499998902 gbest18.seq
500000063 gbest180.seq
499999705 gbest181.seq
499997986 gbest182.seq
499999873 gbest183.seq
42448093 gbest184.seq
499997351 gbest185.seq
499999049 gbest186.seq
499998723 gbest187.seq
499998548 gbest188.seq
41528079 gbest189.seq
499999927 gbest19.seq
499998332 gbest190.seq
499997812 gbest191.seq
499998689 gbest192.seq
499998545 gbest193.seq
10893500 gbest194.seq
499997389 gbest195.seq
499999423 gbest196.seq
499999923 gbest197.seq
499998596 gbest198.seq
27592514 gbest199.seq
499999372 gbest2.seq
262214241 gbest20.seq
499998352 gbest200.seq
499997309 gbest201.seq
499998232 gbest202.seq
499999439 gbest203.seq
33171889 gbest204.seq
13610371 gbest205.seq
500000009 gbest206.seq
499999342 gbest207.seq
328430736 gbest208.seq
499997980 gbest209.seq
500000121 gbest21.seq
499999555 gbest210.seq
317202244 gbest211.seq
499997711 gbest212.seq
499998222 gbest213.seq
265493768 gbest214.seq
499998282 gbest215.seq
499999159 gbest216.seq
269819857 gbest217.seq
499997149 gbest218.seq
499999290 gbest219.seq
499999838 gbest22.seq
499999631 gbest220.seq
500000163 gbest221.seq
49197565 gbest222.seq
499999284 gbest223.seq
499999484 gbest224.seq
499998195 gbest225.seq
500000115 gbest226.seq
46767660 gbest227.seq
499999550 gbest228.seq
499996344 gbest229.seq
243720945 gbest23.seq
175850387 gbest230.seq
499998729 gbest231.seq
499999681 gbest232.seq
499999475 gbest233.seq
478347570 gbest234.seq
499997785 gbest235.seq
499999603 gbest236.seq
499997429 gbest237.seq
462328784 gbest238.seq
499999067 gbest239.seq
499998098 gbest24.seq
499999466 gbest240.seq
499999877 gbest241.seq
494650973 gbest242.seq
499998531 gbest243.seq
499998185 gbest244.seq
499997957 gbest245.seq
499998535 gbest246.seq
24355432 gbest247.seq
499999109 gbest248.seq
499999887 gbest249.seq
499998386 gbest25.seq
497234565 gbest250.seq
499999018 gbest251.seq
499998363 gbest252.seq
499999589 gbest253.seq
499998515 gbest254.seq
21408398 gbest255.seq
499998685 gbest256.seq
499995885 gbest257.seq
499992940 gbest258.seq
499996960 gbest259.seq
499994368 gbest26.seq
75464086 gbest260.seq
499999815 gbest261.seq
499997500 gbest262.seq
499996382 gbest263.seq
500000186 gbest264.seq
15070914 gbest265.seq
499998431 gbest266.seq
499999555 gbest267.seq
499996266 gbest268.seq
499996584 gbest269.seq
499998227 gbest27.seq
56608848 gbest270.seq
499999104 gbest271.seq
499998969 gbest272.seq
499998846 gbest273.seq
119014253 gbest274.seq
499996151 gbest275.seq
499997199 gbest276.seq
499999976 gbest277.seq
499997336 gbest278.seq
53765216 gbest279.seq
48964644 gbest28.seq
499999317 gbest280.seq
499997549 gbest281.seq
499997631 gbest282.seq
499998870 gbest283.seq
56086801 gbest284.seq
499999854 gbest285.seq
499999427 gbest286.seq
499998420 gbest287.seq
499997908 gbest288.seq
12413340 gbest289.seq
499999934 gbest29.seq
499997241 gbest290.seq
500000143 gbest291.seq
499997193 gbest292.seq
499999266 gbest293.seq
25249973 gbest294.seq
499999965 gbest295.seq
499996255 gbest296.seq
485857148 gbest297.seq
499996746 gbest298.seq
499998051 gbest299.seq
499998416 gbest3.seq
499996534 gbest30.seq
499999666 gbest300.seq
499998500 gbest301.seq
5577915 gbest302.seq
499998622 gbest303.seq
499999578 gbest304.seq
499997985 gbest305.seq
499998280 gbest306.seq
8353862 gbest307.seq
499999018 gbest308.seq
500000027 gbest309.seq
499999323 gbest31.seq
499998037 gbest310.seq
421707881 gbest311.seq
499999046 gbest312.seq
499998115 gbest313.seq
500000170 gbest314.seq
496203399 gbest315.seq
499997885 gbest316.seq
499997415 gbest317.seq
468073576 gbest318.seq
499999035 gbest319.seq
486210054 gbest32.seq
499999387 gbest320.seq
500000238 gbest321.seq
499998332 gbest322.seq
39576631 gbest323.seq
500000256 gbest324.seq
499998824 gbest325.seq
499998042 gbest326.seq
493136865 gbest327.seq
499998749 gbest328.seq
499997759 gbest329.seq
499995690 gbest33.seq
499999540 gbest330.seq
499997029 gbest331.seq
55168282 gbest332.seq
499999943 gbest333.seq
499999960 gbest334.seq
499999212 gbest335.seq
469196415 gbest336.seq
499998299 gbest337.seq
499999395 gbest338.seq
500000050 gbest339.seq
499996732 gbest34.seq
499996328 gbest340.seq
18908247 gbest341.seq
499998731 gbest342.seq
492456938 gbest343.seq
499997406 gbest344.seq
499999596 gbest345.seq
499997440 gbest346.seq
499998560 gbest347.seq
6641936 gbest348.seq
499996833 gbest349.seq
499998044 gbest35.seq
499998863 gbest350.seq
499999607 gbest351.seq
445263126 gbest352.seq
499998629 gbest353.seq
500000207 gbest354.seq
499999612 gbest355.seq
387623893 gbest356.seq
499999012 gbest357.seq
499996946 gbest358.seq
499998298 gbest359.seq
464806987 gbest36.seq
499999266 gbest360.seq
23180139 gbest361.seq
499999026 gbest362.seq
499999007 gbest363.seq
499997572 gbest364.seq
499998287 gbest365.seq
57753239 gbest366.seq
166258344 gbest367.seq
499997707 gbest368.seq
499998882 gbest369.seq
500000138 gbest37.seq
499998160 gbest370.seq
499999199 gbest371.seq
86045134 gbest372.seq
499997252 gbest373.seq
499998118 gbest374.seq
499999892 gbest375.seq
499998855 gbest376.seq
166666388 gbest377.seq
499996810 gbest378.seq
499996558 gbest379.seq
499997901 gbest38.seq
499998375 gbest380.seq
500000151 gbest381.seq
151580674 gbest382.seq
499997221 gbest383.seq
499999329 gbest384.seq
499997189 gbest385.seq
497175622 gbest386.seq
499997498 gbest387.seq
499997706 gbest388.seq
499999595 gbest389.seq
499995956 gbest39.seq
64691839 gbest390.seq
499998385 gbest391.seq
499999008 gbest392.seq
499996496 gbest393.seq
499999329 gbest394.seq
83725933 gbest395.seq
499996944 gbest396.seq
499997015 gbest397.seq
499998040 gbest398.seq
499999190 gbest399.seq
434674744 gbest4.seq
499997019 gbest40.seq
85820972 gbest400.seq
499999952 gbest401.seq
499998092 gbest402.seq
499999582 gbest403.seq
499998501 gbest404.seq
49032427 gbest405.seq
499998825 gbest406.seq
499998991 gbest407.seq
499997959 gbest408.seq
499998392 gbest409.seq
191418194 gbest41.seq
88071166 gbest410.seq
499999741 gbest411.seq
499999816 gbest412.seq
499997061 gbest413.seq
499995062 gbest414.seq
125056149 gbest415.seq
499999918 gbest416.seq
327382356 gbest417.seq
499998194 gbest418.seq
499997992 gbest419.seq
499997364 gbest42.seq
499999615 gbest420.seq
499998742 gbest421.seq
53760245 gbest422.seq
499999058 gbest423.seq
499999991 gbest424.seq
499995917 gbest425.seq
410296162 gbest426.seq
499997260 gbest427.seq
499999283 gbest428.seq
335979604 gbest429.seq
499997237 gbest43.seq
499999961 gbest430.seq
499998603 gbest431.seq
262236278 gbest432.seq
499998683 gbest433.seq
499998481 gbest434.seq
458939684 gbest435.seq
499997775 gbest436.seq
499995081 gbest437.seq
307806619 gbest438.seq
499996212 gbest439.seq
499997245 gbest44.seq
499998800 gbest440.seq
333974609 gbest441.seq
499999541 gbest442.seq
499997289 gbest443.seq
186040190 gbest444.seq
500000126 gbest445.seq
499999505 gbest446.seq
119005290 gbest447.seq
499999520 gbest448.seq
499998155 gbest449.seq
499996431 gbest45.seq
142082049 gbest450.seq
499999879 gbest451.seq
499998318 gbest452.seq
146708639 gbest453.seq
499998626 gbest454.seq
499999515 gbest455.seq
499998334 gbest456.seq
487245752 gbest457.seq
499999523 gbest458.seq
499998370 gbest459.seq
189558363 gbest46.seq
499998338 gbest460.seq
499999241 gbest461.seq
20712668 gbest462.seq
170019681 gbest463.seq
499998234 gbest464.seq
499997948 gbest465.seq
499996964 gbest466.seq
499998273 gbest467.seq
23774165 gbest468.seq
499999458 gbest469.seq
499998696 gbest47.seq
499999208 gbest470.seq
499999217 gbest471.seq
499996748 gbest472.seq
60329890 gbest473.seq
499997586 gbest474.seq
499998545 gbest475.seq
499998359 gbest476.seq
499999709 gbest477.seq
58034918 gbest478.seq
499997930 gbest479.seq
499999592 gbest48.seq
499998576 gbest480.seq
499997495 gbest481.seq
499999860 gbest482.seq
38044052 gbest483.seq
499997371 gbest484.seq
499997842 gbest485.seq
499998306 gbest486.seq
499999718 gbest487.seq
74307962 gbest488.seq
499997662 gbest489.seq
499999914 gbest49.seq
499998634 gbest490.seq
499999034 gbest491.seq
206735348 gbest492.seq
499996334 gbest493.seq
499999901 gbest494.seq
499998543 gbest495.seq
500000245 gbest496.seq
89609207 gbest497.seq
499998125 gbest498.seq
499998648 gbest499.seq
499998260 gbest5.seq
475101060 gbest50.seq
499997764 gbest500.seq
499999172 gbest501.seq
55922028 gbest502.seq
499994065 gbest503.seq
499997608 gbest504.seq
499995938 gbest505.seq
499998022 gbest506.seq
143263908 gbest507.seq
500000142 gbest508.seq
499998212 gbest509.seq
499999938 gbest51.seq
499997968 gbest510.seq
500000141 gbest511.seq
142293750 gbest512.seq
499997833 gbest513.seq
499999118 gbest514.seq
499998948 gbest515.seq
499997283 gbest516.seq
19853839 gbest517.seq
174267014 gbest518.seq
499998386 gbest519.seq
355996874 gbest52.seq
499998463 gbest520.seq
84205820 gbest521.seq
499997944 gbest522.seq
499998345 gbest523.seq
75364218 gbest524.seq
499999451 gbest525.seq
499999095 gbest526.seq
499997474 gbest527.seq
500000060 gbest528.seq
99294633 gbest529.seq
499998564 gbest53.seq
499999697 gbest530.seq
499998448 gbest531.seq
499998269 gbest532.seq
499999168 gbest533.seq
8987898 gbest534.seq
499999430 gbest535.seq
499999910 gbest536.seq
499998159 gbest537.seq
477178951 gbest538.seq
499998569 gbest539.seq
499999813 gbest54.seq
499998537 gbest540.seq
499998989 gbest541.seq
413105832 gbest542.seq
499998900 gbest543.seq
499999161 gbest544.seq
499999901 gbest545.seq
500000090 gbest546.seq
82655201 gbest547.seq
499998143 gbest548.seq
500000169 gbest549.seq
499997327 gbest55.seq
499996922 gbest550.seq
499999225 gbest551.seq
33923316 gbest552.seq
499998664 gbest553.seq
499997885 gbest554.seq
499997388 gbest555.seq
500000144 gbest556.seq
44487956 gbest557.seq
499998480 gbest558.seq
499999472 gbest559.seq
483441547 gbest56.seq
500000196 gbest560.seq
500000059 gbest561.seq
9510056 gbest562.seq
499998866 gbest563.seq
499999739 gbest564.seq
392807354 gbest565.seq
500000181 gbest566.seq
499998059 gbest567.seq
100753733 gbest568.seq
499998740 gbest569.seq
499999294 gbest57.seq
499998391 gbest570.seq
50311057 gbest571.seq
499999914 gbest572.seq
499997175 gbest573.seq
499998760 gbest574.seq
254450647 gbest575.seq
499998367 gbest58.seq
499998865 gbest59.seq
499999274 gbest6.seq
464160111 gbest60.seq
499999088 gbest61.seq
499999805 gbest62.seq
499998802 gbest63.seq
499998178 gbest64.seq
6890346 gbest65.seq
499998120 gbest66.seq
499997844 gbest67.seq
499997936 gbest68.seq
483732096 gbest69.seq
499996729 gbest7.seq
500000091 gbest70.seq
499999026 gbest71.seq
499997394 gbest72.seq
499999264 gbest73.seq
8376991 gbest74.seq
123216343 gbest75.seq
499998883 gbest76.seq
499999229 gbest77.seq
500000011 gbest78.seq
499998569 gbest79.seq
469361585 gbest8.seq
5383905 gbest80.seq
499998041 gbest81.seq
499997417 gbest82.seq
499996298 gbest83.seq
499999450 gbest84.seq
46148169 gbest85.seq
499997743 gbest86.seq
499998399 gbest87.seq
499999378 gbest88.seq
500000102 gbest89.seq
499998998 gbest9.seq
53088986 gbest90.seq
500000263 gbest91.seq
499998445 gbest92.seq
499997919 gbest93.seq
472062054 gbest94.seq
500000196 gbest95.seq
499998270 gbest96.seq
499998231 gbest97.seq
498695800 gbest98.seq
35234983 gbest99.seq
499998228 gbgss1.seq
55431063 gbgss10.seq
499999207 gbgss100.seq
500000257 gbgss101.seq
500000134 gbgss102.seq
468268660 gbgss103.seq
499996751 gbgss104.seq
499999692 gbgss105.seq
499997757 gbgss106.seq
499998352 gbgss107.seq
40402012 gbgss108.seq
499999314 gbgss109.seq
499999328 gbgss11.seq
499999661 gbgss110.seq
499997830 gbgss111.seq
316916938 gbgss112.seq
499998412 gbgss113.seq
499997321 gbgss114.seq
499999598 gbgss115.seq
499998006 gbgss116.seq
104211862 gbgss117.seq
499998179 gbgss118.seq
499999367 gbgss119.seq
499998298 gbgss12.seq
499997853 gbgss120.seq
499999736 gbgss121.seq
6537142 gbgss122.seq
499998633 gbgss123.seq
499999968 gbgss124.seq
499998799 gbgss125.seq
449734063 gbgss126.seq
499998381 gbgss127.seq
499999211 gbgss128.seq
499997711 gbgss129.seq
499999246 gbgss13.seq
499998622 gbgss130.seq
29785783 gbgss131.seq
499997877 gbgss132.seq
209679641 gbgss133.seq
500000110 gbgss134.seq
499999602 gbgss135.seq
499997969 gbgss136.seq
500000125 gbgss137.seq
14831686 gbgss138.seq
499996726 gbgss139.seq
498664595 gbgss14.seq
499997951 gbgss140.seq
499999528 gbgss141.seq
499997001 gbgss142.seq
16786266 gbgss143.seq
499997786 gbgss144.seq
499996974 gbgss145.seq
499999546 gbgss146.seq
499996547 gbgss147.seq
2045398 gbgss148.seq
499997382 gbgss149.seq
499997425 gbgss15.seq
499998165 gbgss150.seq
499998480 gbgss151.seq
499997367 gbgss152.seq
6835799 gbgss153.seq
373479550 gbgss154.seq
499998497 gbgss155.seq
500000110 gbgss156.seq
499997282 gbgss157.seq
452208161 gbgss158.seq
499999674 gbgss159.seq
499997738 gbgss16.seq
499998566 gbgss160.seq
499998516 gbgss161.seq
454413234 gbgss162.seq
499997998 gbgss163.seq
499999955 gbgss164.seq
499997965 gbgss165.seq
456856217 gbgss166.seq
499997805 gbgss167.seq
499999559 gbgss168.seq
499999924 gbgss169.seq
499999295 gbgss17.seq
362956480 gbgss170.seq
499999614 gbgss171.seq
499997471 gbgss172.seq
215502537 gbgss173.seq
499998436 gbgss174.seq
499998134 gbgss175.seq
67002892 gbgss176.seq
499999079 gbgss177.seq
499999336 gbgss178.seq
499998518 gbgss179.seq
480471778 gbgss18.seq
499999975 gbgss180.seq
49671428 gbgss181.seq
500000196 gbgss182.seq
499999211 gbgss183.seq
500000209 gbgss184.seq
499999501 gbgss185.seq
39656212 gbgss186.seq
499999015 gbgss187.seq
499999023 gbgss188.seq
23241200 gbgss189.seq
499998975 gbgss19.seq
499998791 gbgss190.seq
499996639 gbgss191.seq
499998774 gbgss192.seq
495024971 gbgss193.seq
499999000 gbgss194.seq
499999717 gbgss195.seq
499999860 gbgss196.seq
499999901 gbgss197.seq
53998378 gbgss198.seq
499998820 gbgss199.seq
499999269 gbgss2.seq
325856321 gbgss20.seq
499999274 gbgss200.seq
499997966 gbgss201.seq
479854442 gbgss202.seq
499997737 gbgss203.seq
499997752 gbgss204.seq
56421213 gbgss205.seq
499997703 gbgss206.seq
500000150 gbgss207.seq
499999163 gbgss208.seq
481466169 gbgss209.seq
499999364 gbgss21.seq
499996771 gbgss210.seq
499999594 gbgss211.seq
499999856 gbgss212.seq
488428954 gbgss213.seq
499999175 gbgss214.seq
499999239 gbgss215.seq
499999176 gbgss216.seq
467990953 gbgss217.seq
499999749 gbgss218.seq
499999749 gbgss219.seq
499997676 gbgss22.seq
499997938 gbgss220.seq
6989681 gbgss221.seq
499999723 gbgss222.seq
499999684 gbgss223.seq
499998774 gbgss224.seq
264582471 gbgss225.seq
499998308 gbgss226.seq
499997919 gbgss227.seq
499999547 gbgss228.seq
429737750 gbgss229.seq
499997001 gbgss23.seq
499998680 gbgss230.seq
499997412 gbgss231.seq
499999464 gbgss232.seq
468539336 gbgss233.seq
499999119 gbgss234.seq
500000083 gbgss235.seq
499999330 gbgss236.seq
418145094 gbgss237.seq
499998654 gbgss238.seq
499999983 gbgss239.seq
499999146 gbgss24.seq
499998793 gbgss240.seq
499998625 gbgss241.seq
16537478 gbgss242.seq
315572447 gbgss243.seq
499997744 gbgss244.seq
499999895 gbgss245.seq
499998432 gbgss246.seq
467293763 gbgss247.seq
499998755 gbgss248.seq
499999780 gbgss249.seq
47915040 gbgss25.seq
499999818 gbgss250.seq
499997858 gbgss251.seq
36102519 gbgss252.seq
499998608 gbgss253.seq
499997686 gbgss254.seq
499998198 gbgss255.seq
499999134 gbgss256.seq
19020583 gbgss257.seq
499998709 gbgss258.seq
499997285 gbgss259.seq
499998203 gbgss26.seq
499998938 gbgss260.seq
1409124 gbgss261.seq
500000216 gbgss262.seq
499999092 gbgss263.seq
499998857 gbgss264.seq
480468608 gbgss265.seq
499999638 gbgss266.seq
499998584 gbgss267.seq
472073119 gbgss268.seq
499999289 gbgss27.seq
499999997 gbgss28.seq
499997737 gbgss29.seq
499999955 gbgss3.seq
28368223 gbgss30.seq
499999620 gbgss31.seq
499999369 gbgss32.seq
499997926 gbgss33.seq
474354474 gbgss34.seq
499997672 gbgss35.seq
499999711 gbgss36.seq
499998458 gbgss37.seq
499998787 gbgss38.seq
10244239 gbgss39.seq
499997976 gbgss4.seq
499998628 gbgss40.seq
500000104 gbgss41.seq
168816398 gbgss42.seq
499998707 gbgss43.seq
499999529 gbgss44.seq
500000062 gbgss45.seq
487188150 gbgss46.seq
499997156 gbgss47.seq
499998418 gbgss48.seq
500000076 gbgss49.seq
37756294 gbgss5.seq
444027250 gbgss50.seq
499998446 gbgss51.seq
500000163 gbgss52.seq
499998853 gbgss53.seq
420972611 gbgss54.seq
499998235 gbgss55.seq
500000088 gbgss56.seq
500000162 gbgss57.seq
427769194 gbgss58.seq
67685650 gbgss59.seq
499999011 gbgss6.seq
500000215 gbgss60.seq
499997984 gbgss61.seq
500000021 gbgss62.seq
492676767 gbgss63.seq
499997513 gbgss64.seq
500000022 gbgss65.seq
499999623 gbgss66.seq
495013992 gbgss67.seq
499998492 gbgss68.seq
499999132 gbgss69.seq
499998063 gbgss7.seq
499999264 gbgss70.seq
419358340 gbgss71.seq
499999747 gbgss72.seq
499998402 gbgss73.seq
499998080 gbgss74.seq
33896316 gbgss75.seq
499997046 gbgss76.seq
499999706 gbgss77.seq
499999836 gbgss78.seq
490829495 gbgss79.seq
499998114 gbgss8.seq
499999758 gbgss80.seq
499998791 gbgss81.seq
499998121 gbgss82.seq
499997910 gbgss83.seq
6352079 gbgss84.seq
499998294 gbgss85.seq
500000122 gbgss86.seq
499997510 gbgss87.seq
499999970 gbgss88.seq
28361625 gbgss89.seq
499999620 gbgss9.seq
499998289 gbgss90.seq
500000231 gbgss91.seq
499998914 gbgss92.seq
463167513 gbgss93.seq
244248654 gbgss94.seq
499999492 gbgss95.seq
499998457 gbgss96.seq
500000176 gbgss97.seq
499997669 gbgss98.seq
45242083 gbgss99.seq
499991077 gbhtc1.seq
499994049 gbhtc2.seq
499986002 gbhtc3.seq
330777725 gbhtc4.seq
499998312 gbhtc5.seq
438285059 gbhtc6.seq
499999221 gbhtc7.seq
212349974 gbhtc8.seq
499944811 gbhtg1.seq
499980257 gbhtg10.seq
485099546 gbhtg11.seq
499977093 gbhtg12.seq
499847932 gbhtg13.seq
499963690 gbhtg14.seq
499701367 gbhtg15.seq
474637756 gbhtg16.seq
499709316 gbhtg17.seq
499810399 gbhtg18.seq
499965464 gbhtg19.seq
499847283 gbhtg2.seq
499990521 gbhtg20.seq
473197896 gbhtg21.seq
499917570 gbhtg22.seq
499967580 gbhtg23.seq
499096826 gbhtg24.seq
499960078 gbhtg25.seq
484456052 gbhtg26.seq
499961890 gbhtg27.seq
499870377 gbhtg28.seq
268060905 gbhtg29.seq
499869170 gbhtg3.seq
499926304 gbhtg30.seq
499809717 gbhtg31.seq
224936220 gbhtg32.seq
499949654 gbhtg33.seq
499926474 gbhtg34.seq
265477168 gbhtg35.seq
499867371 gbhtg36.seq
499973632 gbhtg37.seq
223152909 gbhtg38.seq
499807323 gbhtg39.seq
499846457 gbhtg4.seq
499973486 gbhtg40.seq
234952784 gbhtg41.seq
499825428 gbhtg42.seq
499886028 gbhtg43.seq
202125596 gbhtg44.seq
499794710 gbhtg45.seq
499925955 gbhtg46.seq
205797151 gbhtg47.seq
499976374 gbhtg48.seq
499930130 gbhtg49.seq
499934498 gbhtg5.seq
193865027 gbhtg50.seq
499926863 gbhtg51.seq
499937126 gbhtg52.seq
161358165 gbhtg53.seq
499996939 gbhtg54.seq
499996869 gbhtg55.seq
252726190 gbhtg56.seq
499940545 gbhtg57.seq
499966721 gbhtg58.seq
499998091 gbhtg59.seq
507366 gbhtg6.seq
167066142 gbhtg60.seq
499929757 gbhtg61.seq
499926029 gbhtg62.seq
499877376 gbhtg63.seq
468570824 gbhtg64.seq
499882387 gbhtg65.seq
499975194 gbhtg66.seq
499952380 gbhtg67.seq
499930799 gbhtg68.seq
499789101 gbhtg69.seq
499821242 gbhtg7.seq
417841922 gbhtg70.seq
499651433 gbhtg71.seq
499807557 gbhtg72.seq
385409482 gbhtg73.seq
499951671 gbhtg74.seq
499970875 gbhtg75.seq
383567862 gbhtg76.seq
499964642 gbhtg77.seq
499988333 gbhtg78.seq
499994565 gbhtg79.seq
499933798 gbhtg8.seq
499991192 gbhtg80.seq
499928628 gbhtg81.seq
274850521 gbhtg82.seq
499899409 gbhtg9.seq
499880707 gbinv1.seq
490451253 gbinv10.seq
115145969 gbinv100.seq
499999206 gbinv101.seq
499999803 gbinv102.seq
404239341 gbinv103.seq
499999958 gbinv104.seq
499997812 gbinv105.seq
178050011 gbinv106.seq
499998551 gbinv107.seq
499997023 gbinv108.seq
117744879 gbinv109.seq
491062219 gbinv11.seq
499997654 gbinv110.seq
499999777 gbinv111.seq
148302462 gbinv112.seq
499997600 gbinv113.seq
499997696 gbinv114.seq
156836362 gbinv115.seq
499997251 gbinv116.seq
499996972 gbinv117.seq
193688655 gbinv118.seq
499997574 gbinv119.seq
469686844 gbinv12.seq
499997810 gbinv120.seq
247191599 gbinv121.seq
499998414 gbinv122.seq
499997912 gbinv123.seq
499999137 gbinv124.seq
499999146 gbinv125.seq
25763190 gbinv126.seq
499998875 gbinv127.seq
445991559 gbinv128.seq
288065217 gbinv129.seq
485523455 gbinv13.seq
54947887 gbinv130.seq
52917687 gbinv131.seq
156817630 gbinv132.seq
499990822 gbinv133.seq
266436256 gbinv134.seq
499998557 gbinv135.seq
499997694 gbinv136.seq
172341792 gbinv137.seq
499362318 gbinv138.seq
498178006 gbinv139.seq
174157884 gbinv14.seq
499656507 gbinv140.seq
128976204 gbinv141.seq
496677517 gbinv142.seq
51960557 gbinv143.seq
466558064 gbinv144.seq
479577598 gbinv145.seq
450564845 gbinv146.seq
482003105 gbinv147.seq
121049467 gbinv148.seq
494590358 gbinv149.seq
486730694 gbinv15.seq
499153426 gbinv150.seq
498623791 gbinv151.seq
70591482 gbinv152.seq
872662073 gbinv153.seq
815663159 gbinv154.seq
813528097 gbinv155.seq
780491774 gbinv156.seq
734904723 gbinv157.seq
816941878 gbinv158.seq
452891562 gbinv159.seq
481403838 gbinv16.seq
480839037 gbinv160.seq
375796220 gbinv161.seq
499932212 gbinv162.seq
485386314 gbinv163.seq
485283938 gbinv164.seq
498294953 gbinv165.seq
414580638 gbinv166.seq
498679440 gbinv167.seq
494998502 gbinv168.seq
486081098 gbinv169.seq
492664237 gbinv17.seq
483986740 gbinv170.seq
479014607 gbinv171.seq
377175188 gbinv172.seq
491311809 gbinv173.seq
482991950 gbinv174.seq
495169229 gbinv175.seq
493741890 gbinv176.seq
495500028 gbinv177.seq
371035005 gbinv178.seq
470288952 gbinv179.seq
478211801 gbinv18.seq
496245676 gbinv180.seq
496281402 gbinv181.seq
472368883 gbinv182.seq
493439367 gbinv183.seq
418565417 gbinv184.seq
493154076 gbinv185.seq
491119641 gbinv186.seq
465656312 gbinv187.seq
490891118 gbinv188.seq
459581775 gbinv189.seq
305989097 gbinv19.seq
406078142 gbinv190.seq
476900813 gbinv191.seq
481842193 gbinv192.seq
496741571 gbinv193.seq
492742184 gbinv194.seq
496271174 gbinv195.seq
392139815 gbinv196.seq
496951694 gbinv197.seq
492317100 gbinv198.seq
475955596 gbinv199.seq
455878756 gbinv2.seq
499447601 gbinv20.seq
498243704 gbinv200.seq
496662010 gbinv201.seq
351267284 gbinv202.seq
454436392 gbinv203.seq
490104712 gbinv204.seq
477768949 gbinv205.seq
497117087 gbinv206.seq
273421111 gbinv207.seq
484546259 gbinv208.seq
486200140 gbinv209.seq
331575178 gbinv21.seq
489013669 gbinv210.seq
499882158 gbinv211.seq
389958867 gbinv212.seq
230763287 gbinv213.seq
433765668 gbinv214.seq
341801067 gbinv215.seq
488708469 gbinv216.seq
442221959 gbinv217.seq
499288600 gbinv218.seq
498804465 gbinv219.seq
409329256 gbinv22.seq
192257453 gbinv220.seq
499997309 gbinv221.seq
499998394 gbinv222.seq
273579657 gbinv223.seq
499999674 gbinv224.seq
499997840 gbinv225.seq
201564591 gbinv226.seq
499999683 gbinv227.seq
499998555 gbinv228.seq
260583147 gbinv229.seq
337324220 gbinv23.seq
499998424 gbinv230.seq
499997865 gbinv231.seq
304255466 gbinv232.seq
499998594 gbinv233.seq
499561275 gbinv234.seq
499882610 gbinv235.seq
347600469 gbinv236.seq
499999353 gbinv237.seq
499954513 gbinv238.seq
394313230 gbinv239.seq
416902989 gbinv24.seq
499999746 gbinv240.seq
499862404 gbinv241.seq
499942773 gbinv242.seq
261894712 gbinv243.seq
499489044 gbinv244.seq
499984461 gbinv245.seq
499999178 gbinv246.seq
219010924 gbinv247.seq
499665286 gbinv248.seq
499954794 gbinv249.seq
480340526 gbinv25.seq
499986274 gbinv250.seq
349517342 gbinv251.seq
500000137 gbinv252.seq
499979428 gbinv253.seq
499915813 gbinv254.seq
499990759 gbinv255.seq
499998437 gbinv256.seq
7826534 gbinv257.seq
499999636 gbinv258.seq
499704487 gbinv259.seq
470719972 gbinv26.seq
499897338 gbinv260.seq
499999895 gbinv261.seq
68002970 gbinv262.seq
499977802 gbinv263.seq
499904157 gbinv264.seq
499970007 gbinv265.seq
499999529 gbinv266.seq
499940074 gbinv267.seq
122380920 gbinv268.seq
500000224 gbinv269.seq
478012779 gbinv27.seq
499999552 gbinv270.seq
468683478 gbinv271.seq
499670167 gbinv272.seq
499934229 gbinv273.seq
499999149 gbinv274.seq
480298194 gbinv275.seq
214609255 gbinv276.seq
481046566 gbinv277.seq
450037909 gbinv278.seq
303709221 gbinv279.seq
372274412 gbinv28.seq
293452060 gbinv280.seq
280090041 gbinv281.seq
279807726 gbinv282.seq
274554532 gbinv283.seq
266890122 gbinv284.seq
491295946 gbinv285.seq
418047779 gbinv286.seq
383074444 gbinv287.seq
489267373 gbinv288.seq
393039367 gbinv289.seq
473605830 gbinv29.seq
484538369 gbinv290.seq
482310364 gbinv291.seq
491415359 gbinv292.seq
495004950 gbinv293.seq
483971663 gbinv294.seq
495670320 gbinv295.seq
40846857 gbinv296.seq
492571202 gbinv297.seq
490206006 gbinv298.seq
445709424 gbinv299.seq
499998415 gbinv3.seq
493702810 gbinv30.seq
207302902 gbinv300.seq
370283947 gbinv301.seq
207800719 gbinv302.seq
403111025 gbinv303.seq
496918509 gbinv304.seq
495981016 gbinv305.seq
486335901 gbinv306.seq
491884209 gbinv307.seq
62681775 gbinv308.seq
487678296 gbinv309.seq
499999717 gbinv31.seq
495933337 gbinv310.seq
497117994 gbinv311.seq
485878834 gbinv312.seq
336958408 gbinv313.seq
470338855 gbinv314.seq
473857916 gbinv315.seq
488417194 gbinv316.seq
472993064 gbinv317.seq
444598250 gbinv318.seq
489105559 gbinv319.seq
405915277 gbinv32.seq
489050792 gbinv320.seq
492903374 gbinv321.seq
464570821 gbinv322.seq
389647411 gbinv323.seq
499023581 gbinv324.seq
459750793 gbinv325.seq
457336109 gbinv326.seq
468059342 gbinv327.seq
487547225 gbinv328.seq
494627522 gbinv329.seq
499996233 gbinv33.seq
499360640 gbinv330.seq
425862368 gbinv331.seq
447701977 gbinv332.seq
471356977 gbinv333.seq
106487756 gbinv334.seq
494431929 gbinv335.seq
499089492 gbinv336.seq
174713884 gbinv337.seq
439432672 gbinv338.seq
315017082 gbinv339.seq
405541828 gbinv34.seq
247279447 gbinv340.seq
493106968 gbinv341.seq
482399453 gbinv342.seq
487563600 gbinv343.seq
495044965 gbinv344.seq
345414487 gbinv345.seq
499129683 gbinv346.seq
496482189 gbinv347.seq
369581275 gbinv348.seq
456144815 gbinv349.seq
497340659 gbinv35.seq
200284825 gbinv350.seq
495152558 gbinv351.seq
341654330 gbinv352.seq
336683654 gbinv353.seq
493060580 gbinv354.seq
107491235 gbinv355.seq
487968866 gbinv356.seq
495757046 gbinv357.seq
481723089 gbinv358.seq
326169629 gbinv359.seq
491593012 gbinv36.seq
485886250 gbinv360.seq
492815904 gbinv361.seq
471307712 gbinv362.seq
311911756 gbinv363.seq
499380148 gbinv364.seq
482083381 gbinv365.seq
479658829 gbinv366.seq
363341552 gbinv367.seq
489703355 gbinv368.seq
499514774 gbinv369.seq
468886272 gbinv37.seq
496438512 gbinv370.seq
492572846 gbinv371.seq
486825768 gbinv372.seq
496096827 gbinv373.seq
476044151 gbinv374.seq
496125908 gbinv375.seq
481981378 gbinv376.seq
343407139 gbinv377.seq
493089306 gbinv378.seq
490891004 gbinv379.seq
480484367 gbinv38.seq
498098866 gbinv380.seq
498384023 gbinv381.seq
493309215 gbinv382.seq
324291471 gbinv383.seq
484493924 gbinv384.seq
491069771 gbinv385.seq
494055574 gbinv386.seq
235593723 gbinv387.seq
319983008 gbinv388.seq
484241023 gbinv389.seq
96954549 gbinv39.seq
216170369 gbinv390.seq
218804026 gbinv391.seq
336455655 gbinv392.seq
297857601 gbinv393.seq
477593708 gbinv394.seq
493171167 gbinv395.seq
96653657 gbinv396.seq
401450903 gbinv397.seq
471214414 gbinv398.seq
478230772 gbinv399.seq
499626788 gbinv4.seq
495716316 gbinv40.seq
481551037 gbinv400.seq
119372855 gbinv401.seq
489114034 gbinv402.seq
418973715 gbinv403.seq
492116480 gbinv404.seq
488062801 gbinv405.seq
86400276 gbinv406.seq
475977144 gbinv407.seq
479023212 gbinv408.seq
91925882 gbinv409.seq
459725126 gbinv41.seq
498866242 gbinv410.seq
475446584 gbinv411.seq
492109157 gbinv412.seq
493644048 gbinv413.seq
450867996 gbinv414.seq
491756525 gbinv415.seq
84743944 gbinv416.seq
423731956 gbinv417.seq
344359358 gbinv418.seq
487661322 gbinv419.seq
481987024 gbinv42.seq
481796231 gbinv420.seq
419437489 gbinv421.seq
447480354 gbinv422.seq
458542150 gbinv423.seq
84187054 gbinv424.seq
476248749 gbinv425.seq
482272438 gbinv426.seq
498234741 gbinv427.seq
471043224 gbinv428.seq
136592520 gbinv429.seq
494130818 gbinv43.seq
495120952 gbinv430.seq
498047113 gbinv431.seq
493290837 gbinv432.seq
467611623 gbinv433.seq
464868282 gbinv434.seq
485103437 gbinv435.seq
70626150 gbinv436.seq
444903948 gbinv437.seq
457689916 gbinv438.seq
485060215 gbinv439.seq
170883604 gbinv44.seq
496105931 gbinv440.seq
398887277 gbinv441.seq
496315211 gbinv442.seq
400751741 gbinv443.seq
420887834 gbinv444.seq
466152865 gbinv445.seq
492916768 gbinv446.seq
342221593 gbinv447.seq
352563736 gbinv448.seq
348693377 gbinv449.seq
473738127 gbinv45.seq
456059312 gbinv450.seq
497847487 gbinv451.seq
449319091 gbinv452.seq
468637853 gbinv453.seq
432080041 gbinv454.seq
138509644 gbinv455.seq
496695255 gbinv456.seq
499723939 gbinv457.seq
479047519 gbinv458.seq
257796371 gbinv459.seq
489724528 gbinv46.seq
471704294 gbinv460.seq
487451682 gbinv461.seq
493364736 gbinv462.seq
493281122 gbinv463.seq
53047956 gbinv464.seq
463724029 gbinv465.seq
481227277 gbinv466.seq
489522151 gbinv467.seq
482555865 gbinv468.seq
489387386 gbinv469.seq
481853019 gbinv47.seq
27439657 gbinv470.seq
147311081 gbinv471.seq
520668510 gbinv472.seq
439679373 gbinv473.seq
76608705 gbinv474.seq
544459462 gbinv475.seq
291577871 gbinv476.seq
499183575 gbinv477.seq
449457164 gbinv478.seq
403099826 gbinv479.seq
480574803 gbinv48.seq
271693871 gbinv480.seq
483667272 gbinv481.seq
455324853 gbinv482.seq
403535389 gbinv483.seq
351018811 gbinv484.seq
490437627 gbinv485.seq
445804754 gbinv486.seq
462949261 gbinv487.seq
398542703 gbinv488.seq
175801402 gbinv49.seq
185159259 gbinv5.seq
495890984 gbinv50.seq
496714825 gbinv51.seq
484081852 gbinv52.seq
472135201 gbinv53.seq
487970520 gbinv54.seq
473212643 gbinv55.seq
119585423 gbinv56.seq
483414567 gbinv57.seq
490353662 gbinv58.seq
487639364 gbinv59.seq
496832638 gbinv6.seq
482729413 gbinv60.seq
499999387 gbinv61.seq
420556238 gbinv62.seq
485074020 gbinv63.seq
497628765 gbinv64.seq
492273364 gbinv65.seq
493650304 gbinv66.seq
319407791 gbinv67.seq
495477837 gbinv68.seq
496723738 gbinv69.seq
476450800 gbinv7.seq
492757167 gbinv70.seq
483897094 gbinv71.seq
478248908 gbinv72.seq
492778641 gbinv73.seq
499970626 gbinv74.seq
498315478 gbinv75.seq
483551082 gbinv76.seq
444438685 gbinv77.seq
483768717 gbinv78.seq
493574813 gbinv79.seq
422530821 gbinv8.seq
498159916 gbinv80.seq
461241054 gbinv81.seq
429126368 gbinv82.seq
472254386 gbinv83.seq
487381580 gbinv84.seq
488615859 gbinv85.seq
492386441 gbinv86.seq
410012641 gbinv87.seq
489753781 gbinv88.seq
486903937 gbinv89.seq
173964300 gbinv9.seq
475269344 gbinv90.seq
499301158 gbinv91.seq
356776193 gbinv92.seq
461767421 gbinv93.seq
479421334 gbinv94.seq
494639844 gbinv95.seq
328489972 gbinv96.seq
484117250 gbinv97.seq
500000264 gbinv98.seq
499999605 gbinv99.seq
499998322 gbmam1.seq
82812908 gbmam10.seq
483844712 gbmam100.seq
437064425 gbmam101.seq
223540742 gbmam102.seq
451994163 gbmam103.seq
449442494 gbmam104.seq
428335431 gbmam105.seq
499998224 gbmam106.seq
293855685 gbmam107.seq
227944315 gbmam108.seq
348089742 gbmam109.seq
71296609 gbmam11.seq
373183698 gbmam110.seq
467160879 gbmam111.seq
457054238 gbmam112.seq
483676806 gbmam113.seq
409916232 gbmam114.seq
398303012 gbmam115.seq
372869811 gbmam116.seq
22570876 gbmam12.seq
1268606 gbmam13.seq
378312073 gbmam14.seq
338653931 gbmam15.seq
477859990 gbmam16.seq
445458574 gbmam17.seq
122412955 gbmam18.seq
451114203 gbmam19.seq
399237917 gbmam2.seq
418062948 gbmam20.seq
499818197 gbmam21.seq
462376363 gbmam22.seq
370510653 gbmam23.seq
446296425 gbmam24.seq
431104447 gbmam25.seq
480602957 gbmam26.seq
479109873 gbmam27.seq
483903297 gbmam28.seq
483307008 gbmam29.seq
400559326 gbmam3.seq
48405032 gbmam30.seq
363174382 gbmam31.seq
437246747 gbmam32.seq
470828962 gbmam33.seq
402408906 gbmam34.seq
304109928 gbmam35.seq
452443739 gbmam36.seq
451303958 gbmam37.seq
495648598 gbmam38.seq
405636626 gbmam39.seq
477148353 gbmam4.seq
410457734 gbmam40.seq
441553748 gbmam41.seq
367146984 gbmam42.seq
478421809 gbmam43.seq
316388332 gbmam44.seq
352226884 gbmam45.seq
195247700 gbmam46.seq
474022452 gbmam47.seq
378020853 gbmam48.seq
450136561 gbmam49.seq
374653134 gbmam5.seq
450750944 gbmam50.seq
468132660 gbmam51.seq
374896622 gbmam52.seq
9943517 gbmam53.seq
43989127 gbmam54.seq
91322474 gbmam55.seq
88811458 gbmam56.seq
6364730 gbmam57.seq
20918116 gbmam58.seq
449535581 gbmam59.seq
487713568 gbmam6.seq
423431384 gbmam60.seq
453840584 gbmam61.seq
491149506 gbmam62.seq
425479852 gbmam63.seq
461110029 gbmam64.seq
385606603 gbmam65.seq
489901313 gbmam66.seq
500000153 gbmam67.seq
499998574 gbmam68.seq
18110602 gbmam69.seq
401181424 gbmam7.seq
907465328 gbmam70.seq
839494897 gbmam71.seq
774395849 gbmam72.seq
588873740 gbmam73.seq
364960392 gbmam74.seq
428298067 gbmam75.seq
283039896 gbmam76.seq
266822121 gbmam77.seq
255007049 gbmam78.seq
250435254 gbmam79.seq
435129139 gbmam8.seq
405637142 gbmam80.seq
372091504 gbmam81.seq
465555603 gbmam82.seq
444923782 gbmam83.seq
341578443 gbmam84.seq
257946240 gbmam85.seq
485829704 gbmam86.seq
486026993 gbmam87.seq
483298905 gbmam88.seq
494677523 gbmam89.seq
275778915 gbmam9.seq
335874920 gbmam90.seq
464872853 gbmam91.seq
468294587 gbmam92.seq
497569809 gbmam93.seq
377746247 gbmam94.seq
460747191 gbmam95.seq
150130543 gbmam96.seq
416665240 gbmam97.seq
456214449 gbmam98.seq
486132452 gbmam99.seq
14827412 gbnew.txt
499998732 gbpat1.seq
499999978 gbpat10.seq
499999036 gbpat100.seq
499999497 gbpat101.seq
499997525 gbpat102.seq
228719622 gbpat103.seq
500000251 gbpat104.seq
500000174 gbpat105.seq
499999692 gbpat106.seq
335264573 gbpat107.seq
499999820 gbpat108.seq
499999072 gbpat109.seq
499997609 gbpat11.seq
208457456 gbpat110.seq
499900254 gbpat111.seq
499999229 gbpat112.seq
174097043 gbpat113.seq
499998627 gbpat114.seq
499999833 gbpat115.seq
499997514 gbpat116.seq
8676660 gbpat117.seq
499714821 gbpat118.seq
382785466 gbpat119.seq
179179865 gbpat12.seq
499997546 gbpat120.seq
499993593 gbpat121.seq
499992686 gbpat122.seq
499998948 gbpat123.seq
56313272 gbpat124.seq
499968107 gbpat125.seq
499999013 gbpat126.seq
208432510 gbpat127.seq
499999682 gbpat128.seq
499999422 gbpat129.seq
499890454 gbpat13.seq
57407725 gbpat130.seq
499995995 gbpat131.seq
499998350 gbpat132.seq
487411977 gbpat133.seq
499998022 gbpat134.seq
499999903 gbpat135.seq
26312251 gbpat136.seq
499991578 gbpat137.seq
385133713 gbpat138.seq
499999560 gbpat139.seq
499999507 gbpat14.seq
500000185 gbpat140.seq
148486212 gbpat141.seq
499997120 gbpat142.seq
314466624 gbpat143.seq
499988381 gbpat144.seq
499980283 gbpat145.seq
409538104 gbpat146.seq
500000154 gbpat147.seq
499998659 gbpat148.seq
125951906 gbpat149.seq
62654372 gbpat15.seq
499989559 gbpat150.seq
499997429 gbpat151.seq
499998857 gbpat152.seq
499997730 gbpat153.seq
169831142 gbpat154.seq
499999814 gbpat155.seq
425323705 gbpat156.seq
500000181 gbpat157.seq
499999447 gbpat158.seq
499887403 gbpat159.seq
499998478 gbpat16.seq
353520266 gbpat160.seq
499998082 gbpat161.seq
499999221 gbpat162.seq
289629964 gbpat163.seq
500000122 gbpat164.seq
499999577 gbpat165.seq
499999216 gbpat166.seq
101539058 gbpat167.seq
499995055 gbpat168.seq
499997500 gbpat169.seq
499996492 gbpat17.seq
499998487 gbpat170.seq
499998725 gbpat171.seq
301680889 gbpat172.seq
499979742 gbpat173.seq
499998096 gbpat174.seq
499999222 gbpat175.seq
318462021 gbpat176.seq
499602355 gbpat177.seq
499999188 gbpat178.seq
499999721 gbpat179.seq
421939701 gbpat18.seq
13196841 gbpat180.seq
497266589 gbpat181.seq
499998196 gbpat182.seq
499999181 gbpat183.seq
86829619 gbpat184.seq
499924221 gbpat185.seq
499999973 gbpat186.seq
499996803 gbpat187.seq
39745949 gbpat188.seq
499255855 gbpat189.seq
499854754 gbpat19.seq
499999098 gbpat190.seq
499998936 gbpat191.seq
499999609 gbpat192.seq
96568026 gbpat193.seq
499880815 gbpat194.seq
499997596 gbpat195.seq
499999338 gbpat196.seq
499999435 gbpat197.seq
90172354 gbpat198.seq
499993364 gbpat199.seq
499999508 gbpat2.seq
499999355 gbpat20.seq
499994277 gbpat200.seq
499998512 gbpat201.seq
499999457 gbpat202.seq
4092526 gbpat203.seq
499999756 gbpat204.seq
499999459 gbpat205.seq
500000244 gbpat206.seq
478202129 gbpat207.seq
500000054 gbpat208.seq
499999577 gbpat209.seq
499993518 gbpat21.seq
321705067 gbpat210.seq
499991396 gbpat211.seq
499963719 gbpat212.seq
350635988 gbpat213.seq
497506292 gbpat214.seq
499869540 gbpat215.seq
421452571 gbpat216.seq
499425936 gbpat217.seq
499999361 gbpat218.seq
336263474 gbpat219.seq
347594114 gbpat22.seq
499998549 gbpat220.seq
500000252 gbpat221.seq
499999872 gbpat222.seq
361399369 gbpat223.seq
499999662 gbpat224.seq
494515367 gbpat225.seq
341868206 gbpat226.seq
499999744 gbpat227.seq
500000159 gbpat228.seq
366896749 gbpat229.seq
499885517 gbpat23.seq
499999946 gbpat230.seq
499335751 gbpat231.seq
500000109 gbpat232.seq
499999394 gbpat233.seq
431464810 gbpat234.seq
499998936 gbpat235.seq
499999784 gbpat236.seq
500000182 gbpat237.seq
202199010 gbpat238.seq
499999639 gbpat239.seq
499998943 gbpat24.seq
499997091 gbpat240.seq
499999375 gbpat241.seq
187729792 gbpat242.seq
500000259 gbpat243.seq
499999167 gbpat244.seq
499999565 gbpat245.seq
230892338 gbpat246.seq
499937872 gbpat25.seq
499998992 gbpat26.seq
165910801 gbpat27.seq
499998849 gbpat28.seq
500000116 gbpat29.seq
61226468 gbpat3.seq
213213665 gbpat30.seq
499999775 gbpat31.seq
406025343 gbpat32.seq
499999254 gbpat33.seq
499999573 gbpat34.seq
125459610 gbpat35.seq
499999299 gbpat36.seq
499999218 gbpat37.seq
499999820 gbpat38.seq
140143821 gbpat39.seq
499999168 gbpat4.seq
499998922 gbpat40.seq
493972390 gbpat41.seq
494767350 gbpat42.seq
499999240 gbpat43.seq
149226143 gbpat44.seq
499999126 gbpat45.seq
499999712 gbpat46.seq
499999392 gbpat47.seq
87832912 gbpat48.seq
500000091 gbpat49.seq
499999485 gbpat5.seq
499999407 gbpat50.seq
499999448 gbpat51.seq
130944871 gbpat52.seq
499999366 gbpat53.seq
499999084 gbpat54.seq
184982482 gbpat55.seq
499999726 gbpat56.seq
499999154 gbpat57.seq
137265710 gbpat58.seq
499998902 gbpat59.seq
418811190 gbpat6.seq
499638184 gbpat60.seq
429853201 gbpat61.seq
500000010 gbpat62.seq
320987218 gbpat63.seq
499999504 gbpat64.seq
499999404 gbpat65.seq
306086270 gbpat66.seq
499999595 gbpat67.seq
499997159 gbpat68.seq
144919043 gbpat69.seq
499999792 gbpat7.seq
499999495 gbpat70.seq
226235202 gbpat71.seq
499942763 gbpat72.seq
500000257 gbpat73.seq
309555677 gbpat74.seq
499990988 gbpat75.seq
499996904 gbpat76.seq
259606120 gbpat77.seq
499998418 gbpat78.seq
499997914 gbpat79.seq
499997736 gbpat8.seq
36785301 gbpat80.seq
500000256 gbpat81.seq
474123180 gbpat82.seq
499999640 gbpat83.seq
331587271 gbpat84.seq
499998563 gbpat85.seq
312117887 gbpat86.seq
499997179 gbpat87.seq
500000026 gbpat88.seq
499999148 gbpat89.seq
317219149 gbpat9.seq
203786211 gbpat90.seq
499999444 gbpat91.seq
455869832 gbpat92.seq
499991359 gbpat93.seq
252194068 gbpat94.seq
499999504 gbpat95.seq
499997795 gbpat96.seq
82098506 gbpat97.seq
499999689 gbpat98.seq
498236426 gbpat99.seq
499894748 gbphg1.seq
499942690 gbphg2.seq
499860692 gbphg3.seq
499880587 gbphg4.seq
339821194 gbphg5.seq
499998607 gbpln1.seq
268695070 gbpln10.seq
498973363 gbpln100.seq
472540038 gbpln101.seq
453105795 gbpln102.seq
445429529 gbpln103.seq
387853287 gbpln104.seq
496158394 gbpln105.seq
499810291 gbpln106.seq
499842026 gbpln107.seq
278684203 gbpln108.seq
489314534 gbpln109.seq
499952364 gbpln11.seq
493772547 gbpln110.seq
474363642 gbpln111.seq
394943731 gbpln112.seq
497796041 gbpln113.seq
494269245 gbpln114.seq
496116243 gbpln115.seq
493550841 gbpln116.seq
473105851 gbpln117.seq
86418 gbpln118.seq
361751 gbpln119.seq
498196679 gbpln12.seq
164966386 gbpln120.seq
40081561 gbpln121.seq
74904960 gbpln122.seq
499998623 gbpln123.seq
357347552 gbpln124.seq
499998596 gbpln125.seq
499997982 gbpln126.seq
141165331 gbpln127.seq
499807404 gbpln128.seq
499315505 gbpln129.seq
469955571 gbpln13.seq
499989783 gbpln130.seq
287432314 gbpln131.seq
298429060 gbpln132.seq
211261295 gbpln133.seq
248512222 gbpln134.seq
185645629 gbpln135.seq
997331398 gbpln136.seq
56506409 gbpln137.seq
487346953 gbpln138.seq
473525516 gbpln139.seq
170594776 gbpln14.seq
473209377 gbpln140.seq
467870557 gbpln141.seq
168324921 gbpln142.seq
441980926 gbpln143.seq
460425795 gbpln144.seq
479222672 gbpln145.seq
92564056 gbpln146.seq
609356119 gbpln147.seq
786074578 gbpln148.seq
733167229 gbpln149.seq
496172088 gbpln15.seq
736239733 gbpln150.seq
691575746 gbpln151.seq
660133963 gbpln152.seq
739031764 gbpln153.seq
457967090 gbpln154.seq
424903730 gbpln155.seq
500000104 gbpln156.seq
63765091 gbpln157.seq
499999738 gbpln158.seq
499997703 gbpln159.seq
478225377 gbpln16.seq
269616400 gbpln160.seq
499998927 gbpln161.seq
499998158 gbpln162.seq
90514321 gbpln163.seq
499999729 gbpln164.seq
479226040 gbpln165.seq
499998298 gbpln166.seq
419086673 gbpln167.seq
499996747 gbpln168.seq
388260322 gbpln169.seq
335223965 gbpln17.seq
499998202 gbpln170.seq
499999470 gbpln171.seq
499997273 gbpln172.seq
67203680 gbpln173.seq
499997589 gbpln174.seq
500000027 gbpln175.seq
420992329 gbpln176.seq
499823936 gbpln177.seq
499591755 gbpln178.seq
499542824 gbpln179.seq
418823303 gbpln18.seq
280581486 gbpln180.seq
499803964 gbpln181.seq
491537745 gbpln182.seq
402785639 gbpln183.seq
445924319 gbpln184.seq
499804565 gbpln185.seq
5557296 gbpln186.seq
492236492 gbpln187.seq
226945063 gbpln188.seq
315788495 gbpln189.seq
499938071 gbpln19.seq
665291577 gbpln190.seq
860028189 gbpln191.seq
800605872 gbpln192.seq
794469115 gbpln193.seq
762933697 gbpln194.seq
729969959 gbpln195.seq
808217924 gbpln196.seq
209362038 gbpln197.seq
924325157 gbpln198.seq
1201978654 gbpln199.seq
499855105 gbpln2.seq
175833299 gbpln20.seq
1227268207 gbpln200.seq
1152253241 gbpln201.seq
1115248374 gbpln202.seq
1125506105 gbpln203.seq
1145303472 gbpln204.seq
695608615 gbpln205.seq
494723065 gbpln206.seq
460644363 gbpln207.seq
152680390 gbpln208.seq
463010270 gbpln209.seq
345816360 gbpln21.seq
480459234 gbpln210.seq
494737040 gbpln211.seq
446440740 gbpln212.seq
417743779 gbpln213.seq
250838119 gbpln214.seq
364689197 gbpln215.seq
339196729 gbpln216.seq
386320509 gbpln217.seq
311828079 gbpln218.seq
213907446 gbpln219.seq
384509785 gbpln22.seq
547058897 gbpln220.seq
117077133 gbpln221.seq
485280656 gbpln222.seq
153216335 gbpln223.seq
689933987 gbpln224.seq
887561680 gbpln225.seq
834970472 gbpln226.seq
826391913 gbpln227.seq
792513917 gbpln228.seq
743209872 gbpln229.seq
204428670 gbpln23.seq
833073712 gbpln230.seq
564051 gbpln231.seq
665291577 gbpln232.seq
860028189 gbpln233.seq
800605872 gbpln234.seq
794469115 gbpln235.seq
762933697 gbpln236.seq
729969959 gbpln237.seq
808217924 gbpln238.seq
189117573 gbpln239.seq
84883532 gbpln24.seq
663098252 gbpln240.seq
855592604 gbpln241.seq
807031053 gbpln242.seq
793905039 gbpln243.seq
773303164 gbpln244.seq
718153248 gbpln245.seq
804870210 gbpln246.seq
661762125 gbpln247.seq
840180304 gbpln248.seq
796430245 gbpln249.seq
477735094 gbpln25.seq
779180715 gbpln250.seq
761224530 gbpln251.seq
725380245 gbpln252.seq
792983451 gbpln253.seq
652402241 gbpln254.seq
831209396 gbpln255.seq
783682955 gbpln256.seq
775938782 gbpln257.seq
741958804 gbpln258.seq
700440901 gbpln259.seq
499901688 gbpln26.seq
788705159 gbpln260.seq
683172189 gbpln261.seq
854365289 gbpln262.seq
802776370 gbpln263.seq
793295936 gbpln264.seq
769246264 gbpln265.seq
710912943 gbpln266.seq
799876839 gbpln267.seq
635039454 gbpln268.seq
824184474 gbpln269.seq
498817745 gbpln27.seq
768070182 gbpln270.seq
758956882 gbpln271.seq
732189331 gbpln272.seq
706311232 gbpln273.seq
766293442 gbpln274.seq
651415133 gbpln275.seq
830082304 gbpln276.seq
783385752 gbpln277.seq
770520351 gbpln278.seq
753421970 gbpln279.seq
323729344 gbpln28.seq
699441547 gbpln280.seq
784443196 gbpln281.seq
702337808 gbpln282.seq
906907390 gbpln283.seq
844110716 gbpln284.seq
841780855 gbpln285.seq
805270043 gbpln286.seq
764396863 gbpln287.seq
841492595 gbpln288.seq
714482811 gbpln289.seq
499081327 gbpln29.seq
916127997 gbpln290.seq
858459407 gbpln291.seq
848936990 gbpln292.seq
813129213 gbpln293.seq
765593150 gbpln294.seq
862731158 gbpln295.seq
665885340 gbpln296.seq
629668050 gbpln297.seq
814320946 gbpln298.seq
759349720 gbpln299.seq
499871755 gbpln3.seq
497391978 gbpln30.seq
762512207 gbpln300.seq
724647884 gbpln301.seq
679679449 gbpln302.seq
784312844 gbpln303.seq
684180819 gbpln304.seq
873292213 gbpln305.seq
827422505 gbpln306.seq
815925825 gbpln307.seq
779009585 gbpln308.seq
739747654 gbpln309.seq
499424594 gbpln31.seq
834950434 gbpln310.seq
663096073 gbpln311.seq
849628701 gbpln312.seq
803882830 gbpln313.seq
794420470 gbpln314.seq
760127459 gbpln315.seq
714663802 gbpln316.seq
801095950 gbpln317.seq
668869887 gbpln318.seq
854770002 gbpln319.seq
103293547 gbpln32.seq
805931576 gbpln320.seq
798923954 gbpln321.seq
766411223 gbpln322.seq
723133936 gbpln323.seq
803351408 gbpln324.seq
664176987 gbpln325.seq
854339916 gbpln326.seq
803900400 gbpln327.seq
791449620 gbpln328.seq
761145205 gbpln329.seq
496565850 gbpln33.seq
715062603 gbpln330.seq
806379176 gbpln331.seq
668964953 gbpln332.seq
870939392 gbpln333.seq
809408813 gbpln334.seq
801514137 gbpln335.seq
768794024 gbpln336.seq
723644689 gbpln337.seq
815153418 gbpln338.seq
661177159 gbpln339.seq
498203430 gbpln34.seq
846934671 gbpln340.seq
794708793 gbpln341.seq
789781753 gbpln342.seq
764576068 gbpln343.seq
711115451 gbpln344.seq
797517245 gbpln345.seq
691953899 gbpln346.seq
888406351 gbpln347.seq
835271741 gbpln348.seq
823533989 gbpln349.seq
349198346 gbpln35.seq
787819193 gbpln350.seq
748786657 gbpln351.seq
838184652 gbpln352.seq
488783635 gbpln353.seq
439661491 gbpln354.seq
155752105 gbpln355.seq
758806100 gbpln356.seq
898446949 gbpln357.seq
628489896 gbpln358.seq
1024113089 gbpln359.seq
454048044 gbpln36.seq
1032878661 gbpln360.seq
858694781 gbpln361.seq
960391204 gbpln362.seq
1090094606 gbpln363.seq
781959143 gbpln364.seq
946995961 gbpln365.seq
857542781 gbpln366.seq
656405285 gbpln367.seq
907889097 gbpln368.seq
896386890 gbpln369.seq
495221716 gbpln37.seq
726432335 gbpln370.seq
798296822 gbpln371.seq
918393750 gbpln372.seq
584961784 gbpln373.seq
948865971 gbpln374.seq
954536271 gbpln375.seq
819735731 gbpln376.seq
756588093 gbpln377.seq
876067119 gbpln378.seq
625446321 gbpln379.seq
382012980 gbpln38.seq
977801494 gbpln380.seq
854357980 gbpln381.seq
807732556 gbpln382.seq
947696453 gbpln383.seq
1067629605 gbpln384.seq
822222048 gbpln385.seq
950272996 gbpln386.seq
845138843 gbpln387.seq
643846993 gbpln388.seq
894745096 gbpln389.seq
498975616 gbpln39.seq
893352134 gbpln390.seq
722578984 gbpln391.seq
776227316 gbpln392.seq
899750467 gbpln393.seq
592059964 gbpln394.seq
933986451 gbpln395.seq
939527664 gbpln396.seq
810117922 gbpln397.seq
765938558 gbpln398.seq
886537018 gbpln399.seq
499996171 gbpln4.seq
472855786 gbpln40.seq
623519964 gbpln400.seq
996940649 gbpln401.seq
1030190034 gbpln402.seq
832828033 gbpln403.seq
956342979 gbpln404.seq
1134286144 gbpln405.seq
790513299 gbpln406.seq
944161893 gbpln407.seq
860035788 gbpln408.seq
647268685 gbpln409.seq
496785962 gbpln41.seq
902239623 gbpln410.seq
611029440 gbpln411.seq
734907577 gbpln412.seq
787834228 gbpln413.seq
910724363 gbpln414.seq
606016896 gbpln415.seq
961485234 gbpln416.seq
1242775191 gbpln417.seq
816670128 gbpln418.seq
636658925 gbpln419.seq
429867937 gbpln42.seq
818591771 gbpln420.seq
766580884 gbpln421.seq
752100829 gbpln422.seq
724519993 gbpln423.seq
690955648 gbpln424.seq
769738288 gbpln425.seq
750738544 gbpln426.seq
872184389 gbpln427.seq
624480879 gbpln428.seq
995069022 gbpln429.seq
478648725 gbpln43.seq
1012956234 gbpln430.seq
827074347 gbpln431.seq
940621783 gbpln432.seq
1079418810 gbpln433.seq
776922106 gbpln434.seq
938380968 gbpln435.seq
848757671 gbpln436.seq
643572913 gbpln437.seq
891714442 gbpln438.seq
878638403 gbpln439.seq
83738349 gbpln44.seq
721632671 gbpln440.seq
779156122 gbpln441.seq
895553446 gbpln442.seq
604678568 gbpln443.seq
931006295 gbpln444.seq
933660027 gbpln445.seq
810459540 gbpln446.seq
761872100 gbpln447.seq
878702815 gbpln448.seq
627081460 gbpln449.seq
494333229 gbpln45.seq
994320235 gbpln450.seq
999434327 gbpln451.seq
823789349 gbpln452.seq
945629782 gbpln453.seq
1062113821 gbpln454.seq
792298939 gbpln455.seq
941851700 gbpln456.seq
850142413 gbpln457.seq
656955691 gbpln458.seq
904094753 gbpln459.seq
475215142 gbpln46.seq
900193903 gbpln460.seq
728906821 gbpln461.seq
741172650 gbpln462.seq
898719079 gbpln463.seq
599002526 gbpln464.seq
937117048 gbpln465.seq
936021119 gbpln466.seq
812696702 gbpln467.seq
746628212 gbpln468.seq
897168807 gbpln469.seq
468208544 gbpln47.seq
626698501 gbpln470.seq
1007072101 gbpln471.seq
1000831797 gbpln472.seq
841918855 gbpln473.seq
963426816 gbpln474.seq
1093654114 gbpln475.seq
791118382 gbpln476.seq
959940756 gbpln477.seq
853263842 gbpln478.seq
648051398 gbpln479.seq
486857567 gbpln48.seq
901282075 gbpln480.seq
923491092 gbpln481.seq
732477869 gbpln482.seq
789987733 gbpln483.seq
926022053 gbpln484.seq
610840579 gbpln485.seq
949759032 gbpln486.seq
955444559 gbpln487.seq
818480442 gbpln488.seq
752251380 gbpln489.seq
272302955 gbpln49.seq
897893149 gbpln490.seq
631111272 gbpln491.seq
1022032953 gbpln492.seq
1006306956 gbpln493.seq
837035085 gbpln494.seq
966140819 gbpln495.seq
1090560006 gbpln496.seq
800164754 gbpln497.seq
959884028 gbpln498.seq
886916735 gbpln499.seq
465932320 gbpln5.seq
172902191 gbpln50.seq
641540050 gbpln500.seq
910168783 gbpln501.seq
908785549 gbpln502.seq
729527181 gbpln503.seq
797552105 gbpln504.seq
910975470 gbpln505.seq
616026199 gbpln506.seq
945685366 gbpln507.seq
953145956 gbpln508.seq
820081609 gbpln509.seq
471233536 gbpln51.seq
763165947 gbpln510.seq
870898266 gbpln511.seq
618200825 gbpln512.seq
1009123187 gbpln513.seq
1016689515 gbpln514.seq
832912303 gbpln515.seq
952656374 gbpln516.seq
1065835283 gbpln517.seq
776075044 gbpln518.seq
935940025 gbpln519.seq
455042321 gbpln52.seq
846831932 gbpln520.seq
641399988 gbpln521.seq
892709705 gbpln522.seq
594848385 gbpln523.seq
720169483 gbpln524.seq
780564861 gbpln525.seq
888344689 gbpln526.seq
610800072 gbpln527.seq
934713391 gbpln528.seq
1233388213 gbpln529.seq
488809223 gbpln53.seq
807523234 gbpln530.seq
19542 gbpln531.seq
757881986 gbpln532.seq
889760627 gbpln533.seq
635890046 gbpln534.seq
1007873898 gbpln535.seq
1015524558 gbpln536.seq
836625022 gbpln537.seq
959076059 gbpln538.seq
1077416379 gbpln539.seq
355272263 gbpln54.seq
789416089 gbpln540.seq
958430056 gbpln541.seq
877922843 gbpln542.seq
648665455 gbpln543.seq
907513209 gbpln544.seq
904978028 gbpln545.seq
727024880 gbpln546.seq
789120540 gbpln547.seq
898507915 gbpln548.seq
617229811 gbpln549.seq
200538454 gbpln55.seq
942711764 gbpln550.seq
964780021 gbpln551.seq
818917331 gbpln552.seq
755294557 gbpln553.seq
882064051 gbpln554.seq
627203691 gbpln555.seq
993595919 gbpln556.seq
1021497440 gbpln557.seq
827286497 gbpln558.seq
962451301 gbpln559.seq
377219536 gbpln56.seq
1082256067 gbpln560.seq
781463827 gbpln561.seq
919665368 gbpln562.seq
852133929 gbpln563.seq
645388382 gbpln564.seq
905574854 gbpln565.seq
906714977 gbpln566.seq
718743537 gbpln567.seq
787529633 gbpln568.seq
910251919 gbpln569.seq
375192640 gbpln57.seq
608518276 gbpln570.seq
934541265 gbpln571.seq
954054955 gbpln572.seq
806443717 gbpln573.seq
253200691 gbpln574.seq
654245898 gbpln575.seq
843080362 gbpln576.seq
787261705 gbpln577.seq
773098599 gbpln578.seq
745082094 gbpln579.seq
386441749 gbpln58.seq
711612756 gbpln580.seq
801222610 gbpln581.seq
271464 gbpln582.seq
398651709 gbpln583.seq
315170317 gbpln584.seq
306732013 gbpln585.seq
319872292 gbpln586.seq
286450423 gbpln587.seq
220883441 gbpln588.seq
470283415 gbpln589.seq
482478614 gbpln59.seq
475850186 gbpln590.seq
499124918 gbpln591.seq
460644363 gbpln592.seq
359155255 gbpln593.seq
399402445 gbpln594.seq
501115666 gbpln595.seq
413826113 gbpln596.seq
367000227 gbpln597.seq
238050627 gbpln598.seq
352241749 gbpln599.seq
499999034 gbpln6.seq
473293925 gbpln60.seq
298781185 gbpln600.seq
490716477 gbpln601.seq
86105216 gbpln602.seq
9838016 gbpln603.seq
10182293 gbpln604.seq
766528189 gbpln605.seq
422677536 gbpln606.seq
133574530 gbpln607.seq
756143249 gbpln608.seq
878426054 gbpln609.seq
476593700 gbpln61.seq
631056251 gbpln610.seq
993852367 gbpln611.seq
1020132695 gbpln612.seq
830166807 gbpln613.seq
955723315 gbpln614.seq
1057964328 gbpln615.seq
784007552 gbpln616.seq
947940191 gbpln617.seq
857511193 gbpln618.seq
649137171 gbpln619.seq
434249982 gbpln62.seq
903393879 gbpln620.seq
908180396 gbpln621.seq
721135945 gbpln622.seq
786739709 gbpln623.seq
918070756 gbpln624.seq
603192844 gbpln625.seq
938102555 gbpln626.seq
955978436 gbpln627.seq
813787878 gbpln628.seq
639701128 gbpln629.seq
440487400 gbpln63.seq
468519430 gbpln630.seq
499445109 gbpln631.seq
498567457 gbpln632.seq
20791137 gbpln633.seq
768129678 gbpln634.seq
891209633 gbpln635.seq
1017177961 gbpln636.seq
1036708108 gbpln637.seq
980496603 gbpln638.seq
1096870510 gbpln639.seq
444203819 gbpln64.seq
964601805 gbpln640.seq
883690282 gbpln641.seq
879367269 gbpln642.seq
922136688 gbpln643.seq
805432021 gbpln644.seq
912345991 gbpln645.seq
954500353 gbpln646.seq
944560088 gbpln647.seq
29543150 gbpln648.seq
401384300 gbpln649.seq
189178941 gbpln65.seq
499997720 gbpln650.seq
499778047 gbpln651.seq
475785137 gbpln652.seq
499998880 gbpln653.seq
499743157 gbpln654.seq
499998762 gbpln655.seq
53803864 gbpln656.seq
499732011 gbpln657.seq
499998487 gbpln658.seq
499998081 gbpln659.seq
460468033 gbpln66.seq
193993265 gbpln660.seq
499996871 gbpln661.seq
499748414 gbpln662.seq
499999144 gbpln663.seq
499849755 gbpln664.seq
499887541 gbpln665.seq
106404151 gbpln666.seq
499750469 gbpln667.seq
499999448 gbpln668.seq
499874391 gbpln669.seq
440542307 gbpln67.seq
153494293 gbpln670.seq
357423522 gbpln671.seq
453535590 gbpln672.seq
315191996 gbpln673.seq
679344023 gbpln674.seq
873797632 gbpln675.seq
820367220 gbpln676.seq
806296382 gbpln677.seq
775209384 gbpln678.seq
744231520 gbpln679.seq
452992006 gbpln68.seq
817156402 gbpln680.seq
771380170 gbpln681.seq
913253142 gbpln682.seq
634934982 gbpln683.seq
1019175188 gbpln684.seq
1023638564 gbpln685.seq
822225605 gbpln686.seq
961290952 gbpln687.seq
1090804562 gbpln688.seq
813694518 gbpln689.seq
497916786 gbpln69.seq
962545328 gbpln690.seq
873725319 gbpln691.seq
673190932 gbpln692.seq
905064826 gbpln693.seq
908590682 gbpln694.seq
742712720 gbpln695.seq
793279946 gbpln696.seq
934932909 gbpln697.seq
640700840 gbpln698.seq
961568346 gbpln699.seq
499856130 gbpln7.seq
480376128 gbpln70.seq
952066709 gbpln700.seq
827214105 gbpln701.seq
455119462 gbpln702.seq
483800372 gbpln703.seq
408962039 gbpln704.seq
329779393 gbpln705.seq
332794404 gbpln706.seq
418495189 gbpln707.seq
443558619 gbpln708.seq
449429603 gbpln709.seq
71745252 gbpln71.seq
403262216 gbpln710.seq
477398793 gbpln711.seq
434139529 gbpln712.seq
488358692 gbpln713.seq
482840837 gbpln714.seq
469665157 gbpln715.seq
228132202 gbpln716.seq
434627789 gbpln717.seq
412605137 gbpln718.seq
486452574 gbpln719.seq
470915914 gbpln72.seq
475648613 gbpln720.seq
480187598 gbpln721.seq
445114184 gbpln722.seq
461854061 gbpln723.seq
499646071 gbpln724.seq
476206835 gbpln725.seq
473737289 gbpln726.seq
467895412 gbpln727.seq
429748374 gbpln728.seq
472129613 gbpln73.seq
477884160 gbpln74.seq
460004048 gbpln75.seq
430418757 gbpln76.seq
441540696 gbpln77.seq
433637010 gbpln78.seq
498225038 gbpln79.seq
225561812 gbpln8.seq
107501131 gbpln80.seq
449964742 gbpln81.seq
422837725 gbpln82.seq
383453843 gbpln83.seq
376172115 gbpln84.seq
326317072 gbpln85.seq
320571252 gbpln86.seq
286199716 gbpln87.seq
277716231 gbpln88.seq
499733063 gbpln89.seq
499990067 gbpln9.seq
63743689 gbpln90.seq
391026515 gbpln91.seq
362500946 gbpln92.seq
390024684 gbpln93.seq
341773034 gbpln94.seq
199854530 gbpln95.seq
483137313 gbpln96.seq
493806535 gbpln97.seq
497200072 gbpln98.seq
492442383 gbpln99.seq
148373605 gbpri1.seq
499825465 gbpri10.seq
499966274 gbpri11.seq
248882813 gbpri12.seq
499849548 gbpri13.seq
352975484 gbpri14.seq
162642387 gbpri15.seq
494717022 gbpri16.seq
499956353 gbpri17.seq
499952905 gbpri18.seq
499962231 gbpri19.seq
499849563 gbpri2.seq
254317986 gbpri20.seq
317623183 gbpri21.seq
301998886 gbpri22.seq
491209604 gbpri23.seq
445784104 gbpri24.seq
381563743 gbpri25.seq
343179555 gbpri26.seq
476586505 gbpri27.seq
474070691 gbpri28.seq
368091958 gbpri29.seq
499891257 gbpri3.seq
499999042 gbpri30.seq
73664678 gbpri31.seq
499936200 gbpri32.seq
445708926 gbpri33.seq
427945376 gbpri34.seq
376528667 gbpri35.seq
483909000 gbpri36.seq
361487740 gbpri37.seq
388659484 gbpri38.seq
448630212 gbpri39.seq
499855390 gbpri4.seq
499941391 gbpri40.seq
307422144 gbpri41.seq
314630207 gbpri42.seq
499998781 gbpri43.seq
499999272 gbpri44.seq
213480365 gbpri45.seq
499994791 gbpri46.seq
499999165 gbpri47.seq
316320939 gbpri48.seq
499983237 gbpri49.seq
499729136 gbpri5.seq
499996439 gbpri50.seq
315505284 gbpri51.seq
258775295 gbpri52.seq
499996591 gbpri53.seq
499998528 gbpri54.seq
499975059 gbpri55.seq
279228758 gbpri56.seq
393528728 gbpri6.seq
499802910 gbpri7.seq
499984899 gbpri8.seq
499967070 gbpri9.seq
658938 gbrel.txt
499981989 gbrod1.seq
499996921 gbrod10.seq
6033878 gbrod11.seq
499808157 gbrod12.seq
203924668 gbrod13.seq
499994573 gbrod14.seq
499997569 gbrod15.seq
499999641 gbrod16.seq
294801722 gbrod17.seq
406446251 gbrod18.seq
485622455 gbrod19.seq
499802341 gbrod2.seq
447177630 gbrod20.seq
401874128 gbrod21.seq
366906645 gbrod22.seq
178573611 gbrod23.seq
488460732 gbrod24.seq
424418910 gbrod25.seq
451727107 gbrod26.seq
499112036 gbrod27.seq
467946548 gbrod28.seq
425428799 gbrod29.seq
499880319 gbrod3.seq
380509124 gbrod30.seq
359291146 gbrod31.seq
441031541 gbrod32.seq
489661762 gbrod33.seq
301541852 gbrod34.seq
245696968 gbrod35.seq
444533522 gbrod36.seq
404901396 gbrod37.seq
350079181 gbrod38.seq
484303888 gbrod39.seq
499702715 gbrod4.seq
464197213 gbrod40.seq
311672321 gbrod41.seq
441713729 gbrod42.seq
398906813 gbrod43.seq
493373336 gbrod44.seq
407105696 gbrod45.seq
117842878 gbrod46.seq
488265022 gbrod47.seq
434197329 gbrod48.seq
412800312 gbrod49.seq
499960342 gbrod5.seq
454365663 gbrod50.seq
382748472 gbrod51.seq
428038719 gbrod52.seq
487918369 gbrod53.seq
440586747 gbrod54.seq
359290553 gbrod55.seq
410329952 gbrod56.seq
258123670 gbrod57.seq
390007635 gbrod58.seq
346418766 gbrod59.seq
80291490 gbrod6.seq
345548222 gbrod60.seq
465925928 gbrod61.seq
403537722 gbrod62.seq
386823577 gbrod63.seq
403462511 gbrod64.seq
391812927 gbrod65.seq
346719868 gbrod66.seq
491742089 gbrod67.seq
445010312 gbrod68.seq
493387550 gbrod69.seq
499846851 gbrod7.seq
300864949 gbrod70.seq
466768965 gbrod71.seq
374387663 gbrod72.seq
350248940 gbrod73.seq
470230178 gbrod74.seq
465917437 gbrod75.seq
493546372 gbrod76.seq
241665906 gbrod77.seq
499742719 gbrod8.seq
499945822 gbrod9.seq
499999694 gbsts1.seq
499997730 gbsts10.seq
433283954 gbsts11.seq
499997185 gbsts2.seq
38079720 gbsts3.seq
499998792 gbsts4.seq
499996883 gbsts5.seq
456729482 gbsts6.seq
499997464 gbsts7.seq
499999680 gbsts8.seq
21540654 gbsts9.seq
300834652 gbsyn1.seq
484840372 gbsyn10.seq
420813753 gbsyn11.seq
490139440 gbsyn12.seq
343340422 gbsyn13.seq
372527348 gbsyn14.seq
417861289 gbsyn15.seq
448312981 gbsyn16.seq
416378132 gbsyn17.seq
453065790 gbsyn18.seq
263307032 gbsyn19.seq
343340424 gbsyn2.seq
484840366 gbsyn20.seq
420813747 gbsyn21.seq
498979310 gbsyn22.seq
499990268 gbsyn23.seq
48549451 gbsyn24.seq
499993129 gbsyn25.seq
499996375 gbsyn26.seq
499995233 gbsyn27.seq
245498035 gbsyn28.seq
347814164 gbsyn29.seq
372527353 gbsyn3.seq
417861297 gbsyn4.seq
448312992 gbsyn5.seq
81377357 gbsyn6.seq
470781602 gbsyn7.seq
317285242 gbsyn8.seq
263307034 gbsyn9.seq
499999476 gbtsa1.seq
500000000 gbtsa10.seq
499997439 gbtsa100.seq
499999811 gbtsa101.seq
499996108 gbtsa102.seq
404671505 gbtsa103.seq
499996434 gbtsa104.seq
499998444 gbtsa105.seq
499998535 gbtsa106.seq
473627173 gbtsa107.seq
499999949 gbtsa108.seq
499998832 gbtsa109.seq
499997424 gbtsa11.seq
236669988 gbtsa110.seq
499991596 gbtsa111.seq
499999834 gbtsa112.seq
499999770 gbtsa113.seq
499998939 gbtsa114.seq
34150369 gbtsa115.seq
499995781 gbtsa116.seq
499999069 gbtsa117.seq
499994937 gbtsa118.seq
470659755 gbtsa119.seq
280130073 gbtsa12.seq
499998218 gbtsa120.seq
499998672 gbtsa121.seq
499999924 gbtsa122.seq
280313902 gbtsa123.seq
499999116 gbtsa124.seq
499998111 gbtsa125.seq
499999818 gbtsa126.seq
423256101 gbtsa127.seq
499996235 gbtsa13.seq
499998510 gbtsa14.seq
152208041 gbtsa15.seq
499999603 gbtsa16.seq
499997193 gbtsa17.seq
258373800 gbtsa18.seq
499998168 gbtsa19.seq
499998745 gbtsa2.seq
499999213 gbtsa20.seq
500000233 gbtsa21.seq
67592738 gbtsa22.seq
499998052 gbtsa23.seq
499999856 gbtsa24.seq
499998098 gbtsa25.seq
277251866 gbtsa26.seq
499999635 gbtsa27.seq
499999791 gbtsa28.seq
71311344 gbtsa29.seq
146901025 gbtsa3.seq
499999538 gbtsa30.seq
499999007 gbtsa31.seq
158252503 gbtsa32.seq
499998095 gbtsa33.seq
499999071 gbtsa34.seq
499998984 gbtsa35.seq
489509289 gbtsa36.seq
499999807 gbtsa37.seq
499998500 gbtsa38.seq
499999107 gbtsa39.seq
499998574 gbtsa4.seq
227191517 gbtsa40.seq
499999675 gbtsa41.seq
499991892 gbtsa42.seq
500000238 gbtsa43.seq
175111340 gbtsa44.seq
499998997 gbtsa45.seq
499999560 gbtsa46.seq
354820880 gbtsa47.seq
499999373 gbtsa48.seq
499997080 gbtsa49.seq
499999957 gbtsa5.seq
292181365 gbtsa50.seq
499997879 gbtsa51.seq
500000195 gbtsa52.seq
395118408 gbtsa53.seq
499997625 gbtsa54.seq
499998684 gbtsa55.seq
500000232 gbtsa56.seq
344426441 gbtsa57.seq
499999428 gbtsa58.seq
499998841 gbtsa59.seq
50320220 gbtsa6.seq
499998177 gbtsa60.seq
224353812 gbtsa61.seq
499999722 gbtsa62.seq
500000157 gbtsa63.seq
259943701 gbtsa64.seq
499999212 gbtsa65.seq
465402653 gbtsa66.seq
499998493 gbtsa67.seq
499999436 gbtsa68.seq
499996902 gbtsa69.seq
499995889 gbtsa7.seq
165103829 gbtsa70.seq
499997567 gbtsa71.seq
500000162 gbtsa72.seq
499998185 gbtsa73.seq
2512297 gbtsa74.seq
499998773 gbtsa75.seq
499998780 gbtsa76.seq
131409934 gbtsa77.seq
500000012 gbtsa78.seq
500000259 gbtsa79.seq
499998945 gbtsa8.seq
33928768 gbtsa80.seq
499999375 gbtsa81.seq
499997795 gbtsa82.seq
499997482 gbtsa83.seq
499998016 gbtsa84.seq
45872069 gbtsa85.seq
499997106 gbtsa86.seq
499998546 gbtsa87.seq
499999206 gbtsa88.seq
81426641 gbtsa89.seq
271009161 gbtsa9.seq
499999824 gbtsa90.seq
389215892 gbtsa91.seq
499998191 gbtsa92.seq
499994249 gbtsa93.seq
499998640 gbtsa94.seq
208350764 gbtsa95.seq
499999734 gbtsa96.seq
499998253 gbtsa97.seq
499996332 gbtsa98.seq
230879944 gbtsa99.seq
7022833 gbuna1.seq
499960340 gbvrl1.seq
499998794 gbvrl10.seq
156024328 gbvrl100.seq
499950429 gbvrl101.seq
499968853 gbvrl102.seq
499995767 gbvrl103.seq
221920795 gbvrl104.seq
499976172 gbvrl105.seq
499960522 gbvrl106.seq
499973186 gbvrl107.seq
431560371 gbvrl108.seq
499982927 gbvrl109.seq
499986907 gbvrl11.seq
499977813 gbvrl110.seq
499971395 gbvrl111.seq
141536117 gbvrl112.seq
499982292 gbvrl113.seq
499958960 gbvrl114.seq
499976000 gbvrl115.seq
490319591 gbvrl116.seq
499943193 gbvrl117.seq
499977720 gbvrl118.seq
499982025 gbvrl119.seq
163528822 gbvrl12.seq
255824159 gbvrl120.seq
499957050 gbvrl121.seq
499973710 gbvrl122.seq
499972181 gbvrl123.seq
499987595 gbvrl124.seq
5907114 gbvrl125.seq
499986354 gbvrl126.seq
499942138 gbvrl127.seq
499963493 gbvrl128.seq
499948253 gbvrl129.seq
499996954 gbvrl13.seq
300623147 gbvrl130.seq
499962058 gbvrl131.seq
499975522 gbvrl132.seq
499984933 gbvrl133.seq
499965728 gbvrl134.seq
499976578 gbvrl135.seq
225739938 gbvrl136.seq
499977611 gbvrl137.seq
499973738 gbvrl138.seq
499972748 gbvrl139.seq
499997816 gbvrl14.seq
322559158 gbvrl140.seq
499982106 gbvrl141.seq
499975547 gbvrl142.seq
499968141 gbvrl143.seq
291475553 gbvrl144.seq
499949846 gbvrl145.seq
499942801 gbvrl146.seq
499994645 gbvrl147.seq
181294190 gbvrl148.seq
499970519 gbvrl149.seq
134084819 gbvrl15.seq
499986834 gbvrl150.seq
499950755 gbvrl151.seq
499987786 gbvrl152.seq
251540897 gbvrl153.seq
499972421 gbvrl154.seq
499942510 gbvrl155.seq
499988746 gbvrl156.seq
237753471 gbvrl157.seq
499974277 gbvrl158.seq
499975198 gbvrl159.seq
499995706 gbvrl16.seq
499943494 gbvrl160.seq
499953728 gbvrl161.seq
278848902 gbvrl162.seq
499956780 gbvrl163.seq
499969425 gbvrl164.seq
499954054 gbvrl165.seq
499936963 gbvrl166.seq
224690429 gbvrl167.seq
499966325 gbvrl168.seq
499961808 gbvrl169.seq
499998553 gbvrl17.seq
499948393 gbvrl170.seq
336410902 gbvrl171.seq
499980583 gbvrl172.seq
499974002 gbvrl173.seq
499935447 gbvrl174.seq
148681210 gbvrl175.seq
499963812 gbvrl176.seq
499948958 gbvrl177.seq
499951529 gbvrl178.seq
150727797 gbvrl179.seq
315373917 gbvrl18.seq
499950957 gbvrl180.seq
499956753 gbvrl181.seq
499945341 gbvrl182.seq
460290171 gbvrl183.seq
499942504 gbvrl184.seq
499947570 gbvrl185.seq
499954671 gbvrl186.seq
498557457 gbvrl187.seq
499990413 gbvrl188.seq
499970879 gbvrl189.seq
499999744 gbvrl19.seq
499991746 gbvrl190.seq
168858117 gbvrl191.seq
499952800 gbvrl192.seq
499986663 gbvrl193.seq
499953698 gbvrl194.seq
351909135 gbvrl195.seq
499938270 gbvrl196.seq
499943308 gbvrl197.seq
499937521 gbvrl198.seq
201555920 gbvrl199.seq
499970755 gbvrl2.seq
499995881 gbvrl20.seq
499946920 gbvrl200.seq
499971596 gbvrl201.seq
499958298 gbvrl202.seq
239440962 gbvrl203.seq
499963930 gbvrl204.seq
499974102 gbvrl205.seq
499956348 gbvrl206.seq
499967584 gbvrl207.seq
129150442 gbvrl208.seq
499964580 gbvrl209.seq
345438733 gbvrl21.seq
499998538 gbvrl210.seq
499953147 gbvrl211.seq
327401387 gbvrl212.seq
499951473 gbvrl213.seq
499963096 gbvrl214.seq
499985916 gbvrl215.seq
418063086 gbvrl216.seq
499993142 gbvrl217.seq
499986543 gbvrl218.seq
499994963 gbvrl219.seq
499995123 gbvrl22.seq
247183910 gbvrl220.seq
499988949 gbvrl221.seq
499981657 gbvrl222.seq
499995563 gbvrl223.seq
484639425 gbvrl224.seq
499951950 gbvrl225.seq
499932652 gbvrl226.seq
499959198 gbvrl227.seq
176335329 gbvrl228.seq
499995979 gbvrl229.seq
499997007 gbvrl23.seq
499992000 gbvrl230.seq
499979847 gbvrl231.seq
499936972 gbvrl232.seq
499955316 gbvrl233.seq
191299054 gbvrl234.seq
499977243 gbvrl235.seq
499980632 gbvrl236.seq
499992463 gbvrl237.seq
499950164 gbvrl238.seq
69194859 gbvrl239.seq
369156337 gbvrl24.seq
499957073 gbvrl240.seq
499935660 gbvrl241.seq
499980336 gbvrl242.seq
499955130 gbvrl243.seq
148453325 gbvrl244.seq
499933054 gbvrl245.seq
499996607 gbvrl246.seq
499970501 gbvrl247.seq
426558438 gbvrl248.seq
499944568 gbvrl249.seq
499997535 gbvrl25.seq
499981814 gbvrl250.seq
499997337 gbvrl251.seq
347801993 gbvrl252.seq
499980403 gbvrl253.seq
499955038 gbvrl254.seq
499995405 gbvrl255.seq
246207730 gbvrl256.seq
499941586 gbvrl257.seq
499957362 gbvrl258.seq
499949364 gbvrl259.seq
499999710 gbvrl26.seq
421397902 gbvrl260.seq
499988315 gbvrl261.seq
499981102 gbvrl262.seq
499934298 gbvrl263.seq
284386798 gbvrl264.seq
499983836 gbvrl265.seq
499987591 gbvrl266.seq
499996780 gbvrl267.seq
233831995 gbvrl268.seq
499987930 gbvrl269.seq
313952423 gbvrl27.seq
499967334 gbvrl270.seq
499977561 gbvrl271.seq
237166390 gbvrl272.seq
490193585 gbvrl273.seq
499992500 gbvrl274.seq
252523082 gbvrl275.seq
76688277 gbvrl276.seq
499994644 gbvrl277.seq
499965832 gbvrl278.seq
499992766 gbvrl279.seq
499766558 gbvrl28.seq
249246445 gbvrl280.seq
499997356 gbvrl281.seq
499968021 gbvrl282.seq
499975157 gbvrl283.seq
277362516 gbvrl284.seq
499986328 gbvrl285.seq
499980027 gbvrl286.seq
499966393 gbvrl287.seq
168156082 gbvrl288.seq
499975260 gbvrl289.seq
499997454 gbvrl29.seq
499961425 gbvrl290.seq
499971521 gbvrl291.seq
142698270 gbvrl292.seq
499994331 gbvrl293.seq
499995803 gbvrl294.seq
499991037 gbvrl295.seq
257487211 gbvrl296.seq
499977149 gbvrl297.seq
499988829 gbvrl298.seq
499978366 gbvrl299.seq
414914184 gbvrl3.seq
499981258 gbvrl30.seq
139136987 gbvrl300.seq
499971782 gbvrl301.seq
499992483 gbvrl302.seq
499968666 gbvrl303.seq
259142646 gbvrl304.seq
499993900 gbvrl305.seq
499988767 gbvrl306.seq
499989180 gbvrl307.seq
123572894 gbvrl308.seq
499970770 gbvrl309.seq
239907550 gbvrl31.seq
499994066 gbvrl310.seq
499994968 gbvrl311.seq
468067502 gbvrl312.seq
499990734 gbvrl313.seq
499988330 gbvrl314.seq
499996240 gbvrl315.seq
117898728 gbvrl316.seq
499981425 gbvrl317.seq
499994187 gbvrl318.seq
499989000 gbvrl319.seq
499993200 gbvrl32.seq
359700612 gbvrl320.seq
499994806 gbvrl321.seq
499976145 gbvrl322.seq
499997431 gbvrl323.seq
499999910 gbvrl324.seq
276718100 gbvrl325.seq
499962348 gbvrl326.seq
499993607 gbvrl327.seq
499993733 gbvrl328.seq
499981063 gbvrl329.seq
499998246 gbvrl33.seq
52572525 gbvrl330.seq
499984503 gbvrl331.seq
499977083 gbvrl332.seq
499987313 gbvrl333.seq
400921695 gbvrl334.seq
499965920 gbvrl335.seq
499974118 gbvrl336.seq
499974403 gbvrl337.seq
354399856 gbvrl338.seq
499975084 gbvrl339.seq
419826574 gbvrl34.seq
499977309 gbvrl340.seq
499974395 gbvrl341.seq
244521075 gbvrl342.seq
499969047 gbvrl343.seq
499998527 gbvrl344.seq
499963466 gbvrl345.seq
499983918 gbvrl346.seq
22842810 gbvrl347.seq
499962138 gbvrl348.seq
499990798 gbvrl349.seq
499992530 gbvrl35.seq
499977542 gbvrl350.seq
499986852 gbvrl351.seq
117796084 gbvrl352.seq
499984111 gbvrl353.seq
499990572 gbvrl354.seq
499986315 gbvrl355.seq
136842513 gbvrl356.seq
499960910 gbvrl357.seq
499963640 gbvrl358.seq
499986410 gbvrl359.seq
499993964 gbvrl36.seq
454678599 gbvrl360.seq
499963695 gbvrl361.seq
499975942 gbvrl362.seq
499976716 gbvrl363.seq
499989681 gbvrl364.seq
131902282 gbvrl365.seq
499966715 gbvrl366.seq
499969862 gbvrl367.seq
499965635 gbvrl368.seq
231328788 gbvrl369.seq
414962684 gbvrl37.seq
499967096 gbvrl370.seq
499996020 gbvrl371.seq
499973475 gbvrl372.seq
499991213 gbvrl373.seq
499999340 gbvrl374.seq
169210264 gbvrl375.seq
499999840 gbvrl38.seq
499991255 gbvrl39.seq
499997494 gbvrl4.seq
499995188 gbvrl40.seq
298714970 gbvrl41.seq
499936686 gbvrl42.seq
499996157 gbvrl43.seq
499987296 gbvrl44.seq
269548290 gbvrl45.seq
499984137 gbvrl46.seq
499998943 gbvrl47.seq
499940744 gbvrl48.seq
275939302 gbvrl49.seq
499999396 gbvrl5.seq
499996233 gbvrl50.seq
499993290 gbvrl51.seq
499934632 gbvrl52.seq
251912250 gbvrl53.seq
499941899 gbvrl54.seq
499954090 gbvrl55.seq
499984288 gbvrl56.seq
499979612 gbvrl57.seq
176857546 gbvrl58.seq
499972915 gbvrl59.seq
499998092 gbvrl6.seq
499984837 gbvrl60.seq
499990309 gbvrl61.seq
499944147 gbvrl62.seq
150433330 gbvrl63.seq
499997121 gbvrl64.seq
499956285 gbvrl65.seq
499997994 gbvrl66.seq
499998737 gbvrl67.seq
148187597 gbvrl68.seq
499986609 gbvrl69.seq
499982131 gbvrl7.seq
499971145 gbvrl70.seq
499948166 gbvrl71.seq
404497069 gbvrl72.seq
499934522 gbvrl73.seq
499971105 gbvrl74.seq
499949505 gbvrl75.seq
352443431 gbvrl76.seq
499981928 gbvrl77.seq
499939580 gbvrl78.seq
499977454 gbvrl79.seq
301488775 gbvrl8.seq
307756299 gbvrl80.seq
499965353 gbvrl81.seq
499962230 gbvrl82.seq
499981049 gbvrl83.seq
41227290 gbvrl84.seq
499974318 gbvrl85.seq
499962896 gbvrl86.seq
499972185 gbvrl87.seq
184848748 gbvrl88.seq
499986169 gbvrl89.seq
499998102 gbvrl9.seq
499941886 gbvrl90.seq
499934721 gbvrl91.seq
175000247 gbvrl92.seq
499977099 gbvrl93.seq
499975342 gbvrl94.seq
499961511 gbvrl95.seq
219017864 gbvrl96.seq
499951171 gbvrl97.seq
499963371 gbvrl98.seq
499960166 gbvrl99.seq
499953136 gbvrt1.seq
289935612 gbvrt10.seq
1063697373 gbvrt100.seq
1045817456 gbvrt101.seq
754876698 gbvrt102.seq
616753988 gbvrt103.seq
490283916 gbvrt104.seq
470651151 gbvrt105.seq
397152890 gbvrt106.seq
351566814 gbvrt107.seq
339881554 gbvrt108.seq
404716166 gbvrt109.seq
87348314 gbvrt11.seq
489465929 gbvrt110.seq
499108511 gbvrt111.seq
486719349 gbvrt112.seq
58362562 gbvrt113.seq
436489699 gbvrt114.seq
486735687 gbvrt115.seq
492786702 gbvrt116.seq
424170309 gbvrt117.seq
281367593 gbvrt118.seq
478264522 gbvrt119.seq
499776413 gbvrt12.seq
485840122 gbvrt120.seq
493662272 gbvrt121.seq
75046811 gbvrt122.seq
979125221 gbvrt123.seq
838606764 gbvrt124.seq
678362247 gbvrt125.seq
476490051 gbvrt126.seq
461393141 gbvrt127.seq
438814149 gbvrt128.seq
394334276 gbvrt129.seq
284656236 gbvrt13.seq
313818221 gbvrt130.seq
288999697 gbvrt131.seq
280186115 gbvrt132.seq
407765043 gbvrt133.seq
421856869 gbvrt134.seq
478932645 gbvrt135.seq
480028007 gbvrt136.seq
438022009 gbvrt137.seq
174441466 gbvrt138.seq
487902327 gbvrt139.seq
15637437 gbvrt14.seq
456814552 gbvrt140.seq
462308829 gbvrt141.seq
168813991 gbvrt142.seq
455915969 gbvrt143.seq
469542169 gbvrt144.seq
479148432 gbvrt145.seq
211438035 gbvrt146.seq
481255007 gbvrt147.seq
475910668 gbvrt148.seq
366785231 gbvrt149.seq
36032850 gbvrt15.seq
464881586 gbvrt150.seq
474452025 gbvrt151.seq
234874130 gbvrt152.seq
697335450 gbvrt153.seq
670835803 gbvrt154.seq
524090553 gbvrt155.seq
413420126 gbvrt156.seq
345317144 gbvrt157.seq
329841089 gbvrt158.seq
250750417 gbvrt159.seq
18507952 gbvrt16.seq
486600390 gbvrt160.seq
364885711 gbvrt161.seq
448395879 gbvrt162.seq
471877569 gbvrt163.seq
393642536 gbvrt164.seq
355134416 gbvrt165.seq
470602746 gbvrt166.seq
448657488 gbvrt167.seq
384724558 gbvrt168.seq
432320923 gbvrt169.seq
497676663 gbvrt17.seq
471132362 gbvrt170.seq
497676594 gbvrt171.seq
207882210 gbvrt172.seq
397267013 gbvrt173.seq
366771863 gbvrt174.seq
351249970 gbvrt175.seq
309532358 gbvrt176.seq
296271444 gbvrt177.seq
286321426 gbvrt178.seq
268164730 gbvrt179.seq
497173924 gbvrt18.seq
253329800 gbvrt180.seq
494939336 gbvrt181.seq
424426418 gbvrt182.seq
410896883 gbvrt183.seq
369957025 gbvrt184.seq
169574120 gbvrt185.seq
426847158 gbvrt186.seq
496824508 gbvrt187.seq
434394791 gbvrt188.seq
494363156 gbvrt189.seq
481350583 gbvrt19.seq
61896426 gbvrt190.seq
431425246 gbvrt191.seq
474666330 gbvrt192.seq
479195821 gbvrt193.seq
352877651 gbvrt194.seq
479851070 gbvrt195.seq
497038176 gbvrt196.seq
432867963 gbvrt197.seq
439843808 gbvrt198.seq
469531790 gbvrt199.seq
499838315 gbvrt2.seq
400795564 gbvrt20.seq
496015817 gbvrt200.seq
488626307 gbvrt201.seq
432135676 gbvrt202.seq
70119528 gbvrt203.seq
491056051 gbvrt204.seq
328508705 gbvrt205.seq
497328806 gbvrt206.seq
499238966 gbvrt207.seq
187508760 gbvrt208.seq
490842556 gbvrt209.seq
488197715 gbvrt21.seq
463385772 gbvrt210.seq
446788975 gbvrt211.seq
438416202 gbvrt212.seq
170595769 gbvrt213.seq
451342688 gbvrt214.seq
474563355 gbvrt215.seq
461335548 gbvrt216.seq
436658187 gbvrt217.seq
154682616 gbvrt218.seq
456837606 gbvrt219.seq
479291185 gbvrt22.seq
488930196 gbvrt220.seq
466502331 gbvrt221.seq
455725140 gbvrt222.seq
453475816 gbvrt223.seq
462276007 gbvrt224.seq
497473221 gbvrt225.seq
499283767 gbvrt226.seq
481742871 gbvrt227.seq
54779872 gbvrt228.seq
477445338 gbvrt229.seq
480798341 gbvrt23.seq
495314515 gbvrt230.seq
486008997 gbvrt231.seq
489201368 gbvrt232.seq
499536480 gbvrt233.seq
347470388 gbvrt234.seq
1068402516 gbvrt235.seq
1067356333 gbvrt236.seq
896844819 gbvrt237.seq
805318347 gbvrt238.seq
718662677 gbvrt239.seq
499274554 gbvrt24.seq
556944666 gbvrt240.seq
299728838 gbvrt241.seq
293507186 gbvrt242.seq
484357811 gbvrt243.seq
130768604 gbvrt244.seq
874873715 gbvrt245.seq
685858825 gbvrt246.seq
627564227 gbvrt247.seq
610271897 gbvrt248.seq
543871783 gbvrt249.seq
483255170 gbvrt25.seq
284797667 gbvrt250.seq
269299175 gbvrt251.seq
474717664 gbvrt252.seq
402979396 gbvrt253.seq
343325815 gbvrt254.seq
450550965 gbvrt255.seq
494368803 gbvrt256.seq
470716411 gbvrt257.seq
470514883 gbvrt258.seq
229630839 gbvrt259.seq
484153821 gbvrt26.seq
499998197 gbvrt260.seq
499998993 gbvrt261.seq
474776513 gbvrt262.seq
494963931 gbvrt263.seq
485274977 gbvrt264.seq
474231618 gbvrt265.seq
490948606 gbvrt266.seq
332441302 gbvrt267.seq
477156039 gbvrt268.seq
499226352 gbvrt269.seq
65325604 gbvrt27.seq
477696169 gbvrt270.seq
353039605 gbvrt271.seq
438196164 gbvrt272.seq
489809255 gbvrt273.seq
460938782 gbvrt274.seq
476280761 gbvrt275.seq
497596868 gbvrt276.seq
443693971 gbvrt277.seq
437233554 gbvrt28.seq
488520688 gbvrt29.seq
466371162 gbvrt3.seq
456456384 gbvrt30.seq
341830592 gbvrt31.seq
14151693 gbvrt32.seq
21383246 gbvrt33.seq
90967413 gbvrt34.seq
499908979 gbvrt35.seq
499997057 gbvrt36.seq
499999728 gbvrt37.seq
55655694 gbvrt38.seq
499997255 gbvrt39.seq
179100370 gbvrt4.seq
269768476 gbvrt40.seq
385151455 gbvrt41.seq
490595601 gbvrt42.seq
386502843 gbvrt43.seq
499998933 gbvrt44.seq
118920744 gbvrt45.seq
499998724 gbvrt46.seq
444774179 gbvrt47.seq
500000122 gbvrt48.seq
28726185 gbvrt49.seq
448778544 gbvrt5.seq
444169093 gbvrt50.seq
499998149 gbvrt51.seq
388059821 gbvrt52.seq
499998596 gbvrt53.seq
279896965 gbvrt54.seq
499999654 gbvrt55.seq
499452044 gbvrt56.seq
497917356 gbvrt57.seq
490184966 gbvrt58.seq
483022576 gbvrt59.seq
490703641 gbvrt6.seq
450977918 gbvrt60.seq
202128841 gbvrt61.seq
123737443 gbvrt62.seq
483315203 gbvrt63.seq
481925504 gbvrt64.seq
499999199 gbvrt65.seq
499926681 gbvrt66.seq
296494910 gbvrt67.seq
492181094 gbvrt68.seq
492375887 gbvrt69.seq
499120716 gbvrt7.seq
479677491 gbvrt70.seq
480814553 gbvrt71.seq
362168611 gbvrt72.seq
490950275 gbvrt73.seq
475405574 gbvrt74.seq
489430322 gbvrt75.seq
352376975 gbvrt76.seq
465372186 gbvrt77.seq
488788789 gbvrt78.seq
189348250 gbvrt79.seq
483670759 gbvrt8.seq
451948482 gbvrt80.seq
443703248 gbvrt81.seq
400719178 gbvrt82.seq
427517644 gbvrt83.seq
319264824 gbvrt84.seq
275756309 gbvrt85.seq
252640763 gbvrt86.seq
251496345 gbvrt87.seq
466369516 gbvrt88.seq
418722220 gbvrt89.seq
263689236 gbvrt9.seq
186091498 gbvrt90.seq
404212770 gbvrt91.seq
481131817 gbvrt92.seq
474827267 gbvrt93.seq
480710662 gbvrt94.seq
89576280 gbvrt95.seq
435880706 gbvrt96.seq
487966705 gbvrt97.seq
497561523 gbvrt98.seq
468911614 gbvrt99.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 101755 185776336
BCT10 101 247874669
BCT100 118 229172914
BCT101 127 232212861
BCT102 90 178403076
BCT103 114 212138354
BCT104 75 222053892
BCT105 112 225347102
BCT106 124 217786851
BCT107 3 5977905
BCT108 246 222256023
BCT109 104 221252195
BCT11 145 242443173
BCT110 100 224644129
BCT111 83 222703364
BCT112 21 86233168
BCT113 68 221578114
BCT114 87 219795809
BCT115 87 223588406
BCT116 80 226303150
BCT117 20 45564131
BCT118 124 217933644
BCT119 53 217706139
BCT12 167 262397135
BCT120 90 227492926
BCT121 57 149506400
BCT122 94 223837173
BCT123 73 221711999
BCT124 113 222996943
BCT125 78 197436829
BCT126 156 218173209
BCT127 84 220629983
BCT128 79 216070642
BCT129 141 228566924
BCT13 6 12749856
BCT130 106 221256144
BCT131 80 221199213
BCT132 92 196245950
BCT133 115 225967887
BCT134 92 220409897
BCT135 158 214217907
BCT136 88 207032597
BCT137 140 220978157
BCT138 63 217844098
BCT139 90 215013764
BCT14 170 237845538
BCT140 125 217101319
BCT141 88 223616604
BCT142 21 65066945
BCT143 174 220602790
BCT144 128 221993348
BCT145 118 216449560
BCT146 170 220678956
BCT147 54 177570665
BCT148 104 218683705
BCT149 113 217389079
BCT15 151 240481452
BCT150 138 222247056
BCT151 109 220993944
BCT152 101 223667628
BCT153 118 156232056
BCT154 95 229134325
BCT155 104 222093509
BCT156 97 225362965
BCT157 116 220401677
BCT158 94 219188969
BCT159 134 220654115
BCT16 199 252481270
BCT160 36 70525291
BCT161 169 220902025
BCT162 100 223727909
BCT163 94 222167747
BCT164 94 214484227
BCT165 71 223304376
BCT166 123 228309968
BCT167 150 228808455
BCT168 80 212893326
BCT169 100 233591727
BCT17 206 229336468
BCT170 96 224405035
BCT171 134 223606319
BCT172 84 220867011
BCT173 24 84218657
BCT174 119 222185746
BCT175 151 231715107
BCT176 72 216080650
BCT177 81 120955479
BCT178 111 216184725
BCT179 156 227708035
BCT18 2 4770723
BCT180 111 220250972
BCT181 89 136614524
BCT182 133 229717687
BCT183 111 208992481
BCT184 108 219925553
BCT185 77 222877345
BCT186 18 29103391
BCT187 98 220152536
BCT188 133 227333368
BCT189 125 230906352
BCT19 136 236547259
BCT190 118 245874590
BCT191 114 233627230
BCT192 32 86501281
BCT193 131 216438017
BCT194 93 226438829
BCT195 108 224087651
BCT196 116 221458112
BCT197 65 122261042
BCT198 127 225144984
BCT199 137 258852104
BCT2 107 227274960
BCT20 113 230295403
BCT200 100 226683783
BCT201 158 215934234
BCT202 69 111557509
BCT203 123 222422665
BCT204 115 218469346
BCT205 89 219209021
BCT206 102 224188280
BCT207 104 209481600
BCT208 97 234475408
BCT209 102 220656832
BCT21 140 223708984
BCT210 100 218053674
BCT211 94 224743372
BCT212 104 226992367
BCT213 107 231904945
BCT214 70 148112573
BCT215 104 221826114
BCT216 108 221051727
BCT217 98 226007841
BCT218 76 270744187
BCT219 75 254647899
BCT22 200 220359484
BCT220 106 225376718
BCT221 176 219971681
BCT222 132 226738257
BCT223 55 106489903
BCT224 324 275336670
BCT225 116 218712797
BCT226 118 218047051
BCT227 45 74298835
BCT228 89 220099828
BCT229 86 226600378
BCT23 24 29385563
BCT230 83 233332678
BCT231 103 224217713
BCT232 24 60324544
BCT233 60 216868170
BCT234 120 221119124
BCT235 86 223426276
BCT236 85 217995381
BCT237 30 67668948
BCT238 157 275025230
BCT239 87 234185848
BCT24 174 220036188
BCT240 96 219765338
BCT241 135 191926241
BCT242 109 262921422
BCT243 72 217635148
BCT244 100 214909619
BCT245 76 205489624
BCT246 143 306547296
BCT247 72 239204396
BCT248 88 216728836
BCT249 132 223474256
BCT25 157 217996559
BCT250 142 267934611
BCT251 46 90275869
BCT252 146 273570514
BCT253 109 252612009
BCT254 35 229012536
BCT255 56 209847636
BCT256 110 218761905
BCT257 130 219578217
BCT258 90 250893937
BCT259 80 203207828
BCT26 52 221902715
BCT260 124 215159011
BCT261 113 223367533
BCT262 144 228597181
BCT263 114 228439247
BCT264 114 231113225
BCT265 120 228230620
BCT266 26 74228471
BCT267 106 218843831
BCT268 82 215186387
BCT269 87 232931079
BCT27 105 237356821
BCT270 98 219566714
BCT271 13 10410673
BCT272 93 235647841
BCT273 104 235928514
BCT274 69 223063860
BCT275 99 208185886
BCT276 119 217748117
BCT277 165 223745463
BCT278 161 212763762
BCT279 133 231781514
BCT28 53 100436723
BCT280 100 227626264
BCT281 123 231590590
BCT282 160 251320587
BCT283 101 227802166
BCT284 122 221777912
BCT285 112 212578426
BCT286 96 229032785
BCT287 123 222518405
BCT288 174 224603753
BCT289 146 214297168
BCT29 81 239594577
BCT290 66 116580172
BCT291 130 226536352
BCT292 105 224013789
BCT293 83 219368049
BCT294 81 216493682
BCT295 103 168153425
BCT296 88 244048892
BCT297 107 228886299
BCT298 83 221517737
BCT299 61 216100377
BCT3 37541 123332243
BCT30 100 222853857
BCT300 75 170636859
BCT301 115 219540003
BCT302 101 218974130
BCT303 124 216924787
BCT304 90 217527347
BCT305 140 185056878
BCT306 124 248813935
BCT307 110 222498371
BCT308 81 224631234
BCT309 61 221300332
BCT31 96 226432790
BCT310 88 179376157
BCT311 128 238885544
BCT312 197 234044756
BCT313 149 219659340
BCT314 120 215711231
BCT315 119 190631862
BCT316 141 246427155
BCT317 167 279237902
BCT318 170 216918027
BCT319 131 219454695
BCT32 129 224597211
BCT320 15 110010139
BCT321 72 228738867
BCT322 128 242193459
BCT323 1242 223734795
BCT324 115 224896454
BCT325 72 181783799
BCT326 101 222185425
BCT327 126 217279454
BCT328 105 212886231
BCT329 130 222884236
BCT33 87 223628495
BCT330 233 231488171
BCT331 188 221578382
BCT332 115 220062307
BCT333 41 85434399
BCT334 123 216507866
BCT335 144 220140457
BCT336 146 218600953
BCT337 124 227417343
BCT338 149 234265173
BCT339 91 238304642
BCT34 112 237222831
BCT340 45 86498994
BCT341 111 224832352
BCT342 159 234833925
BCT343 118 225344370
BCT344 134 231232559
BCT345 61 155047624
BCT346 125 234008897
BCT347 122 226223828
BCT348 77 220312740
BCT349 84 219810323
BCT35 79 218851207
BCT350 55 217536973
BCT351 50 220946014
BCT352 173 224610961
BCT353 3 2825298
BCT354 195 229604129
BCT355 130 250400642
BCT356 142 222978469
BCT357 212 224523784
BCT358 28 60552651
BCT359 94 242189407
BCT36 164 223048523
BCT360 110 247993139
BCT361 46 215287487
BCT362 53 215300620
BCT363 16 60029943
BCT364 92 217200838
BCT365 90 231500758
BCT366 117 246538204
BCT367 203 232314981
BCT368 92 220627220
BCT369 120 214832865
BCT37 532 205551953
BCT370 22 48955354
BCT371 166 261984346
BCT372 180 236857563
BCT373 477 233890189
BCT374 139 234982226
BCT375 148 240643544
BCT376 96 230627278
BCT377 77 123809930
BCT378 110 230934388
BCT379 85 220353169
BCT38 5200 7533877
BCT380 92 218533698
BCT381 104 232991105
BCT382 162 222657737
BCT383 42 76520643
BCT384 88 219801256
BCT385 100 226032023
BCT386 156 310068527
BCT387 112 248255848
BCT388 98 283687676
BCT389 79 182479910
BCT39 10402 13141863
BCT390 114 227850421
BCT391 146 217630758
BCT392 105 227003732
BCT393 148 223405170
BCT394 120 225492649
BCT395 113 228628833
BCT396 86 105656974
BCT397 105 226068926
BCT398 143 223058556
BCT399 113 234518747
BCT4 41293 139254430
BCT40 53922 202025650
BCT400 177 218440412
BCT401 29 61315594
BCT402 129 231508633
BCT403 143 217992395
BCT404 140 221014593
BCT405 109 225377333
BCT406 60 159790523
BCT407 108 234695862
BCT408 138 240972634
BCT409 91 305006086
BCT41 185 214548596
BCT410 97 213066701
BCT411 67 99800639
BCT412 120 221718706
BCT413 121 216687071
BCT414 87 221343640
BCT415 93 259722290
BCT416 30 68667546
BCT417 121 215033983
BCT418 119 228238463
BCT419 118 214080125
BCT42 104 232516945
BCT420 111 222440492
BCT421 8 14459449
BCT422 144 219919128
BCT423 107 252494589
BCT424 165 214214629
BCT425 157 206720897
BCT426 238 214458452
BCT427 127 213318904
BCT428 102 217958513
BCT429 111 255569279
BCT43 116 205561869
BCT430 135 256991516
BCT431 47 110554099
BCT432 101 235232040
BCT433 128 234585657
BCT434 116 218121724
BCT435 114 229642984
BCT436 91 181627435
BCT437 154 213693155
BCT438 111 221269896
BCT439 152 220120956
BCT44 103 222777517
BCT440 97 225592274
BCT441 103 221184160
BCT442 302 214942895
BCT443 13 11235012
BCT444 364 210657095
BCT445 110 214726128
BCT446 142 213119125
BCT447 158 217105943
BCT448 168 218983591
BCT449 174 208501241
BCT45 131 222293417
BCT450 24 45926834
BCT451 161 208257957
BCT452 162 212193463
BCT453 114 210605338
BCT454 157 213126972
BCT455 132 209356669
BCT456 131 195243107
BCT457 183 210687290
BCT458 116 210811583
BCT459 136 211510245
BCT46 123 223122738
BCT460 161 217802986
BCT461 33 52695846
BCT462 168 242619762
BCT463 120 224618414
BCT464 137 225114532
BCT465 108 228056033
BCT466 130 222038116
BCT467 135 226318248
BCT468 136 116206201
BCT469 107 232838404
BCT47 150 224035996
BCT470 101 219419825
BCT471 89 227873694
BCT472 93 227716613
BCT473 104 285959088
BCT474 113 224770003
BCT475 1 3039501
BCT476 124 230097780
BCT477 119 217641315
BCT478 125 220337202
BCT479 188 223112133
BCT48 157 222523995
BCT480 138 226588520
BCT481 74 139461444
BCT482 107 258561528
BCT483 89 212143620
BCT484 158 216707113
BCT485 140 217074444
BCT486 103 225282290
BCT487 132 221285131
BCT488 55 76373529
BCT489 153 246886803
BCT49 103 120901509
BCT490 125 324156894
BCT491 123 246022338
BCT492 194 241856809
BCT493 98 231471692
BCT494 53 151032801
BCT495 99 221181511
BCT496 77 214541590
BCT497 109 234374705
BCT498 126 220074155
BCT499 121 216906928
BCT5 20648 169648440
BCT50 255 227294457
BCT500 68 71301239
BCT501 131 215005041
BCT502 121 220809665
BCT503 138 227841328
BCT504 221 225805718
BCT505 166 144980074
BCT506 133 226910571
BCT507 116 212440150
BCT508 146 244216301
BCT509 134 220559267
BCT51 97 225049518
BCT510 111 220885611
BCT511 147 187909205
BCT512 127 222414510
BCT513 177 214900913
BCT514 140 229675886
BCT515 109 218884211
BCT516 100 135717571
BCT517 148 251704567
BCT518 174 237850274
BCT519 191 210225765
BCT52 105 223456641
BCT520 121 249972207
BCT521 54 192306540
BCT522 124 232858776
BCT523 146 226121334
BCT524 124 228321158
BCT525 97 217908717
BCT526 85 195077841
BCT527 115 216604435
BCT528 119 225008835
BCT529 103 216948181
BCT53 130 225426913
BCT530 117 227156732
BCT531 80 220660553
BCT532 129 227385316
BCT533 160 222067990
BCT534 159 221685726
BCT535 137 221389912
BCT536 126 218500440
BCT537 113 239088222
BCT538 153 228675433
BCT539 151 215312891
BCT54 133 219722042
BCT540 88 223523097
BCT541 166 212067501
BCT542 115 215447043
BCT543 61 208737714
BCT544 60 209982617
BCT545 85 227478197
BCT546 64 199854429
BCT547 73 210314457
BCT548 71 211048635
BCT549 151 222584775
BCT55 107 149028776
BCT550 139 261641589
BCT551 205 240483392
BCT552 54 143268788
BCT553 106 223564250
BCT554 109 221738149
BCT555 119 213187912
BCT556 73 216089179
BCT557 111 135876944
BCT558 121 238759328
BCT559 129 224537672
BCT56 136 223054995
BCT560 127 217814507
BCT561 119 266272178
BCT562 103 388584999
BCT563 88 227677607
BCT564 91 317300604
BCT565 194 223597024
BCT566 119 221819730
BCT567 149 276502385
BCT568 59 56831837
BCT569 108 221474500
BCT57 112 217399067
BCT570 79 225880480
BCT571 180 272624619
BCT572 92 235388308
BCT573 287 220056755
BCT574 121 213230170
BCT575 14 30830533
BCT576 155 259162747
BCT577 119 223811119
BCT578 144 211071910
BCT579 130 210174400
BCT58 131 223635367
BCT580 39 55390545
BCT581 120 211093125
BCT582 123 212731133
BCT583 199 213135589
BCT584 155 223098306
BCT585 169 215938894
BCT586 17 43381733
BCT587 182 228831309
BCT588 121 232279181
BCT589 132 223270245
BCT59 121 221481204
BCT590 116 222726208
BCT591 31 49944878
BCT592 134 210260272
BCT593 181 239594051
BCT594 98 215193160
BCT595 48 211643751
BCT596 9 15566569
BCT597 102 212230252
BCT598 98 212747217
BCT599 86 215225823
BCT6 2600 37759883
BCT60 138 232661918
BCT600 94 245033389
BCT601 10 28861878
BCT602 139 223909880
BCT603 316 211118911
BCT604 93 229974245
BCT605 90 220150066
BCT606 45 125580003
BCT607 111 223842225
BCT608 148 211085348
BCT609 127 210728553
BCT61 108 225781339
BCT610 143 206521634
BCT611 138 215033366
BCT612 114 149068377
BCT613 528 115589384
BCT614 1589 2511957
BCT615 3172 5268484
BCT616 6338 7796395
BCT617 12613 14997690
BCT618 25523 27672494
BCT619 50566 54072396
BCT62 38 50860113
BCT620 148864 156705080
BCT621 14219 193528085
BCT622 3297 203942569
BCT623 2509 213411401
BCT624 7215 212675624
BCT625 164 249069009
BCT626 39928 39703867
BCT627 75102 180239641
BCT628 11057 202910557
BCT629 6079 198788687
BCT63 94 229475332
BCT630 97387 180456180
BCT631 63918 70589904
BCT632 149185 156905313
BCT633 84517 88080422
BCT634 144584 151086417
BCT635 25894 25557033
BCT636 132569 167518864
BCT637 31496 43702397
BCT638 116174 178749610
BCT639 7905 17300263
BCT64 117 227983621
BCT640 32958 53337698
BCT641 30892 249205870
BCT642 6368 291344221
BCT643 5035 225442726
BCT644 3847 224092509
BCT645 1442 273316652
BCT646 109 222593498
BCT647 55 216844860
BCT648 70 213822191
BCT649 34 137765382
BCT65 160 232898310
BCT650 69 224394912
BCT651 364 238323955
BCT652 889 289911825
BCT653 316 85816731
BCT654 1274 198668008
BCT655 333 211837174
BCT656 514 379401000
BCT657 883 314043216
BCT658 262 70200635
BCT659 3569 247581755
BCT66 154 221704284
BCT660 322 301468663
BCT661 334 391121871
BCT662 277 260588329
BCT663 362 393266490
BCT664 364 392445913
BCT665 2140 260288424
BCT666 63 145106063
BCT667 86 222746849
BCT668 78 227354684
BCT669 3023 245927078
BCT67 128 238275556
BCT670 1230 124242115
BCT671 1412 261424764
BCT672 47 241352896
BCT673 45 243003094
BCT674 2180 269716913
BCT675 945 54278114
BCT676 2288 268994823
BCT677 83 274582043
BCT678 422 283036369
BCT679 3015 248690235
BCT68 114 230664549
BCT680 11940 19905115
BCT681 25214 42009550
BCT682 118419 188773431
BCT683 115811 191204701
BCT684 79517 138823668
BCT685 102167 196089335
BCT686 113483 208563805
BCT687 12853 282203492
BCT688 11828 22146794
BCT69 54 123393656
BCT7 1310 133308362
BCT70 300 239582260
BCT71 142 231562727
BCT72 354 225466658
BCT73 111 222896198
BCT74 121 213352666
BCT75 120 227473574
BCT76 98 224926366
BCT77 90 224039666
BCT78 98 225070223
BCT79 58 138528232
BCT8 191 234251938
BCT80 53 211054879
BCT81 45 210584326
BCT82 45 210864282
BCT83 45 212727898
BCT84 76 222861078
BCT85 40 115080869
BCT86 112 227959956
BCT87 129 231316827
BCT88 99 245428056
BCT89 87 223381451
BCT9 133 236750743
BCT90 59 181990919
BCT91 93 237302287
BCT92 103 223843089
BCT93 62 225168570
BCT94 64 140507059
BCT95 97 233623581
BCT96 82 229505918
BCT97 100 238937572
BCT98 24 34605217
BCT99 94 226656782
ENV1 189982 141874265
ENV10 173855 166589843
ENV11 65213 34655833
ENV12 218986 102584580
ENV13 176384 159892020
ENV14 19547 17057460
ENV15 204700 124201887
ENV16 186255 146035020
ENV17 209745 130993068
ENV18 179486 146067073
ENV19 1415 1898084
ENV2 148971 161139594
ENV20 155448 156524394
ENV21 250294 68810308
ENV22 87168 20074006
ENV23 220965 118700470
ENV24 255777 108832989
ENV25 205134 126617565
ENV26 26930 25481171
ENV27 152293 158746214
ENV28 201147 103381957
ENV29 68254 51342584
ENV3 65987 142821091
ENV30 213318 108924480
ENV31 170956 153785998
ENV32 135008 163683922
ENV33 11532 15711524
ENV34 179950 128304632
ENV35 218057 118479883
ENV36 78482 41729198
ENV37 143993 98017210
ENV38 100657 112290439
ENV39 130550 80387732
ENV4 124 288213636
ENV40 173942 138869886
ENV41 163506 139637537
ENV42 179624 114231226
ENV43 200986 107353842
ENV44 196375 109569349
ENV45 111545 97796771
ENV46 158066 134829296
ENV47 145098 136814785
ENV48 169098 47789387
ENV49 172196 133125957
ENV5 83 221317267
ENV50 211020 100433902
ENV51 142308 62179102
ENV52 216483 84261105
ENV53 212752 92644509
ENV54 108059 43423495
ENV55 224310 98787879
ENV56 224820 91761971
ENV57 142869 92450995
ENV58 198721 110748728
ENV59 182641 90460397
ENV6 97 218466622
ENV60 192130 114104534
ENV61 32634 21034577
ENV62 129142 185728154
ENV63 224079 135799121
ENV64 231214 95377034
ENV65 76690 34633236
ENV66 194774 111983942
ENV67 125738 173623962
ENV68 66716 228825645
ENV69 115227 150585292
ENV7 63 204534087
ENV70 43940 42498219
ENV8 76 217162029
ENV9 88 228545332
EST1 152690 59075604
EST10 155841 67142647
EST100 152899 76533320
EST101 145118 99319879
EST102 145153 85348913
EST103 148976 93026423
EST104 7202 4208037
EST105 149683 109460875
EST106 135200 99322475
EST107 136257 97452494
EST108 136284 94853959
EST109 2297 1519204
EST11 163596 69202196
EST110 136920 77327965
EST111 176687 106050647
EST112 194369 119409911
EST113 236609 141475405
EST114 6067 3721593
EST115 229453 127643708
EST116 182810 103717899
EST117 191453 94556126
EST118 2649 2084299
EST119 148549 100251847
EST12 150682 64736779
EST120 154735 119130159
EST121 166270 97893382
EST122 22076 15469633
EST123 130039 82535239
EST124 83544 30919856
EST125 36757 12481811
EST126 84106 31034635
EST127 84264 34515269
EST128 33711 11378339
EST129 85031 32709177
EST13 186775 83515461
EST130 82017 34968192
EST131 83454 35266094
EST132 84118 32965334
EST133 14468 5903340
EST134 83460 51063090
EST135 173481 87480434
EST136 170378 77656565
EST137 146503 92405772
EST138 28666 18158607
EST139 141402 87644345
EST14 104666 47796016
EST140 149169 98038750
EST141 157781 78491749
EST142 180947 92630877
EST143 7809 4568886
EST144 141652 76089203
EST145 151600 73212463
EST146 148400 87046443
EST147 155872 83630976
EST148 11550 6810689
EST149 166186 102136895
EST15 197334 111632923
EST150 202211 107329025
EST151 158885 93296243
EST152 102216 51071043
EST153 156473 79478757
EST154 135311 80239330
EST155 141446 88012873
EST156 166518 86082889
EST157 7780 4492262
EST158 179041 104197304
EST159 218733 94431044
EST16 147209 104729060
EST160 145808 85870166
EST161 161419 87629009
EST162 2881 1405734
EST163 140904 82600306
EST164 133037 84115331
EST165 147197 88183849
EST166 146344 80519535
EST167 20047 10151922
EST168 117769 61073260
EST169 115690 61941713
EST17 156572 83431034
EST170 122419 54128062
EST171 121107 48630686
EST172 29423 11431564
EST173 122215 48678047
EST174 125703 48478095
EST175 165762 83297665
EST176 172200 75566620
EST177 24701 15540946
EST178 147743 104364925
EST179 163429 99358064
EST18 191133 116914855
EST180 205284 116217156
EST181 167204 93396394
EST182 154071 103341968
EST183 134240 92949965
EST184 10672 5956502
EST185 146642 94153416
EST186 155031 80976156
EST187 132039 71141342
EST188 160889 90606816
EST189 13157 8318140
EST19 177385 113034633
EST190 148885 87668246
EST191 153770 95507815
EST192 175569 99208167
EST193 140565 77269449
EST194 4787 3937199
EST195 124049 64324468
EST196 162986 91001193
EST197 172959 99449352
EST198 149725 92920886
EST199 5972 3763796
EST2 157294 60515133
EST20 70833 55594967
EST200 165077 79250588
EST201 122391 84352364
EST202 163499 96411266
EST203 163942 96037285
EST204 13937 6668670
EST205 5847 2580354
EST206 111210 63109502
EST207 151258 87141554
EST208 107046 63442451
EST209 164567 100983680
EST21 194467 109200353
EST210 168503 124867991
EST211 82159 66786101
EST212 186522 95181519
EST213 145766 90574874
EST214 86781 65214858
EST215 141936 85229954
EST216 137996 75168597
EST217 95484 30656388
EST218 146951 86298614
EST219 149234 82714699
EST22 179940 92457377
EST220 141191 94332052
EST221 156023 90298582
EST222 8574 6134787
EST223 162088 99653428
EST224 153953 93687394
EST225 123359 88331915
EST226 145963 90179428
EST227 6829 4133477
EST228 128898 82067873
EST229 127965 89748598
EST23 107170 50424590
EST230 44286 31824886
EST231 156430 83332027
EST232 167399 92029681
EST233 166930 92691512
EST234 158124 88082424
EST235 163896 91508682
EST236 163228 92242200
EST237 166033 91294921
EST238 154891 85088026
EST239 168030 90687163
EST24 191019 61404489
EST240 187909 98489047
EST241 191634 107203138
EST242 168058 100162600
EST243 180324 103395206
EST244 190067 112774100
EST245 186271 113269841
EST246 177969 115370580
EST247 6823 5405260
EST248 140678 86230531
EST249 212622 138844321
EST25 136507 39208104
EST250 226925 111316658
EST251 164069 113913134
EST252 183146 95756964
EST253 198080 98535367
EST254 122995 89266798
EST255 7420 5143960
EST256 140264 82389170
EST257 206368 112807460
EST258 162380 106263195
EST259 93796 92617953
EST26 102352 27614927
EST260 15103 19661197
EST261 147677 99225559
EST262 150845 89791238
EST263 139060 101685483
EST264 216355 99358875
EST265 4529 2802996
EST266 133641 96440141
EST267 130218 90891668
EST268 135817 98456038
EST269 113498 81468042
EST27 201361 85182682
EST270 16334 10302901
EST271 136074 84237789
EST272 126197 86196946
EST273 128323 97050498
EST274 35670 25454263
EST275 126736 89458518
EST276 116536 79046724
EST277 139019 83785438
EST278 145795 114764182
EST279 15520 10975069
EST28 19773 8874629
EST280 125388 117381359
EST281 132658 98908640
EST282 162514 97700191
EST283 165607 104413716
EST284 18919 11863137
EST285 142285 92456214
EST286 169004 115153071
EST287 151628 103870677
EST288 136300 103171057
EST289 3411 2247987
EST29 203774 100081169
EST290 159541 97224651
EST291 222465 90720377
EST292 152865 111339324
EST293 160396 71799076
EST294 10553 1193300
EST295 208919 37982085
EST296 212168 83253851
EST297 150194 115334993
EST298 168070 97736830
EST299 154876 103183719
EST3 156026 54734733
EST30 216496 109027723
EST300 169010 109940649
EST301 149577 109937373
EST302 2047 1383922
EST303 180827 102281924
EST304 178602 93097581
EST305 168947 109496172
EST306 158905 104112356
EST307 2301 1836837
EST308 226903 106725089
EST309 267054 116129355
EST31 154021 67128068
EST310 184680 111793289
EST311 150001 28271688
EST312 229940 100512738
EST313 174951 100179676
EST314 156364 99977355
EST315 158624 94456753
EST316 166394 114093378
EST317 179942 95197248
EST318 143687 97189386
EST319 188156 110324042
EST32 149408 63700868
EST320 187330 49206581
EST321 201871 33888691
EST322 174430 95507560
EST323 14499 9114509
EST324 158346 113326097
EST325 184784 110470367
EST326 167585 97771317
EST327 165651 109621930
EST328 165922 71417216
EST329 127843 80161184
EST33 165215 65707574
EST330 121728 80853125
EST331 146532 101245025
EST332 21820 7774986
EST333 250640 26635193
EST334 254708 23392102
EST335 151991 94206454
EST336 152235 98594976
EST337 151209 99840551
EST338 145953 92202538
EST339 237888 43423594
EST34 147091 64543076
EST340 185289 81055476
EST341 3831 4735967
EST342 168933 99821815
EST343 163873 101087370
EST344 145612 92727124
EST345 189485 103146623
EST346 156145 109738093
EST347 153432 101614360
EST348 2288 864923
EST349 184471 108452053
EST35 162685 70898185
EST350 169884 94645155
EST351 169244 105166617
EST352 178324 59608381
EST353 195038 71941256
EST354 194528 75305704
EST355 197065 74426894
EST356 135405 70508640
EST357 174807 127367579
EST358 148414 85118544
EST359 150556 86650597
EST36 160539 65861740
EST360 121467 94921597
EST361 5845 4638473
EST362 142908 94503918
EST363 155404 94371977
EST364 162321 90297561
EST365 157495 100342924
EST366 22567 9986532
EST367 45656 24624838
EST368 155308 104544223
EST369 138149 97255037
EST37 107944 33683544
EST370 158633 102056658
EST371 152663 109858372
EST372 29680 25288248
EST373 173564 146756127
EST374 163564 85431758
EST375 127677 80996734
EST376 137841 94057317
EST377 51157 35811072
EST378 131619 88276056
EST379 137447 89871154
EST38 99513 30489629
EST380 139754 97233001
EST381 147706 97347466
EST382 49930 40332362
EST383 164182 86552371
EST384 143622 81415127
EST385 144915 86073821
EST386 144157 103713157
EST387 155646 93181756
EST388 137963 87470976
EST389 133431 84870432
EST39 99153 31399282
EST390 19448 11945202
EST391 196902 107235645
EST392 137014 75086496
EST393 92962 54579752
EST394 120552 80253239
EST395 23222 14225572
EST396 131518 83245448
EST397 119611 76575368
EST398 147506 80759467
EST399 210530 82593877
EST4 142938 56345501
EST40 98816 29786707
EST400 29795 12545416
EST401 163649 84380495
EST402 163929 99177970
EST403 159177 95841266
EST404 125973 81299685
EST405 12110 7935207
EST406 129506 86704326
EST407 137484 90244035
EST408 178709 111928688
EST409 154288 93121919
EST41 39234 11599533
EST410 27624 12033186
EST411 166658 91952291
EST412 168798 124868987
EST413 87450 56185339
EST414 69678 41107319
EST415 34158 16817373
EST416 137675 80049361
EST417 82268 49325811
EST418 139989 56900987
EST419 148868 30145031
EST42 101326 31351096
EST420 148732 30447487
EST421 163341 80758198
EST422 25882 13994606
EST423 201236 115851401
EST424 237754 108749660
EST425 220126 107466859
EST426 127110 74510970
EST427 128057 85803248
EST428 131704 80409324
EST429 93228 56881081
EST43 102633 36243427
EST430 173975 110008863
EST431 213030 84734194
EST432 106810 28527327
EST433 184604 112683361
EST434 204032 111425126
EST435 179047 105682535
EST436 197423 116761422
EST437 134572 63148204
EST438 110907 60524263
EST439 162601 108614110
EST44 95475 48218258
EST440 181510 116038684
EST441 107719 85697863
EST442 177578 140349548
EST443 150447 90322050
EST444 53524 34057685
EST445 166324 107087931
EST446 178587 101256659
EST447 42327 24215122
EST448 195643 106683981
EST449 185000 94875495
EST45 121121 52335541
EST450 50905 38186851
EST451 189907 115816753
EST452 180028 118006489
EST453 54560 33977145
EST454 196573 133887305
EST455 219858 123775639
EST456 190129 126982964
EST457 183837 144586907
EST458 204235 155997292
EST459 192463 115363460
EST46 55810 33167886
EST460 161320 96627740
EST461 181301 94469393
EST462 6514 541380
EST463 53496 4381716
EST464 158232 12239421
EST465 144975 12987161
EST466 148608 30079541
EST467 149063 29643665
EST468 7062 1471579
EST469 148744 30417064
EST47 177020 89152389
EST470 141959 81858084
EST471 172661 101046443
EST472 161280 110585728
EST473 17077 12231595
EST474 160825 92803556
EST475 150648 104118732
EST476 133685 93217910
EST477 141794 98144377
EST478 16200 8333478
EST479 157157 103510844
EST48 158156 65087434
EST480 146227 105186557
EST481 161980 97553210
EST482 165874 51113462
EST483 12282 1932641
EST484 160517 40369185
EST485 150815 102160424
EST486 146721 96562650
EST487 170801 112275584
EST488 21806 11812767
EST489 132815 75920561
EST49 162318 92154071
EST490 189715 107933025
EST491 149560 109195789
EST492 53160 36077311
EST493 126855 87064282
EST494 145577 90234473
EST495 148608 89434104
EST496 163475 89083574
EST497 35424 18054695
EST498 151814 92135788
EST499 156183 92080965
EST5 162082 62608784
EST50 154343 80230369
EST500 168394 101996402
EST501 136268 85441647
EST502 15668 8801102
EST503 100266 71178650
EST504 78634 60627274
EST505 97503 64771452
EST506 143432 80472324
EST507 37129 21174627
EST508 120968 73589785
EST509 133541 87504697
EST51 156434 74815564
EST510 135322 79344957
EST511 151966 92813762
EST512 45965 25226580
EST513 155676 85797389
EST514 184681 110501583
EST515 120275 78975961
EST516 178599 94870924
EST517 5472 2068756
EST518 52576 18674859
EST519 183137 100957942
EST52 108175 61178993
EST520 152175 81363374
EST521 22458 13592932
EST522 162316 94446797
EST523 211757 123975299
EST524 29664 19024876
EST525 147952 99622109
EST526 158950 98067836
EST527 134284 87368944
EST528 128632 87802150
EST529 25678 16071401
EST53 153907 88947354
EST530 179560 74468277
EST531 179121 79605250
EST532 198821 83560789
EST533 194805 80470030
EST534 3280 1144491
EST535 178841 95307232
EST536 174407 102458892
EST537 180222 107874027
EST538 171896 103671986
EST539 196696 126518824
EST54 154265 84990557
EST540 186164 103323533
EST541 178872 82793691
EST542 146564 93624885
EST543 206771 125126638
EST544 205624 126733200
EST545 188949 108252864
EST546 208319 121337435
EST547 34072 17688009
EST548 154068 96424423
EST549 187947 117401468
EST55 152201 92256141
EST550 166655 99005330
EST551 133842 98224898
EST552 8916 7253889
EST553 157240 92159075
EST554 170464 84942643
EST555 149142 85090487
EST556 151163 81932683
EST557 11887 7106830
EST558 156643 80037173
EST559 181306 106392845
EST56 149962 69910171
EST560 162463 103032191
EST561 175342 108161051
EST562 3265 2193046
EST563 170740 117103699
EST564 183914 113636430
EST565 129050 83670403
EST566 169422 97775191
EST567 184959 110599310
EST568 36235 23666360
EST569 204465 119127975
EST57 142200 76730860
EST570 269542 91763948
EST571 25664 9425377
EST572 262943 83717893
EST573 157488 57559226
EST574 162301 59144259
EST575 80398 30735657
EST58 151702 83209748
EST59 161189 65789374
EST6 166267 65037339
EST60 144565 70124844
EST61 160487 90001957
EST62 150435 92621597
EST63 150089 99320726
EST64 157731 94531135
EST65 2397 992589
EST66 154803 103449832
EST67 163009 82999675
EST68 166573 84863254
EST69 142258 77778692
EST7 163878 67752112
EST70 148469 82574868
EST71 149056 86144188
EST72 148550 92242235
EST73 150768 87593603
EST74 2767 1630284
EST75 29919 18235506
EST76 186707 102811942
EST77 170458 90758531
EST78 212600 115717827
EST79 179457 103369706
EST8 160931 67798598
EST80 2123 1442005
EST81 196745 121640362
EST82 167564 93350039
EST83 136131 63336816
EST84 128099 62635550
EST85 11016 5645786
EST86 150359 92610323
EST87 154646 96984150
EST88 130214 66325764
EST89 140261 89341569
EST9 169418 69380160
EST90 14381 7458009
EST91 183467 91897835
EST92 204521 119847865
EST93 202012 107982494
EST94 192027 90407181
EST95 204070 87102143
EST96 145885 86968514
EST97 137843 84893226
EST98 158617 76448051
EST99 9280 6073374
GSS1 172832 126575132
GSS10 14980 14463402
GSS100 169231 144356515
GSS101 157749 108935751
GSS102 155985 106347536
GSS103 152502 105561845
GSS104 168005 122783070
GSS105 149804 126570500
GSS106 162066 125204781
GSS107 186623 116025316
GSS108 16058 9820533
GSS109 185735 119778325
GSS11 146494 107085566
GSS110 201336 103953762
GSS111 219954 124091627
GSS112 87417 56990793
GSS113 152238 114271565
GSS114 155173 118809397
GSS115 155139 118869811
GSS116 163366 106680649
GSS117 37173 21505622
GSS118 179780 132238950
GSS119 189809 117152112
GSS12 200835 104101173
GSS120 166036 55081336
GSS121 169957 76572607
GSS122 2295 1480054
GSS123 161723 105208392
GSS124 189169 124964186
GSS125 200745 81604444
GSS126 167188 79936559
GSS127 137268 94431217
GSS128 129855 104605133
GSS129 132043 108777560
GSS13 192062 84601331
GSS130 132451 106048276
GSS131 8056 5958858
GSS132 135214 112032054
GSS133 56598 47104660
GSS134 132584 107786768
GSS135 139149 116140565
GSS136 140043 114408742
GSS137 138251 109584898
GSS138 4155 2820771
GSS139 134784 106426486
GSS14 173265 89245149
GSS140 134049 108003847
GSS141 134400 111531585
GSS142 138188 116474348
GSS143 4675 3643453
GSS144 139468 108106612
GSS145 136810 113648547
GSS146 136898 113473892
GSS147 137299 112649085
GSS148 559 466085
GSS149 137155 110923756
GSS15 167983 83930679
GSS150 134480 106278327
GSS151 133002 107665198
GSS152 138659 116136290
GSS153 1985 1674795
GSS154 127182 92203837
GSS155 174080 105026233
GSS156 184435 110103307
GSS157 162417 108627913
GSS158 177494 102481389
GSS159 197022 129307000
GSS16 160060 81615096
GSS160 201458 133365835
GSS161 200723 134048006
GSS162 179465 125486286
GSS163 198341 136948587
GSS164 196713 139067120
GSS165 196065 138672070
GSS166 174298 134353538
GSS167 144587 97412907
GSS168 138114 80517957
GSS169 165347 73456578
GSS17 156174 85673627
GSS170 130087 57900795
GSS171 163014 141019316
GSS172 170951 113528738
GSS173 80811 52919501
GSS174 191881 129015715
GSS175 196554 117983862
GSS176 28456 14940540
GSS177 180225 98140530
GSS178 181302 123365801
GSS179 178800 126906476
GSS18 152981 95677320
GSS180 181098 127179984
GSS181 19114 12799890
GSS182 165902 130533276
GSS183 170977 155597399
GSS184 219919 123799690
GSS185 216581 103401654
GSS186 17290 8049466
GSS187 210015 95106166
GSS188 156568 134374532
GSS189 6818 6760628
GSS19 153707 72745819
GSS190 125540 102753347
GSS191 122235 93469471
GSS192 156847 154495780
GSS193 167720 158232911
GSS194 131396 104305071
GSS195 149360 107958474
GSS196 170325 141788280
GSS197 174263 119970230
GSS198 20136 11688868
GSS199 181316 133971324
GSS2 173589 107819358
GSS20 106546 59105521
GSS200 184910 120116892
GSS201 180126 93029160
GSS202 172830 121726505
GSS203 189216 117024741
GSS204 189414 116726891
GSS205 21729 12651457
GSS206 200615 129990067
GSS207 215712 142629172
GSS208 217635 140382802
GSS209 166429 136402995
GSS21 132536 64638951
GSS210 152472 108704003
GSS211 159966 120564247
GSS212 160040 145460321
GSS213 158462 140421086
GSS214 160859 145750229
GSS215 162431 144534355
GSS216 163049 142910892
GSS217 159417 122903915
GSS218 168345 139695448
GSS219 161743 115993986
GSS22 125191 56725897
GSS220 180530 88689585
GSS221 2575 1768585
GSS222 251369 52150506
GSS223 262481 40466091
GSS224 262523 40408947
GSS225 122800 38229504
GSS226 253355 52912344
GSS227 182565 86129448
GSS228 188825 55952994
GSS229 154339 118463226
GSS23 134196 73094577
GSS230 177033 144334259
GSS231 160568 145787944
GSS232 159531 147010793
GSS233 174549 109955224
GSS234 238210 57319690
GSS235 198151 101373468
GSS236 229423 39758510
GSS237 119094 74590504
GSS238 174029 112048984
GSS239 147861 90042086
GSS24 143035 74371292
GSS240 140661 84073818
GSS241 159796 149652844
GSS242 5899 5023719
GSS243 112668 95722541
GSS244 180351 149222837
GSS245 172954 122407496
GSS246 201906 127716652
GSS247 188210 120275961
GSS248 166175 94403497
GSS249 159873 84506384
GSS25 12092 5172754
GSS250 156433 119872540
GSS251 203514 148104443
GSS252 14298 9398581
GSS253 171523 67875770
GSS254 176683 96454754
GSS255 195475 152072364
GSS256 199776 154504000
GSS257 7495 6183699
GSS258 197813 157229673
GSS259 197524 124135901
GSS26 140902 65659537
GSS260 194959 142650302
GSS261 611 422080
GSS262 214911 131530338
GSS263 189958 57638710
GSS264 218598 111928830
GSS265 170488 153872948
GSS266 163848 150141940
GSS267 234900 132469628
GSS268 240183 119740511
GSS27 159863 79841194
GSS28 156781 92818285
GSS29 165484 85429269
GSS3 138093 115755641
GSS30 9310 4808678
GSS31 171978 102877480
GSS32 182794 109078835
GSS33 182356 87082611
GSS34 172894 102149372
GSS35 191042 104301903
GSS36 162180 112295088
GSS37 160410 98257518
GSS38 173347 108755067
GSS39 3659 2625600
GSS4 140176 112446360
GSS40 183985 122974505
GSS41 181701 117299100
GSS42 52326 27358639
GSS43 177824 102907428
GSS44 164532 141986785
GSS45 179635 148566932
GSS46 139666 92482471
GSS47 182856 132009094
GSS48 181603 114543151
GSS49 204426 116967764
GSS5 11600 8663177
GSS50 185614 99479137
GSS51 211954 108037045
GSS52 211747 108318359
GSS53 197315 132797049
GSS54 158211 124808059
GSS55 185583 139405028
GSS56 196775 63137269
GSS57 171822 96460264
GSS58 157621 106112242
GSS59 23373 13575160
GSS6 152749 116375726
GSS60 166616 156645100
GSS61 177157 98801574
GSS62 161196 115202462
GSS63 172331 112351434
GSS64 175439 118751394
GSS65 184542 127843483
GSS66 205677 128792296
GSS67 188167 112097249
GSS68 200686 134224634
GSS69 215702 158336970
GSS7 170814 119984140
GSS70 189038 138024221
GSS71 173742 107642623
GSS72 198219 111980277
GSS73 140725 76414851
GSS74 163079 95884017
GSS75 10697 6814502
GSS76 159270 97756741
GSS77 159481 96970229
GSS78 172285 114351414
GSS79 170749 109399099
GSS8 177198 108971414
GSS80 174370 122402741
GSS81 188875 105213057
GSS82 174789 125779909
GSS83 164306 106587290
GSS84 1781 1416018
GSS85 189251 108546104
GSS86 180944 113833644
GSS87 167309 118209772
GSS88 193311 106233375
GSS89 8554 4944340
GSS9 141908 118712459
GSS90 213831 107550639
GSS91 227222 89202095
GSS92 213483 139456408
GSS93 182686 91963194
GSS94 94686 37020965
GSS95 193805 75823638
GSS96 201086 123394316
GSS97 191020 122180795
GSS98 156116 139401502
GSS99 16660 10968419
HTC1 41206 63404125
HTC2 32318 72275691
HTC3 32080 77890442
HTC4 84836 50647832
HTC5 129773 161432183
HTC6 125015 122865024
HTC7 137623 130766468
HTC8 67932 61167822
HTG1 3784 374870703
HTG10 2848 363016285
HTG11 1976 365940103
HTG12 1714 382089084
HTG13 1718 381796340
HTG14 1659 383118453
HTG15 1835 380424998
HTG16 1750 361896240
HTG17 1843 380599315
HTG18 1752 382301790
HTG19 1775 381824019
HTG2 5068 373604329
HTG20 1891 380883515
HTG21 2135 355865123
HTG22 2426 376351102
HTG23 2269 379507879
HTG24 2442 381163865
HTG25 2175 382733656
HTG26 2070 368006459
HTG27 2074 380458182
HTG28 2061 380108509
HTG29 1047 202962639
HTG3 2556 370662362
HTG30 2040 379446758
HTG31 2203 375546591
HTG32 986 170706729
HTG33 2152 379221269
HTG34 2348 376393195
HTG35 1372 195850538
HTG36 2462 370234045
HTG37 2428 372528369
HTG38 1015 169191937
HTG39 2235 381490266
HTG4 2735 369989641
HTG40 2336 385145188
HTG41 1069 180930974
HTG42 2312 384776536
HTG43 2363 384490832
HTG44 906 155597869
HTG45 2500 379735659
HTG46 2319 385244375
HTG47 927 158722850
HTG48 2315 385567657
HTG49 2293 386023883
HTG5 2500 373389217
HTG50 900 149450476
HTG51 2237 385154833
HTG52 2106 380011723
HTG53 657 122585305
HTG54 2010 379525743
HTG55 1981 378955508
HTG56 1184 193581815
HTG57 2144 380658486
HTG58 2686 383430148
HTG59 2973 383248998
HTG6 2 386956
HTG60 884 128257683
HTG61 2959 380503057
HTG62 3012 366231486
HTG63 2990 372824610
HTG64 2953 336850403
HTG65 3178 359117111
HTG66 3179 359260560
HTG67 3186 360427818
HTG68 3128 367889098
HTG69 2913 377859052
HTG7 2327 375791086
HTG70 1846 312468258
HTG71 3415 365492036
HTG72 2071 381329139
HTG73 1668 298160154
HTG74 2088 382520375
HTG75 2244 384445864
HTG76 1669 296247510
HTG77 2201 385233869
HTG78 2249 384504439
HTG79 3219 384192102
HTG8 1500 384347777
HTG80 2166 384708164
HTG81 3033 373087380
HTG82 2056 208001329
HTG9 1582 384062276
INV1 154214 140640933
INV10 14 359428768
INV100 32679 23464004
INV101 148923 103605739
INV102 152212 116398734
INV103 121751 83651264
INV104 154941 113616553
INV105 153605 120477844
INV106 54022 36075945
INV107 152799 109375436
INV108 153465 115493295
INV109 37197 32123644
INV11 9 363281720
INV110 141580 88513374
INV111 147770 93670302
INV112 43751 33362749
INV113 148100 97247951
INV114 139030 81413294
INV115 43128 25564228
INV116 138170 82625343
INV117 137814 82616392
INV118 54036 35679511
INV119 138821 83289431
INV12 52 355336707
INV120 135265 98788268
INV121 75087 58795734
INV122 141990 108087313
INV123 150956 120582485
INV124 156044 118329910
INV125 108799 225604215
INV126 7054 14257427
INV127 183035 236941459
INV128 216228 165877386
INV129 38629 187147326
INV13 14 371434550
INV130 800 42674647
INV131 566 40635863
INV132 8037 115580217
INV133 23329 332915377
INV134 23255 171962006
INV135 68041 305365919
INV136 123287 266863020
INV137 64375 76908791
INV138 180571 237306452
INV139 41592 302727004
INV14 78 134821644
INV140 315 394021049
INV141 1012 100307854
INV142 2059 383654064
INV143 2 41011863
INV144 587 361649714
INV145 8 378508614
INV146 974 354275690
INV147 6 380479040
INV148 2 95552909
INV149 22 390382246
INV15 6 384224499
INV150 10036 362338941
INV151 377 367082657
INV152 3415 40188607
INV153 1 685423969
INV154 1 640667275
INV155 1 639123876
INV156 1 612949391
INV157 1 577192767
INV158 1 641629864
INV159 497 320978344
INV16 14 379706462
INV160 2 371500015
INV161 2 289902239
INV162 2965 358959205
INV163 59277 333080486
INV164 34 383065485
INV165 19 393344928
INV166 14 327270017
INV167 27 393651567
INV168 32 390738662
INV169 24 383706785
INV17 31 388860819
INV170 25 382049854
INV171 31 378115211
INV172 13 297748085
INV173 18 387848160
INV174 24 381271345
INV175 36 390867092
INV176 34 389743485
INV177 26 391141334
INV178 19 292893418
INV179 11 371260264
INV18 11 377131664
INV180 19 391738068
INV181 12 391781067
INV182 13 372901688
INV183 32 389502837
INV184 22 330411078
INV185 29 389284801
INV186 38 387663352
INV187 17 367589223
INV188 12 387517245
INV189 17 362786034
INV19 3 241225934
INV190 10 320557524
INV191 13 376469258
INV192 35 380323776
INV193 26 392110963
INV194 24 388964019
INV195 21 391745060
INV196 22 309540561
INV197 27 392282931
INV198 24 388632304
INV199 12 375724207
INV2 2288 315894747
INV20 3 393880593
INV200 16 393313708
INV201 13 392068811
INV202 10 277290815
INV203 15 358735036
INV204 11 386907833
INV205 16 377160071
INV206 21 392427759
INV207 5 215849302
INV208 15 382505853
INV209 743 382889760
INV21 3 261336042
INV210 26 386022184
INV211 28 394591284
INV212 7 307846652
INV213 4 182170525
INV214 2 342421305
INV215 2 269826459
INV216 18 385786230
INV217 1901 346423963
INV218 8863 319021282
INV219 11615 311682508
INV22 3 322765503
INV220 29288 83527942
INV221 149749 106269296
INV222 152762 93799470
INV223 83465 48589229
INV224 151203 93782192
INV225 151094 109841000
INV226 59612 50546718
INV227 151668 123267883
INV228 149727 121589297
INV229 79775 64060773
INV23 2 265971290
INV230 149602 114005216
INV231 143939 122400158
INV232 78842 99846119
INV233 146013 123750475
INV234 99799 176099704
INV235 1896 379101147
INV236 3199 260759195
INV237 96781 321023124
INV238 217342 232110336
INV239 60949 250981301
INV24 4 328757598
INV240 104213 292697254
INV241 28749 364829410
INV242 1766 378350697
INV243 2736 196647685
INV244 184144 268358078
INV245 1785 378880292
INV246 5583 374469857
INV247 20768 153711624
INV248 288223 205808194
INV249 1224 379793465
INV25 5 378753109
INV250 4515 373876603
INV251 92490 210334617
INV252 391527 140904810
INV253 109733 258294965
INV254 62463 308727005
INV255 4162 375136162
INV256 44629 350112618
INV257 2155 4626806
INV258 298725 199657065
INV259 214334 249067665
INV26 5 371191486
INV260 2226 377046597
INV261 19303 366955288
INV262 16948 41978773
INV263 298408 186907243
INV264 1355 379516794
INV265 3687 378313727
INV266 136930 300095839
INV267 38349 357698579
INV268 664 92151452
INV269 8529 370827851
INV27 4 376987297
INV270 197744 256830145
INV271 359558 128682792
INV272 93023 322972837
INV273 2568 378355489
INV274 61847 343439542
INV275 110721 285908317
INV276 12 169407469
INV277 15 379655485
INV278 6 355188453
INV279 1 239744465
INV28 4 293537168
INV280 1 231634122
INV281 1 221096292
INV282 1 220877407
INV283 1 216720617
INV284 1 210676062
INV285 2 387811394
INV286 2 329972158
INV287 2 302384449
INV288 20 360081608
INV289 9 301825222
INV29 4 373434888
INV290 23 382490317
INV291 23 380735444
INV292 18 387931948
INV293 33 390736486
INV294 780 381140152
INV295 20 391287680
INV296 2 32244328
INV297 27 388830496
INV298 21 386972019
INV299 9 351834369
INV3 104809 182024877
INV30 47 389240333
INV300 5 163634948
INV301 1 292306469
INV302 1 164045107
INV303 2 318230244
INV304 855 391020194
INV305 30 391515590
INV306 25 383908286
INV307 25 388289419
INV308 3 49480870
INV309 25 384967207
INV31 25309 346462434
INV310 26 391482668
INV311 22 392427991
INV312 26 383547221
INV313 26 265978999
INV314 6 371290168
INV315 13 374069663
INV316 19 385560269
INV317 15 373391572
INV318 13 350978987
INV319 22 386100611
INV32 127810 103598195
INV320 24 386055502
INV321 23 389090030
INV322 31 366704932
INV323 12 307588661
INV324 24 393918543
INV325 16 362929629
INV326 8 361035446
INV327 13 369493806
INV328 13 384884009
INV329 18 390461886
INV33 167272 134294671
INV330 22 394170044
INV331 11 336163521
INV332 6 353407420
INV333 7 372089599
INV334 3 84055540
INV335 9 390324178
INV336 19 393988728
INV337 11 137914990
INV338 1 346874609
INV339 1 248688513
INV34 126789 112378558
INV340 1 195213701
INV341 21 389226046
INV342 16 380802157
INV343 17 384888603
INV344 24 390785021
INV345 14 272669524
INV346 19 394017224
INV347 17 391933486
INV348 7 291754234
INV349 2 360067285
INV35 37136 273256295
INV350 1 158111693
INV351 5 390880948
INV352 1 269711166
INV353 1 265788494
INV354 5 389225578
INV355 8 84827761
INV356 32 385162699
INV357 29 391336068
INV358 26 380265073
INV359 8 257485661
INV36 2779 371575686
INV360 20 383534539
INV361 18 388997674
INV362 13 372064491
INV363 12 246225518
INV364 18 394216238
INV365 18 380558243
INV366 10 378653212
INV367 35 286756574
INV368 50 386517834
INV369 41 394290459
INV37 44 370097852
INV370 30 391877099
INV371 23 388833300
INV372 17 384297034
INV373 16 391613329
INV374 12 375795023
INV375 18 391634427
INV376 20 380480634
INV377 22 271076993
INV378 29 389236155
INV379 23 387510109
INV38 24 379270378
INV380 25 393194949
INV381 29 393406758
INV382 10 389413895
INV383 12 256001243
INV384 25 382453876
INV385 25 387644779
INV386 17 390017898
INV387 13 185974631
INV388 1 252586203
INV389 2 382245123
INV39 5 76533839
INV390 1 170640157
INV391 3 172715237
INV392 1 265601162
INV393 1 235131548
INV394 8 377013040
INV395 18 389308576
INV396 6 76294397
INV397 2 316929497
INV398 5 371999024
INV399 13 377525467
INV4 59185 272955779
INV40 32 391299062
INV400 20 380130864
INV401 4 94235370
INV402 20 386111019
INV403 10 330750052
INV404 8 388492156
INV405 29 385235322
INV406 3 68204675
INV407 1 375708846
INV408 147 377882925
INV409 3 72566929
INV41 25 362900281
INV410 18 393806697
INV411 12 375328864
INV412 13 388485421
INV413 17 389690952
INV414 10 355855682
INV415 12 388165924
INV416 5 66893570
INV417 2 334507981
INV418 2 271847796
INV419 9 384970046
INV42 18 380479131
INV420 14 380331769
INV421 17 331062789
INV422 4 353245537
INV423 5 361980503
INV424 1 66459093
INV425 6 375950524
INV426 11 380698960
INV427 13 393299321
INV428 16 371834617
INV429 4 107829629
INV43 19 390062857
INV430 16 390859621
INV431 35 393136677
INV432 18 389411089
INV433 79 348191088
INV434 10 366985680
INV435 18 382945053
INV436 3 55752453
INV437 23 351194891
INV438 4 361297550
INV439 7 382899134
INV44 5 134896453
INV440 16 391635138
INV441 18 314878223
INV442 25 391765795
INV443 7 316364288
INV444 3 332270074
INV445 4 368005921
INV446 23 389089573
INV447 17 270136971
INV448 2 278332741
INV449 6 275271247
INV45 18 373966012
INV450 9 360027838
INV451 12 393015501
INV452 10 354694948
INV453 6 369954565
INV454 6 341098428
INV455 2 109343042
INV456 8 392102027
INV457 24 394471285
INV458 24 378149829
INV459 13 203497026
INV46 24 386582132
INV460 9 372379570
INV461 12 384804523
INV462 16 389458670
INV463 46 389323171
INV464 6 41869888
INV465 36 366039518
INV466 20 379859277
INV467 27 386406984
INV468 41 380881166
INV469 15 386326246
INV47 8 380395300
INV470 1 21660759
INV471 8 116281656
INV472 1 410988561
INV473 2 347081175
INV474 2 60458881
INV475 1 429819325
INV476 1 230177572
INV477 2 394052085
INV478 35 354776638
INV479 7 318208416
INV48 19 379365223
INV480 3 214479292
INV481 7 381813918
INV482 9 359428332
INV483 2 318574174
INV484 2 277111903
INV485 3 387176093
INV486 3 351940327
INV487 6 365463711
INV488 20090 279663127
INV49 9 138772803
INV5 37249 75746579
INV50 28 391443577
INV51 28 392100242
INV52 45 382097969
INV53 27 372689565
INV54 18 385206419
INV55 12 373566826
INV56 1 94407144
INV57 15 381614547
INV58 29 387067226
INV59 25 384930048
INV6 129081 165754942
INV60 18 381070342
INV61 96940 235208859
INV62 124249 97188162
INV63 28932 319690973
INV64 28941 347133943
INV65 20 388604938
INV66 15 389699299
INV67 16 252138391
INV68 34 391108664
INV69 71 392017627
INV7 207 346774014
INV70 24 388974367
INV71 21 381982755
INV72 20 377528210
INV73 24 388990901
INV74 29 394663938
INV75 27 393364049
INV76 23 381713426
INV77 134 350713408
INV78 4 381900476
INV79 24 389620287
INV8 85 322154899
INV80 33 393229173
INV81 9 344807465
INV82 23 323415557
INV83 32 372768847
INV84 20 384741007
INV85 25 385708546
INV86 29 388680045
INV87 22 323658394
INV88 25 386606940
INV89 22 384360764
INV9 3 136766944
INV90 22 375170777
INV91 31 394116451
INV92 20 281624502
INV93 11 364532943
INV94 14 378464462
INV95 38 390437780
INV96 20 259303673
INV97 35 382133951
INV98 38989 329147920
INV99 150715 102219903
MAM1 32388 323882267
MAM10 26814 24994146
MAM100 5 381968701
MAM101 4 345040697
MAM102 3 176472919
MAM103 6 356825309
MAM104 3 354814440
MAM105 3336 333279354
MAM106 66885 270491063
MAM107 67321 96527981
MAM108 1 179953079
MAM109 4 274800947
MAM11 13731 20581276
MAM110 4 294612101
MAM111 4 368804057
MAM112 5 360824188
MAM113 3 381844289
MAM114 4 323611747
MAM115 5 314441637
MAM116 8291 281091208
MAM12 3445 7368868
MAM13 107 699953
MAM14 20 277696380
MAM15 1 249270926
MAM16 2 343930246
MAM17 3 325384739
MAM18 1 90795278
MAM19 4 322903327
MAM2 22252 277073294
MAM20 4 298795355
MAM21 6 353843759
MAM22 5 329700903
MAM23 2 289079565
MAM24 3 348530310
MAM25 4 336581445
MAM26 5 375256260
MAM27 6 373952570
MAM28 8 377813420
MAM29 5 379300313
MAM3 2 316219032
MAM30 1 38035513
MAM31 5 285741626
MAM32 5 342804543
MAM33 8 370485433
MAM34 6 316655225
MAM35 4 238884849
MAM36 4 355768297
MAM37 6 355037276
MAM38 7 389945117
MAM39 6 319172640
MAM4 2 376685399
MAM40 5 323047396
MAM41 4 347221982
MAM42 5 288444151
MAM43 5 375232988
MAM44 5 248962388
MAM45 1 277956744
MAM46 1 154038104
MAM47 3 374028897
MAM48 2 298256496
MAM49 3 355148320
MAM5 2 295769989
MAM50 3 355658200
MAM51 3 369352591
MAM52 13 295784090
MAM53 54 7614329
MAM54 215 34073042
MAM55 431 71272130
MAM56 861 68509101
MAM57 1706 2411269
MAM58 6836 6159435
MAM59 110526 193401624
MAM6 2 385026516
MAM60 33167 281592591
MAM61 4 358286156
MAM62 5 387739617
MAM63 5 335893012
MAM64 6 364021592
MAM65 6 304412506
MAM66 10 386743576
MAM67 132599 153988220
MAM68 117954 169545135
MAM69 5871 5207043
MAM7 3 316699161
MAM70 1 716413629
MAM71 1 662751787
MAM72 1 611347268
MAM73 1 464895054
MAM74 1 288121652
MAM75 3 338107697
MAM76 1 223449203
MAM77 1 210645437
MAM78 1 201318998
MAM79 1 197708286
MAM8 5 343489620
MAM80 2 320231256
MAM81 2 293750401
MAM82 3 367535284
MAM83 4 351244600
MAM84 367 269065793
MAM85 1 203623556
MAM86 2 383513587
MAM87 4 383666147
MAM88 5 381503248
MAM89 263 390074346
MAM9 933 216317382
MAM90 2 265153725
MAM91 4 366992153
MAM92 5 369689861
MAM93 5 392803577
MAM94 6 298207437
MAM95 3 363734450
MAM96 1 118519168
MAM97 3 328935722
MAM98 4 359964523
MAM99 4 383777488
PAT1 420072 157363817
PAT10 304138 130867531
PAT100 352852 189327041
PAT101 310862 206556098
PAT102 261889 226571161
PAT103 130469 96637053
PAT104 304402 217824161
PAT105 276793 236021165
PAT106 255575 243191966
PAT107 219302 91982645
PAT108 185522 168147091
PAT109 194734 145573860
PAT11 235969 217001618
PAT110 98142 56009604
PAT111 244010 110313663
PAT112 143100 226369725
PAT113 78463 27201918
PAT114 88275 271848443
PAT115 224850 124890935
PAT116 225594 104823639
PAT117 1429 4493399
PAT118 247765 75673289
PAT119 230776 33741646
PAT12 83512 75761949
PAT120 94886 123403652
PAT121 98574 119749391
PAT122 81936 115812708
PAT123 203199 107726574
PAT124 26053 9049911
PAT125 203753 100524714
PAT126 183498 80758866
PAT127 117398 19496465
PAT128 249601 208803263
PAT129 386164 114645354
PAT13 242994 211781414
PAT130 52464 7541176
PAT131 283983 180108026
PAT132 123556 298380793
PAT133 110200 303234802
PAT134 393173 122391607
PAT135 290823 158915495
PAT136 12505 8419526
PAT137 287141 182646284
PAT138 409360 14039521
PAT139 496812 33315384
PAT14 328299 148441113
PAT140 525210 7878150
PAT141 153458 3896573
PAT142 377415 123797918
PAT143 245707 106305353
PAT144 259895 238802744
PAT145 4634 392128968
PAT146 190899 207809354
PAT147 308470 120437803
PAT148 140526 153750733
PAT149 6432 91696404
PAT15 63707 1592675
PAT150 177885 181303248
PAT151 71548 185117089
PAT152 75797 115786083
PAT153 75754 115775734
PAT154 46229 38674255
PAT155 245585 68642488
PAT156 201628 63082013
PAT157 264566 57807463
PAT158 309583 83974277
PAT159 458732 54677761
PAT16 197481 165317752
PAT160 227775 118065838
PAT161 360552 132693725
PAT162 287882 50231443
PAT163 154057 4622388
PAT164 229227 77275728
PAT165 228121 72916652
PAT166 281284 18699015
PAT167 64337 7031178
PAT168 153383 170227500
PAT169 73417 134980723
PAT17 217864 141819681
PAT170 74139 123431457
PAT171 137229 84274353
PAT172 175192 2627880
PAT173 234158 99492766
PAT174 198435 145143798
PAT175 229722 110406144
PAT176 105083 67822652
PAT177 80124 122466507
PAT178 260801 46024540
PAT179 294811 4422165
PAT18 217789 104558172
PAT180 7781 116715
PAT181 278538 10765362
PAT182 99590 135915739
PAT183 220910 105875731
PAT184 23917 35278529
PAT185 143999 206566501
PAT186 173285 186742155
PAT187 70129 243259642
PAT188 6542 8869371
PAT189 137168 133366031
PAT19 238917 105580979
PAT190 136594 204924247
PAT191 208575 98959238
PAT192 284104 31395226
PAT193 26280 42269494
PAT194 264589 66935450
PAT195 227269 82111943
PAT196 179588 5746816
PAT197 194343 81150933
PAT198 52350 9088688
PAT199 82690 146051882
PAT2 329685 203025577
PAT20 217522 131791310
PAT200 75930 116106222
PAT201 76058 115438165
PAT202 205771 85563217
PAT203 2801 56020
PAT204 342231 6844620
PAT205 341891 7168782
PAT206 341071 7503562
PAT207 331154 110021550
PAT208 268658 230373189
PAT209 282624 222310160
PAT21 295514 53562493
PAT210 192664 139614235
PAT211 276098 235021090
PAT212 188385 291326630
PAT213 137484 196232251
PAT214 247191 246690030
PAT215 11728 387687504
PAT216 313354 152356909
PAT217 244602 252477336
PAT218 160029 300870611
PAT219 215545 135077252
PAT22 146925 94683972
PAT220 172971 290885692
PAT221 266012 215701137
PAT222 351348 145812501
PAT223 304078 76036517
PAT224 317818 206630332
PAT225 43590 365712261
PAT226 151381 180550783
PAT227 338212 193787787
PAT228 332520 206353769
PAT229 155792 199233054
PAT23 196051 155681695
PAT230 249094 251157045
PAT231 209852 277995521
PAT232 262858 236722257
PAT233 313828 214462099
PAT234 164472 182083893
PAT235 218335 140106906
PAT236 284534 19076352
PAT237 283825 19293837
PAT238 106269 19050125
PAT239 281624 22162860
PAT24 279821 73243680
PAT240 286514 14630240
PAT241 287155 13479675
PAT242 96564 20012546
PAT243 263509 44902329
PAT244 293106 5569014
PAT245 293106 5569014
PAT246 123658 19117456
PAT25 228204 147409353
PAT26 209297 140270153
PAT27 62580 53901225
PAT28 304662 206975876
PAT29 321045 202870000
PAT3 50180 20260693
PAT30 69609 127456994
PAT31 217213 274043600
PAT32 399532 38379558
PAT33 255749 169048211
PAT34 232475 137936527
PAT35 62211 29249686
PAT36 159610 193120910
PAT37 187244 152014323
PAT38 212000 134509372
PAT39 97875 9820258
PAT4 329511 180386857
PAT40 349667 21562036
PAT41 269132 102155254
PAT42 166 390395449
PAT43 7285 386170321
PAT44 91553 5256860
PAT45 304606 19422510
PAT46 304621 19407682
PAT47 188156 183524069
PAT48 31139 33397375
PAT49 100021 274296388
PAT5 261927 200082814
PAT50 347914 22045690
PAT51 356635 6776065
PAT52 92431 1756189
PAT53 351487 15876250
PAT54 360979 6858601
PAT55 133552 2537488
PAT56 360626 6851894
PAT57 359974 6839506
PAT58 125418 2711844
PAT59 535700 100616524
PAT6 217647 164402205
PAT60 111356 330233433
PAT61 289774 158820679
PAT62 481510 50384146
PAT63 225628 89296979
PAT64 254551 194646755
PAT65 328369 204069827
PAT66 171734 140681449
PAT67 349862 190728733
PAT68 612603 75778089
PAT69 132887 40797313
PAT7 247422 122522282
PAT70 484033 127126269
PAT71 126354 109119371
PAT72 150168 307250321
PAT73 318626 211710240
PAT74 51881 214846609
PAT75 189165 289007376
PAT76 317843 207880789
PAT77 123868 129694058
PAT78 342751 192409991
PAT79 362616 180214431
PAT8 224285 103120736
PAT80 20467 17346132
PAT81 311143 212599739
PAT82 414691 138165335
PAT83 481329 57361173
PAT84 327289 49350302
PAT85 456880 82648416
PAT86 157574 115871211
PAT87 167196 186345594
PAT88 316168 151202056
PAT89 224216 179583881
PAT9 153311 78043594
PAT90 160892 40126467
PAT91 548289 10417491
PAT92 499577 9491963
PAT93 509422 32511534
PAT94 211221 45759082
PAT95 257687 203232161
PAT96 388298 141389415
PAT97 39463 44148194
PAT98 361773 186862184
PAT99 415062 154422395
PHG1 8914 216260788
PHG2 4805 223666272
PHG3 5303 216101949
PHG4 7771 238152117
PHG5 3421 151330418
PLN1 135045 172305967
PLN10 18921 157294990
PLN100 57 390189770
PLN101 11 373036233
PLN102 8 357693623
PLN103 6 351635285
PLN104 12 293471641
PLN105 78 341267500
PLN106 131 317758159
PLN107 124 358113214
PLN108 105 219857218
PLN109 196 355571810
PLN11 29377 278503063
PLN110 126 326901077
PLN111 75 366349697
PLN112 8 311786530
PLN113 117 351878453
PLN114 168 389953378
PLN115 83 391444557
PLN116 89 389460779
PLN117 142 373285858
PLN118 37 16871
PLN119 149 79314
PLN12 2658 334144218
PLN120 2469 93786416
PLN121 7181 18795412
PLN122 14346 29953091
PLN123 97686 209391101
PLN124 129456 90021506
PLN125 158989 148223727
PLN126 162795 146546909
PLN127 57609 31477802
PLN128 181655 125377433
PLN129 49816 254932253
PLN13 37 329935405
PLN130 41637 287857567
PLN131 71877 108804425
PLN132 98644 85504671
PLN133 49729 72847341
PLN134 25061 110565816
PLN135 13561 89764040
PLN136 1 774434471
PLN137 8305 28494037
PLN138 1861 361385154
PLN139 5 372618381
PLN14 46 124218893
PLN140 6 372447772
PLN141 6 368295254
PLN142 2 132503639
PLN143 428 311697900
PLN144 8 327823341
PLN145 6 343447962
PLN146 1 66465249
PLN147 1 474651383
PLN148 1 612216829
PLN149 1 571018318
PLN15 9 366014477
PLN150 1 574020038
PLN151 1 538550714
PLN152 1 514282554
PLN153 1 575541767
PLN154 131 336044503
PLN155 13436 306721111
PLN156 175202 124224769
PLN157 23716 15789680
PLN158 148447 156345649
PLN159 149692 145702591
PLN16 2395 340580897
PLN160 86487 71749507
PLN161 154563 132804814
PLN162 163972 118773191
PLN163 24516 26690245
PLN164 147691 134509689
PLN165 125620 155874192
PLN166 167303 121796894
PLN167 116023 120542165
PLN168 134594 149644253
PLN169 102159 121622355
PLN17 1949 233857567
PLN170 135892 149974629
PLN171 126630 163224490
PLN172 120529 166610792
PLN173 20143 18065287
PLN174 124346 164171902
PLN175 112939 173112638
PLN176 85826 158293970
PLN177 118924 172057219
PLN178 112287 186107308
PLN179 12351 318054410
PLN18 3 330514248
PLN180 18889 192078726
PLN181 19737 363518883
PLN182 10232 333664247
PLN183 302 288936846
PLN184 5 324373291
PLN185 1670 369972731
PLN186 1585 2233569
PLN187 1382 387001316
PLN188 8 179149947
PLN189 1282 232633870
PLN19 37 346663474
PLN190 1 522466905
PLN191 1 675310294
PLN192 1 628753756
PLN193 1 624247919
PLN194 1 599018945
PLN195 1 573247234
PLN196 1 634667502
PLN197 8563 149646365
PLN198 1 727344967
PLN199 1 946003158
PLN2 39532 282847162
PLN20 19733 84550131
PLN200 1 965754312
PLN201 1 906459801
PLN202 1 876148008
PLN203 1 885153844
PLN204 1 899925126
PLN205 1 528437893
PLN206 4140 344356697
PLN207 10 362580157
PLN208 4 120184706
PLN209 129 363593727
PLN21 96586 101383894
PLN210 404 366581476
PLN211 9 335385998
PLN212 130 308977848
PLN213 2 317663561
PLN214 1 192140685
PLN215 1 279860179
PLN216 1 259520967
PLN217 2 294703259
PLN218 1 238633233
PLN219 1 162496318
PLN22 113432 117615216
PLN220 1 420743833
PLN221 206 92200731
PLN222 16 383095167
PLN223 32 120825431
PLN224 1 541700351
PLN225 1 696809892
PLN226 1 655542733
PLN227 1 648987779
PLN228 1 622068216
PLN229 1 583456046
PLN23 57311 72144580
PLN230 1 654005093
PLN231 130 298375
PLN232 1 522466905
PLN233 1 675310294
PLN234 1 628753756
PLN235 1 624247919
PLN236 1 599018945
PLN237 1 573247234
PLN238 1 634667502
PLN239 313 95007523
PLN24 28689 28922869
PLN240 1 521073757
PLN241 1 672273650
PLN242 1 634137895
PLN243 1 624121443
PLN244 1 607506942
PLN245 1 564293627
PLN246 1 632401812
PLN247 1 520603772
PLN248 1 661076038
PLN249 1 626572591
PLN25 2648 194594881
PLN250 1 612852138
PLN251 1 598896166
PLN252 1 570629545
PLN253 1 623813090
PLN254 1 513014082
PLN255 1 653624577
PLN256 1 616219606
PLN257 1 610044819
PLN258 1 583417444
PLN259 1 550735148
PLN26 344 254550430
PLN260 1 620104558
PLN261 1 536602846
PLN262 1 671211297
PLN263 1 630677708
PLN264 1 623428415
PLN265 1 604298040
PLN266 1 558526623
PLN267 1 628419988
PLN268 1 500012378
PLN269 1 648922534
PLN27 400 261235914
PLN270 1 604770208
PLN271 1 597403059
PLN272 1 576456374
PLN273 1 556080982
PLN274 1 603311816
PLN275 1 512023576
PLN276 1 652551272
PLN277 1 615767531
PLN278 1 605571303
PLN279 1 592249714
PLN28 198 168828441
PLN280 1 549757368
PLN281 1 616509610
PLN282 1 550024188
PLN283 1 710194481
PLN284 1 661081403
PLN285 1 659460550
PLN286 1 630572514
PLN287 1 598618390
PLN288 1 658974642
PLN289 1 559656399
PLN29 298 258873545
PLN290 1 717517502
PLN291 1 672450454
PLN292 1 665297378
PLN293 1 636785599
PLN294 1 599706080
PLN295 1 675658265
PLN296 1 523168208
PLN297 1 495661851
PLN298 1 640830439
PLN299 1 597781253
PLN3 3694 380437784
PLN30 339 265493888
PLN300 1 600363860
PLN301 1 570178053
PLN302 1 534998810
PLN303 1 616598997
PLN304 1 537457279
PLN305 1 685947972
PLN306 1 649921694
PLN307 1 641099225
PLN308 1 611845738
PLN309 1 581041262
PLN31 485 350911896
PLN310 1 655783664
PLN311 1 521174834
PLN312 1 667717957
PLN313 1 631819663
PLN314 1 624692602
PLN315 1 597351075
PLN316 1 561737938
PLN317 1 629651422
PLN318 1 524514255
PLN319 1 670202054
PLN32 112 80604200
PLN320 1 631946783
PLN321 1 626743494
PLN322 1 600801835
PLN323 1 566971015
PLN324 1 629827058
PLN325 1 522114480
PLN326 1 671530377
PLN327 1 631910401
PLN328 1 622474059
PLN329 1 598240357
PLN33 455 379563194
PLN330 1 562137082
PLN331 1 633805855
PLN332 1 525723083
PLN333 1 684336246
PLN334 1 636053469
PLN335 1 629969872
PLN336 1 604087610
PLN337 1 568600391
PLN338 1 640498578
PLN339 1 519546829
PLN34 127 379253996
PLN340 1 665715246
PLN341 1 624683667
PLN342 1 621078253
PLN343 1 600910593
PLN344 1 558953701
PLN345 1 626840912
PLN346 1 543344542
PLN347 1 697540743
PLN348 1 655862368
PLN349 1 646765634
PLN35 91 241350431
PLN350 1 618540729
PLN351 1 587963859
PLN352 1 658085510
PLN353 439 378681748
PLN354 15 312691008
PLN355 20 111531882
PLN356 1 596211899
PLN357 1 705338699
PLN358 1 493450010
PLN359 1 804285258
PLN36 108 325736871
PLN360 1 810734643
PLN361 1 673981989
PLN362 1 754496630
PLN363 1 855759449
PLN364 1 614042580
PLN365 1 743847818
PLN366 1 673340788
PLN367 1 515668560
PLN368 1 713320806
PLN369 1 703598484
PLN37 17 390428741
PLN370 1 570159854
PLN371 1 625793224
PLN372 1 721110502
PLN373 1 459355444
PLN374 1 745201001
PLN375 1 749284433
PLN376 1 643344672
PLN377 1 595297365
PLN378 1 688905267
PLN379 1 491807393
PLN38 234 283333018
PLN380 1 769338634
PLN381 1 671568023
PLN382 1 635285330
PLN383 1 745618965
PLN384 1 839470345
PLN385 1 646400022
PLN386 1 747589525
PLN387 1 665179885
PLN388 1 506585010
PLN389 1 703962928
PLN39 161 383746871
PLN390 1 702438406
PLN391 1 568126671
PLN392 1 610851963
PLN393 1 707596419
PLN394 1 465558328
PLN395 1 734536914
PLN396 1 738743901
PLN397 1 636778132
PLN398 1 602900890
PLN399 1 697493198
PLN4 3521 387756969
PLN40 65 329728329
PLN400 1 490518203
PLN401 1 784661008
PLN402 1 810500911
PLN403 1 655314739
PLN404 1 752710991
PLN405 1 890847171
PLN406 1 621781073
PLN407 1 743084022
PLN408 1 676741658
PLN409 1 509452426
PLN41 16 386556087
PLN410 1 710124532
PLN411 1 480767623
PLN412 1 578021311
PLN413 1 620140791
PLN414 1 716573881
PLN415 1 476726550
PLN416 1 756324664
PLN417 1 977471539
PLN418 1 642207261
PLN419 1 502612092
PLN42 20 328777414
PLN420 1 646234737
PLN421 1 605172934
PLN422 1 593744788
PLN423 1 571972453
PLN424 1 545472572
PLN425 1 607667504
PLN426 1 590561804
PLN427 1 685720839
PLN428 1 490910922
PLN429 1 782694893
PLN43 6 376299569
PLN430 1 796420183
PLN431 1 650274702
PLN432 1 739889549
PLN433 1 848590828
PLN434 1 610626473
PLN435 1 738023571
PLN436 1 667607564
PLN437 1 506274898
PLN438 1 701434008
PLN439 1 690770133
PLN44 1 65870126
PLN440 1 567265955
PLN441 1 612987783
PLN442 1 704156067
PLN443 1 475327881
PLN444 1 732118298
PLN445 1 733931846
PLN446 1 636796232
PLN447 1 599764323
PLN448 1 691313424
PLN449 1 493357854
PLN45 93 388494695
PLN450 1 782685093
PLN451 1 786410271
PLN452 1 648139033
PLN453 1 744407562
PLN454 1 835583350
PLN455 1 623221719
PLN456 1 741299132
PLN457 1 669032550
PLN458 1 517040482
PLN459 1 711661679
PLN46 15 373888800
PLN460 1 708205786
PLN461 1 573398137
PLN462 1 583494258
PLN463 1 707105489
PLN464 1 471251328
PLN465 1 737453356
PLN466 1 736349413
PLN467 1 639162162
PLN468 1 586755746
PLN469 1 704478343
PLN47 9 363551984
PLN470 1 492109999
PLN471 1 791475352
PLN472 1 785940626
PLN473 1 661246824
PLN474 1 756990402
PLN475 1 858776195
PLN476 1 621195942
PLN477 1 754256086
PLN478 1 670301833
PLN479 1 509263899
PLN48 60 374148929
PLN480 1 708234589
PLN481 1 725120110
PLN482 1 575129590
PLN483 1 620883766
PLN484 1 727285804
PLN485 1 479660269
PLN486 1 745978486
PLN487 1 750160716
PLN488 1 642428577
PLN489 1 591313643
PLN49 14 212654302
PLN490 1 705330581
PLN491 1 495656580
PLN492 1 803232604
PLN493 1 790745243
PLN494 1 657494025
PLN495 1 759305888
PLN496 1 856542542
PLN497 1 628321883
PLN498 1 754364263
PLN499 1 697113365
PLN5 97749 201760120
PLN50 74 124609184
PLN500 1 504254270
PLN501 1 715354979
PLN502 1 713929667
PLN503 1 572943128
PLN504 1 626959190
PLN505 1 715714221
PLN506 1 483823121
PLN507 1 742917797
PLN508 1 748536659
PLN509 1 643784981
PLN51 8 358353307
PLN510 1 600654286
PLN511 1 685083685
PLN512 1 486317123
PLN513 1 794150360
PLN514 1 799857935
PLN515 1 655329108
PLN516 1 749763888
PLN517 1 838116175
PLN518 1 610468321
PLN519 1 736551279
PLN52 3 347496433
PLN520 1 666328382
PLN521 1 504826275
PLN522 1 702606209
PLN523 1 467876140
PLN524 1 566465558
PLN525 1 614421429
PLN526 1 698878671
PLN527 1 480431564
PLN528 1 735408736
PLN529 1 969998116
PLN53 4 370651368
PLN530 1 635024734
PLN531 10 3368
PLN532 1 595339094
PLN533 1 698605642
PLN534 1 499102108
PLN535 1 791748890
PLN536 1 797311483
PLN537 1 656817438
PLN538 1 753360318
PLN539 1 845838138
PLN54 2 271593360
PLN540 1 619661694
PLN541 1 752772853
PLN542 1 689709469
PLN543 1 509595892
PLN544 1 712797596
PLN545 1 710493282
PLN546 1 570643040
PLN547 1 619886155
PLN548 1 705533140
PLN549 1 484551304
PLN55 1 150766190
PLN550 1 740148362
PLN551 1 757233630
PLN552 1 642499559
PLN553 1 594006513
PLN554 1 693261537
PLN555 1 492948387
PLN556 1 781462734
PLN557 1 802944975
PLN558 1 650275864
PLN559 1 756841830
PLN56 2 288204953
PLN560 1 850623622
PLN561 1 614136911
PLN562 1 723255126
PLN563 1 669876730
PLN564 1 507533340
PLN565 1 712168462
PLN566 1 712339524
PLN567 1 564869106
PLN568 1 619418949
PLN569 1 715454519
PLN57 2 286787940
PLN570 1 478264344
PLN571 1 734693445
PLN572 1 749685439
PLN573 1 633598967
PLN574 191 140765345
PLN575 1 516505932
PLN576 1 665585731
PLN577 1 621516506
PLN578 1 610333535
PLN579 1 588218686
PLN58 2 295931502
PLN580 1 561794515
PLN581 1 632540561
PLN582 118 87991
PLN583 1 313789095
PLN584 1 248068439
PLN585 1 241454477
PLN586 1 251811976
PLN587 1 225452224
PLN588 1 173806927
PLN589 2 370152128
PLN59 50 360868274
PLN590 158 374282142
PLN591 599 391596749
PLN592 10 362580157
PLN593 7 281547701
PLN594 1 314258027
PLN595 1 394306295
PLN596 1 325599754
PLN597 1 288763641
PLN598 1 187311108
PLN599 1 277174932
PLN6 111696 128135306
PLN60 8 373615720
PLN600 1 235078182
PLN601 15 332895745
PLN602 16436 36185494
PLN603 5636 1862075
PLN604 5224 2478918
PLN605 1 563502314
PLN606 833 298337632
PLN607 1194 92707173
PLN608 1 594102056
PLN609 1 689851870
PLN61 7 376229618
PLN610 1 495453186
PLN611 1 780798557
PLN612 1 801256715
PLN613 1 651852609
PLN614 1 750843639
PLN615 1 830829764
PLN616 1 615552423
PLN617 1 744588157
PLN618 1 673617499
PLN619 1 509857067
PLN62 6 342806685
PLN620 1 709773743
PLN621 1 713149757
PLN622 1 566080677
PLN623 1 618079260
PLN624 1 720988478
PLN625 1 473592718
PLN626 1 736706236
PLN627 1 750620385
PLN628 1 638686055
PLN629 1 480980714
PLN63 6 347730275
PLN630 6684 330577769
PLN631 3760 370633860
PLN632 10097 326490424
PLN633 1753 12315783
PLN634 1 585266722
PLN635 1 681112512
PLN636 1 775448786
PLN637 1 790338525
PLN638 1 746673839
PLN639 1 836514780
PLN64 6 350661716
PLN640 1 736872137
PLN641 1 676292951
PLN642 1 669155517
PLN643 1 701372996
PLN644 1 615672275
PLN645 1 698614761
PLN646 1 728031845
PLN647 1 722970987
PLN648 12302 8480478
PLN649 94663 142071821
PLN65 43 144640005
PLN650 109265 181590851
PLN651 90304 195853653
PLN652 80527 197998663
PLN653 98715 191422274
PLN654 102271 190171111
PLN655 101947 188417681
PLN656 9926 22165276
PLN657 89526 204547491
PLN658 88989 203757767
PLN659 74454 219786613
PLN66 144 326417895
PLN660 30501 81358955
PLN661 71656 229068958
PLN662 75969 213199658
PLN663 60740 236629293
PLN664 74955 225372317
PLN665 51887 244696093
PLN666 15923 50601146
PLN667 62147 232657038
PLN668 43872 259925927
PLN669 53511 264485593
PLN67 7 298887356
PLN670 18746 68775490
PLN671 61848 155149450
PLN672 4 357989979
PLN673 5 248779719
PLN674 1 532083992
PLN675 1 684376481
PLN676 1 642597466
PLN677 1 631979072
PLN678 1 607115911
PLN679 1 582960187
PLN68 6 332369654
PLN680 1 640026769
PLN681 1 608979116
PLN682 1 720972993
PLN683 1 501257520
PLN684 1 804602427
PLN685 1 808121247
PLN686 1 649118519
PLN687 1 758906661
PLN688 1 861141126
PLN689 1 642382296
PLN69 50 340388796
PLN690 1 759893476
PLN691 1 689766370
PLN692 1 531462149
PLN693 1 714517032
PLN694 1 717288350
PLN695 1 586345039
PLN696 1 626266972
PLN697 1 738085275
PLN698 1 505809789
PLN699 1 759124079
PLN7 64151 184698553
PLN70 34 333743749
PLN700 1 751612808
PLN701 1 653055523
PLN702 7 358620060
PLN703 674 378721715
PLN704 1 322486422
PLN705 1 260047251
PLN706 1 262402055
PLN707 1 330012911
PLN708 1 349800169
PLN709 1 354403191
PLN71 1 48961553
PLN710 1 317988395
PLN711 1 376468909
PLN712 297 341997202
PLN713 6 385538869
PLN714 18 375740512
PLN715 12 364214839
PLN716 51 171035642
PLN717 38 343074766
PLN718 5 325733636
PLN719 11 384023275
PLN72 195 309764478
PLN720 10 375480087
PLN721 10 379071384
PLN722 9 351388705
PLN723 125 364494783
PLN724 10 394439500
PLN725 10 375932913
PLN726 10 373983960
PLN727 10 369372075
PLN728 37245 264839939
PLN73 6 336790634
PLN74 5 336035871
PLN75 6 326965702
PLN76 5 304407451
PLN77 13 303962775
PLN78 5 284426683
PLN79 8 327303441
PLN8 21750 106937494
PLN80 61 76849044
PLN81 2 355063454
PLN82 1 333667882
PLN83 1 302574826
PLN84 1 296818136
PLN85 1 257455782
PLN86 1 252943167
PLN87 1 225803546
PLN88 1 219123305
PLN89 2 394302667
PLN9 35233 291274408
PLN90 38 30696039
PLN91 15 305289289
PLN92 2 286029496
PLN93 2 307738366
PLN94 2 269669619
PLN95 1 157681923
PLN96 40 376080648
PLN97 33 389701062
PLN98 106 384154506
PLN99 99 346737635
PRI1 23047 60053106
PRI10 2265 387936439
PRI11 4375 381717987
PRI12 2068 191950792
PRI13 2459 391017609
PRI14 17343 243216304
PRI15 27929 79132073
PRI16 96050 166265556
PRI17 11025 363947920
PRI18 3741 383223079
PRI19 15303 353911286
PRI2 23840 319341223
PRI20 2239 172855211
PRI21 1 250749103
PRI22 1 238414537
PRI23 2 387789264
PRI24 2 351926207
PRI25 2 301224727
PRI26 2 270924633
PRI27 3 376243325
PRI28 4 374251276
PRI29 5 290585290
PRI3 2613 370370379
PRI30 42409 314482865
PRI31 18912 23568975
PRI32 53141 193817517
PRI33 4 351860731
PRI34 5 337827736
PRI35 3 297245061
PRI36 3 382019003
PRI37 2 285375381
PRI38 2 306826759
PRI39 2 354172067
PRI4 2409 360399901
PRI40 2 394680893
PRI41 1 242696752
PRI42 1 248387328
PRI43 17506 351876446
PRI44 118269 177479229
PRI45 43852 90882728
PRI46 74330 199952244
PRI47 54429 215566213
PRI48 34622 144332518
PRI49 69722 214218466
PRI5 2593 353874487
PRI50 97141 191928360
PRI51 158 230113596
PRI52 1 190673448
PRI53 9368 358512524
PRI54 48771 211007198
PRI55 83915 189800930
PRI56 58592 119478970
PRI6 2112 282951291
PRI7 2729 356953890
PRI8 3181 362167571
PRI9 2423 385530941
ROD1 38451 309764896
ROD10 15053 352243468
ROD11 1336 2453179
ROD12 22213 347967024
ROD13 1002 157743814
ROD14 53466 238707384
ROD15 21658 310382782
ROD16 228381 97417834
ROD17 97011 65140425
ROD18 38009 248623028
ROD19 2 383374219
ROD2 1810 346957759
ROD20 2 353017828
ROD21 2 317259772
ROD22 2 289653994
ROD23 1 140975125
ROD24 3 385591618
ROD25 4 335044383
ROD26 5 356599364
ROD27 2 394024503
ROD28 2 369416674
ROD29 2 335852806
ROD3 1885 352024250
ROD30 2 300392300
ROD31 2 283621167
ROD32 3 348161973
ROD33 5 386542915
ROD34 154 237877425
ROD35 1 193958709
ROD36 2 350925653
ROD37 2 319642044
ROD38 2 276360533
ROD39 3 382322699
ROD4 1943 360884621
ROD40 3 366447402
ROD41 84 245931526
ROD42 2 348668775
ROD43 2 314889876
ROD44 3 389462371
ROD45 3 321351180
ROD46 1 93020901
ROD47 5 385423505
ROD48 6 342729329
ROD49 3 325864489
ROD5 1990 363733749
ROD50 4 358685719
ROD51 4 302148481
ROD52 5 337904903
ROD53 6 385168143
ROD54 6 347801590
ROD55 6 283624907
ROD56 64732 199377972
ROD57 1 203594213
ROD58 2 307631349
ROD59 2 273205312
ROD6 306 57843793
ROD60 2 272523522
ROD61 3 367476852
ROD62 3 318205593
ROD63 5 305035074
ROD64 2 318173246
ROD65 2 308990189
ROD66 2 273361793
ROD67 3 387778067
ROD68 3 350884214
ROD69 4 388911322
ROD7 1975 368354297
ROD70 4 237246301
ROD71 2 368078907
ROD72 2 295232279
ROD73 2 276158786
ROD74 3 370764878
ROD75 3 367374895
ROD76 5 389069045
ROD77 20543 154840115
ROD8 1990 369693686
ROD9 1959 368016559
STS1 170456 86853136
STS10 202215 61355397
STS11 167032 59462482
STS2 143554 63344283
STS3 8245 4839643
STS4 108725 63673512
STS5 110379 70040590
STS6 106166 81423611
STS7 122521 86625645
STS8 198741 60873501
STS9 8954 2431337
SYN1 54442 100617525
SYN10 2 382762979
SYN11 2 332214168
SYN12 4 386933112
SYN13 1 271050050
SYN14 2 294093621
SYN15 3 329883353
SYN16 4 353920981
SYN17 2 328712085
SYN18 4 357672913
SYN19 1 207870274
SYN2 1 271050050
SYN20 2 382762979
SYN21 2 332214168
SYN22 8 392789107
SYN23 65482 196007195
SYN24 894 34300580
SYN25 9183 352928592
SYN26 17218 334475810
SYN27 109363 160506319
SYN28 32874 97953896
SYN29 8599 242419983
SYN3 2 294093621
SYN4 3 329883353
SYN5 4 353920981
SYN6 1 64242768
SYN7 3 371658272
SYN8 2 250483958
SYN9 1 207870274
TSA1 233379 79653713
TSA10 168620 151882439
TSA100 63252 114802277
TSA101 79841 41351312
TSA102 82721 28609319
TSA103 67721 19747702
TSA104 84021 22863253
TSA105 84236 21912832
TSA106 84446 20981295
TSA107 134042 46621688
TSA108 155667 149676184
TSA109 183730 101083950
TSA11 157833 129928381
TSA110 47348 107503283
TSA111 136867 166252974
TSA112 166495 124901244
TSA113 97423 237859520
TSA114 99257 234633653
TSA115 12708 5978473
TSA116 134189 172362066
TSA117 127781 180160426
TSA118 129595 177105775
TSA119 121186 168272985
TSA12 96970 81223522
TSA120 161588 123667649
TSA121 122311 187541168
TSA122 147961 145186533
TSA123 94592 61300137
TSA124 136202 168455642
TSA125 159235 124954199
TSA126 156460 125810552
TSA127 123500 121448801
TSA13 144445 166877725
TSA14 183179 128348861
TSA15 63956 19389564
TSA16 207559 109270376
TSA17 186915 104023410
TSA18 49380 65170400
TSA19 154738 149587836
TSA2 222489 88761403
TSA20 216986 100238238
TSA21 205873 104166326
TSA22 22693 12535715
TSA23 158964 127360041
TSA24 173318 148890122
TSA25 214965 83902995
TSA26 105827 75169883
TSA27 172910 71716168
TSA28 221930 89798997
TSA29 26888 19147632
TSA3 74606 22549982
TSA30 203801 105213489
TSA31 180460 145757585
TSA32 69461 30780900
TSA33 188249 126080028
TSA34 147105 171156456
TSA35 162844 143034354
TSA36 150188 161796191
TSA37 167342 152072055
TSA38 141406 134174466
TSA39 170369 157568728
TSA4 200107 117397278
TSA40 68539 95284697
TSA41 171892 122248327
TSA42 190077 128883583
TSA43 179565 129786674
TSA44 74788 42541556
TSA45 179837 148961559
TSA46 157618 110427650
TSA47 134614 95382384
TSA48 185173 132793697
TSA49 208467 104145310
TSA5 215390 134315100
TSA50 79060 109863998
TSA51 193270 109670524
TSA52 179789 118955400
TSA53 112018 117198240
TSA54 155065 135926838
TSA55 161491 91811831
TSA56 130880 143874686
TSA57 137221 81350084
TSA58 155281 162331143
TSA59 162870 156978878
TSA6 15756 19456676
TSA60 193460 121152461
TSA61 58307 95815324
TSA62 173904 118336485
TSA63 151865 162169634
TSA64 60981 124236666
TSA65 201109 152115772
TSA66 185638 143700395
TSA67 163423 121712708
TSA68 182114 137377481
TSA69 170731 97712914
TSA7 193738 53823711
TSA70 40637 38146354
TSA71 119065 123313318
TSA72 131964 141438855
TSA73 151655 115933671
TSA74 830 251943
TSA75 152989 102336522
TSA76 156503 143538644
TSA77 40595 33645981
TSA78 176683 138455592
TSA79 161932 158903820
TSA8 157351 121760532
TSA80 11473 9475196
TSA81 185669 115791752
TSA82 143388 147833423
TSA83 177758 145461495
TSA84 159207 177073302
TSA85 17073 11909470
TSA86 168307 128893220
TSA87 156344 150391937
TSA88 195417 125563889
TSA89 31946 22565095
TSA9 99887 68939156
TSA90 196286 138439609
TSA91 112986 113189975
TSA92 98986 206634893
TSA93 87112 229168164
TSA94 77344 247719367
TSA95 30093 107285833
TSA96 141033 144555977
TSA97 106053 76615758
TSA98 74413 65471527
TSA99 33768 32853514
UNA1 713 4436341
VRL1 132414 138777887
VRL10 44177 308098589
VRL100 2588 70143626
VRL101 9216 222070295
VRL102 9000 220925388
VRL103 8399 222314457
VRL104 3450 99018611
VRL105 7542 222798704
VRL106 8481 222342344
VRL107 7541 222039971
VRL108 7606 191489142
VRL109 7469 222617997
VRL11 115601 146305734
VRL110 7660 221917498
VRL111 7698 222064552
VRL112 2108 62823796
VRL113 7479 222259253
VRL114 7485 221552147
VRL115 8411 222475161
VRL116 7539 218218599
VRL117 7738 219687007
VRL118 7369 218154802
VRL119 8023 222001322
VRL12 22911 79776921
VRL120 3795 112794498
VRL121 7551 221475386
VRL122 7476 222844210
VRL123 8212 222941214
VRL124 7418 219925136
VRL125 87 2577293
VRL126 7849 218822501
VRL127 7721 222235544
VRL128 7514 220490813
VRL129 7373 218285751
VRL13 114063 144977044
VRL130 5199 154595161
VRL131 12365 369630589
VRL132 12387 370295291
VRL133 12393 370567303
VRL134 12384 370286134
VRL135 12382 370211898
VRL136 5593 167207813
VRL137 12391 370378994
VRL138 12393 370390238
VRL139 12395 370424114
VRL14 112585 147955960
VRL140 7993 238860319
VRL141 12409 370814633
VRL142 12404 370667524
VRL143 12459 371903729
VRL144 5733 170858745
VRL145 7445 221929148
VRL146 7873 222585801
VRL147 7444 221865957
VRL148 2717 80820397
VRL149 7650 223348921
VRL15 26373 44259789
VRL150 7457 222064080
VRL151 7598 222200402
VRL152 8204 221526099
VRL153 3722 110331731
VRL154 7512 220722783
VRL155 7408 219833868
VRL156 7409 219748913
VRL157 3588 103837431
VRL158 7413 219157477
VRL159 7527 222563592
VRL16 91100 158466153
VRL160 7488 219920420
VRL161 7609 223004974
VRL162 4429 124200516
VRL163 7764 221768439
VRL164 7450 221516016
VRL165 7363 218047165
VRL166 7914 221352857
VRL167 3570 99729366
VRL168 7443 221912979
VRL169 7417 220600930
VRL17 96717 150177445
VRL170 7454 220827257
VRL171 5055 150614940
VRL172 7533 221973138
VRL173 7456 221885618
VRL174 7462 219507196
VRL175 2191 64820359
VRL176 7522 221905234
VRL177 7821 222009260
VRL178 7433 220989056
VRL179 2274 66973885
VRL18 60953 99688982
VRL180 7855 222784820
VRL181 7627 223205749
VRL182 7631 223011146
VRL183 6943 203972089
VRL184 7364 218005430
VRL185 7498 222152562
VRL186 7560 223117835
VRL187 7463 221896947
VRL188 7447 221890174
VRL189 7602 222279181
VRL19 92385 166032863
VRL190 7442 221347380
VRL191 2515 75010713
VRL192 7600 221963321
VRL193 7387 219054561
VRL194 7528 220390955
VRL195 5270 156999921
VRL196 7482 222890054
VRL197 7617 222921322
VRL198 7554 221837223
VRL199 3027 90259423
VRL2 126444 151471712
VRL20 91155 163931909
VRL200 7435 219464199
VRL201 7406 219724563
VRL202 7457 222066680
VRL203 3598 105987095
VRL204 7524 223593418
VRL205 7572 224219932
VRL206 7577 222246985
VRL207 7447 221713651
VRL208 2048 57727519
VRL209 7519 222412726
VRL21 53961 120923805
VRL210 7431 221233234
VRL211 7386 219102489
VRL212 4893 145324823
VRL213 7511 221910656
VRL214 8131 223124821
VRL215 7552 224876222
VRL216 6398 185520356
VRL217 7483 221806706
VRL218 7481 222674161
VRL219 7395 219451019
VRL22 83155 172778768
VRL220 3809 109022083
VRL221 7558 223034392
VRL222 7524 223014582
VRL223 7472 222216004
VRL224 7292 216327617
VRL225 7456 222171623
VRL226 7383 219061715
VRL227 7424 221068122
VRL228 2626 78049171
VRL229 7552 223238227
VRL23 85993 167265659
VRL230 7552 222079339
VRL231 7477 222133967
VRL232 7554 222599811
VRL233 7619 222029230
VRL234 2870 85284253
VRL235 7452 221759674
VRL236 7381 219102170
VRL237 7431 221234825
VRL238 7453 222416660
VRL239 1031 30733164
VRL24 69463 119030629
VRL240 7569 223034763
VRL241 7473 222923340
VRL242 7452 222456927
VRL243 7583 223559616
VRL244 2233 66446665
VRL245 7457 221635917
VRL246 7410 220601824
VRL247 7434 221590460
VRL248 6344 188895014
VRL249 7533 222875801
VRL25 82970 167612962
VRL250 7438 221584316
VRL251 7520 222336956
VRL252 5183 154361376
VRL253 7573 219801182
VRL254 7412 220547796
VRL255 7451 221917771
VRL256 4339 108886662
VRL257 7457 221379308
VRL258 7569 223431441
VRL259 7456 222057880
VRL26 83252 167328982
VRL260 6288 187154162
VRL261 7462 222349861
VRL262 7399 219903249
VRL263 7481 222256072
VRL264 4588 126597123
VRL265 7459 222258777
VRL266 7474 222595538
VRL267 7448 221867952
VRL268 3487 103835298
VRL269 7454 222321174
VRL27 50274 112038035
VRL270 7492 223015063
VRL271 7432 221420391
VRL272 4304 128254661
VRL273 12227 365134813
VRL274 12346 368941421
VRL275 6276 187454790
VRL276 1904 56895892
VRL277 12412 370879597
VRL278 12615 376530246
VRL279 12642 377214922
VRL28 88466 184808853
VRL280 6339 188939939
VRL281 12640 377031424
VRL282 12732 379414321
VRL283 12742 379705519
VRL284 7006 208976171
VRL285 12705 378687920
VRL286 12643 377171669
VRL287 12570 374982296
VRL288 4234 126319737
VRL289 12563 374631629
VRL29 48181 281024838
VRL290 12551 374528581
VRL291 12589 375488908
VRL292 3548 106009595
VRL293 12492 372907154
VRL294 12432 371444506
VRL295 12406 370719895
VRL296 6412 191544890
VRL297 12420 370922953
VRL298 12405 370740440
VRL299 12392 370374902
VRL3 100365 122798920
VRL30 73207 193329123
VRL300 3446 102996629
VRL301 12465 372209245
VRL302 12442 371607689
VRL303 12298 368780193
VRL304 6433 192236959
VRL305 12555 374690328
VRL306 12414 370927670
VRL307 12130 362534777
VRL308 3014 90082279
VRL309 12422 371167299
VRL31 37939 87605889
VRL310 12261 366451044
VRL311 12386 370106341
VRL312 11574 345921941
VRL313 12375 369587244
VRL314 12390 369740875
VRL315 12379 370001711
VRL316 2818 84233233
VRL317 12290 367379494
VRL318 12510 373034066
VRL319 12366 369235414
VRL32 67784 182231549
VRL320 8841 264242569
VRL321 12371 369579323
VRL322 12404 370568074
VRL323 12579 375437866
VRL324 12370 369707372
VRL325 6792 202887204
VRL326 12355 369205246
VRL327 12444 371704645
VRL328 12371 369747768
VRL329 12440 371544438
VRL33 77053 186601686
VRL330 1311 39148614
VRL331 12301 367635353
VRL332 12375 369821506
VRL333 12376 369854194
VRL334 9922 296540679
VRL335 12418 371109515
VRL336 12357 369316303
VRL337 12364 369502706
VRL338 8756 261662439
VRL339 12392 370309151
VRL34 65127 153346634
VRL340 12364 369530954
VRL341 12373 369795214
VRL342 6051 180847472
VRL343 12089 361310448
VRL344 11884 355177935
VRL345 12279 366995197
VRL346 12379 369940129
VRL347 570 17013008
VRL348 12439 371649960
VRL349 12231 365563714
VRL35 75273 192269322
VRL350 12376 369888686
VRL351 12358 369342861
VRL352 2911 87000964
VRL353 12296 367175259
VRL354 12392 370337006
VRL355 12637 376641056
VRL356 3475 103531946
VRL357 12423 371100313
VRL358 12499 373201033
VRL359 12414 370789479
VRL36 83574 171872428
VRL360 11257 336322505
VRL361 12266 366416888
VRL362 12486 372717575
VRL363 12366 369573371
VRL364 12360 369353490
VRL365 3266 97611260
VRL366 12432 370526059
VRL367 12374 369743924
VRL368 12247 366038327
VRL369 5681 169794634
VRL37 70817 140929893
VRL370 12470 372461867
VRL371 12606 375805530
VRL372 12380 370004101
VRL373 12402 370640890
VRL374 12384 370120977
VRL375 31260 77097281
VRL38 79285 176377833
VRL39 67236 183068515
VRL4 94614 149040310
VRL40 42034 198262593
VRL41 18158 125567214
VRL42 24376 217375070
VRL43 15527 218692718
VRL44 33648 206750888
VRL45 6853 118777801
VRL46 16140 220046602
VRL47 22228 215349921
VRL48 15309 218639047
VRL49 6502 121688709
VRL5 87219 144400840
VRL50 12868 220105592
VRL51 8837 220841044
VRL52 9545 221384011
VRL53 4516 111298304
VRL54 8354 223689438
VRL55 8768 220992696
VRL56 8364 222453327
VRL57 9289 222012664
VRL58 3411 77518848
VRL59 9790 221537232
VRL6 93293 144785513
VRL60 12688 218205428
VRL61 7816 221605104
VRL62 9534 220916918
VRL63 2364 66266321
VRL64 7489 220957043
VRL65 7760 222142993
VRL66 9095 219451984
VRL67 18431 213031018
VRL68 2333 65673048
VRL69 7736 220619790
VRL7 130391 141296444
VRL70 7520 221225121
VRL71 7997 220761438
VRL72 6345 179771599
VRL73 7806 221565981
VRL74 8124 220522342
VRL75 7574 219657736
VRL76 5907 156307860
VRL77 11088 220062973
VRL78 7652 219851287
VRL79 8092 221744641
VRL8 70174 88335781
VRL80 4790 137374224
VRL81 7424 220835960
VRL82 7603 222380069
VRL83 7631 222865514
VRL84 631 18365850
VRL85 8235 222098988
VRL86 7743 222153458
VRL87 7421 220933452
VRL88 3049 82367332
VRL89 7543 222410132
VRL9 121328 144536257
VRL90 8523 221659559
VRL91 7568 220841042
VRL92 2974 78251834
VRL93 9227 219104789
VRL94 7968 222084387
VRL95 8155 223112882
VRL96 3658 97248403
VRL97 8854 222603105
VRL98 8921 223070145
VRL99 9519 222484992
VRT1 70024 272630303
VRT10 37396 74041240
VRT100 1 839681426
VRT101 1 825560060
VRT102 1 595904407
VRT103 1 486875112
VRT104 1 387033265
VRT105 1 371528181
VRT106 1 313513962
VRT107 1 277530821
VRT108 1 268302114
VRT109 3 319484498
VRT11 18698 27611025
VRT110 5 386368861
VRT111 7 393936069
VRT112 7 384166854
VRT113 1 46063367
VRT114 7 344525641
VRT115 6 384186008
VRT116 8 388949147
VRT117 332 334400544
VRT118 1 222115097
VRT119 3 377547369
VRT12 5986 380511905
VRT120 10 383496928
VRT121 33 389650655
VRT122 6 59236435
VRT123 1 772932187
VRT124 1 662004353
VRT125 1 535506559
VRT126 1 376147139
VRT127 1 364230008
VRT128 1 346409914
VRT129 1 311292523
VRT13 3363 217068541
VRT130 1 247732340
VRT131 1 228143320
VRT132 1 221182781
VRT133 2 321892640
VRT134 490 332426844
VRT135 12 378048109
VRT136 9 378909870
VRT137 6 345737823
VRT138 2 137693511
VRT139 7 385107928
VRT14 4685 4674270
VRT140 8 360581972
VRT141 10 364952837
VRT142 4 133261911
VRT143 8 359905961
VRT144 5 370674748
VRT145 9 378247816
VRT146 6 166907986
VRT147 14 379842153
VRT148 15 375595384
VRT149 41 289507176
VRT15 1171 26255719
VRT150 11 366984719
VRT151 14 374291772
VRT152 10 185283047
VRT153 1 550518975
VRT154 1 529596002
VRT155 1 413748038
VRT156 1 326378286
VRT157 1 272612222
VRT158 1 260396842
VRT159 1 197956435
VRT16 293 13983146
VRT160 2 384149701
VRT161 2 288058306
VRT162 4 353983664
VRT163 461 371881983
VRT164 2 310725315
VRT165 2 280326572
VRT166 3 371471404
VRT167 3 354148189
VRT168 3 303679844
VRT169 4 341249946
VRT17 37 392789976
VRT170 382 371460784
VRT171 13 392880011
VRT172 13 164097178
VRT173 1 313568160
VRT174 1 289498315
VRT175 1 277254249
VRT176 1 244324502
VRT177 1 233859027
VRT178 1 225974235
VRT179 1 211674833
VRT18 13 392458500
VRT180 1 199962141
VRT181 2 390673241
VRT182 2 334991523
VRT183 2 324316137
VRT184 2 292002398
VRT185 1 133841611
VRT186 3 336899598
VRT187 28 389500106
VRT188 6 332993899
VRT189 6 378599539
VRT19 12 379958897
VRT190 1 47256133
VRT191 6 330076811
VRT192 7 362796652
VRT193 8 365387335
VRT194 20 273534543
VRT195 9 378695651
VRT196 11 392251032
VRT197 205 341394663
VRT198 7 347210350
VRT199 7 370650631
VRT2 72835 271698363
VRT20 11 316368323
VRT200 8 391548385
VRT201 6 385659507
VRT202 7 341110862
VRT203 1 55350661
VRT204 8 387616857
VRT205 3 259325358
VRT206 5 392602723
VRT207 41 394037361
VRT208 3 148003845
VRT209 7 387415360
VRT21 13 385338369
VRT210 7 365756282
VRT211 6 352657526
VRT212 5 346047628
VRT213 2 134650353
VRT214 5 356250620
VRT215 6 374573269
VRT216 6 364137996
VRT217 7 343458516
VRT218 2 121348818
VRT219 7 358240592
VRT22 14 372163844
VRT220 8 383435354
VRT221 8 365970383
VRT222 6 357597984
VRT223 7 355728138
VRT224 8 362648569
VRT225 7 390172982
VRT226 8 391413434
VRT227 8 377681388
VRT228 1 42933508
VRT229 100 376541917
VRT23 14 352781625
VRT230 20 391000381
VRT231 13 383659375
VRT232 58 386123281
VRT233 11 394338841
VRT234 11 274288418
VRT235 1 843366180
VRT236 1 842558404
VRT237 1 707956555
VRT238 1 635713434
VRT239 1 567300182
VRT24 19 384683297
VRT240 1 439630435
VRT241 1 236595445
VRT242 1 231667822
VRT243 2 382351630
VRT244 2 103223822
VRT245 1 690654357
VRT246 1 541439571
VRT247 1 495417988
VRT248 1 481763206
VRT249 1 429350720
VRT25 16 379729070
VRT250 1 224823088
VRT251 1 212589178
VRT252 2 374746477
VRT253 2 318111367
VRT254 32 270969991
VRT255 2 352563619
VRT256 7 386835620
VRT257 4314 352825248
VRT258 19 370712563
VRT259 15988 152796988
VRT26 16 381718727
VRT260 139344 132737398
VRT261 144440 125658042
VRT262 131311 124639283
VRT263 134283 133926968
VRT264 5 383094575
VRT265 5 374381301
VRT266 16 387558511
VRT267 41 262370602
VRT268 14 376657571
VRT269 16 394062851
VRT27 2 51507477
VRT270 16 377073984
VRT271 8 278699154
VRT272 13 345916081
VRT273 3 386677656
VRT274 5 363840571
VRT275 26 375942556
VRT276 11 392818628
VRT277 13210 328615031
VRT28 6 344600068
VRT29 7 384846875
VRT3 9006 334129504
VRT30 7 359521465
VRT31 33 269170512
VRT32 147 10842596
VRT33 586 15797052
VRT34 2343 67436863
VRT35 19198 357652178
VRT36 54157 304795318
VRT37 158681 137228288
VRT38 18089 13374643
VRT39 117693 200745678
VRT4 3 141387178
VRT40 84130 68199786
VRT41 2 304060631
VRT42 6 387303573
VRT43 28 305102738
VRT44 156524 129498792
VRT45 39643 26607666
VRT46 185764 123620850
VRT47 148584 105819123
VRT48 168363 113478362
VRT49 8428 7214021
VRT5 8 354279535
VRT50 133023 105740718
VRT51 156399 117964862
VRT52 142031 87313772
VRT53 188518 120085844
VRT54 103239 61379831
VRT55 157552 119284532
VRT56 157298 129049054
VRT57 129 388713808
VRT58 358 381748347
VRT59 1698 374024838
VRT6 11 387350249
VRT60 93605 262107503
VRT61 145106 21008965
VRT62 75789 25336814
VRT63 13375 365641119
VRT64 20 379347618
VRT65 270 393447049
VRT66 3067 391133617
VRT67 3471 230588304
VRT68 6925 378855996
VRT69 16 388667304
VRT7 11 393947221
VRT70 16 378559418
VRT71 12 379509384
VRT72 7 285874095
VRT73 12 387522266
VRT74 18 375242791
VRT75 16 386329687
VRT76 229 277860126
VRT77 17 367327734
VRT78 15 385834222
VRT79 7 149460915
VRT8 30744 333424138
VRT80 1 356776219
VRT81 1 350268637
VRT82 1 316334699
VRT83 1 337490635
VRT84 1 252032905
VRT85 1 217689105
VRT86 1 199443007
VRT87 1 198537509
VRT88 2 368166310
VRT89 2 330550494
VRT9 74952 70629182
VRT90 1 146904662
VRT91 3 319096504
VRT92 7 379783228
VRT93 11 374771935
VRT94 13 379441801
VRT95 3 70710155
VRT96 16 344076996
VRT97 10 385210617
VRT98 15 392781064
VRT99 22 370094349
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 247.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:
Entries Bases Species
1942643 172374634626 Triticum aestivum
1347430 97059428399 Hordeum vulgare subsp. vulgare
2703508 80497317866 Severe acute respiratory syndrome coronavirus 2
27437763 27714770678 Homo sapiens
150422 13502686559 Escherichia coli
1730239 10890050390 Danio rerio
2241632 10650539694 Bos taurus
10029578 10459557283 Mus musculus
23087 9981497962 Triticum turgidum subsp. durum
4219695 7411312909 Zea mays
21316 7083888984 Klebsiella pneumoniae
21523 6749236152 Secale cereale
2202024 6547403015 Rattus norvegicus
1471062 5775151674 Canis lupus familiaris
54 5178626132 Rhinatrema bivittatum
3307728 5083049438 Sus scrofa
1955 4991603121 Bufo bufo
17 4548077046 Microcaecilia unicolor
29708 4348333235 Hordeum vulgare subsp. spontaneum
10371 4262019239 Macrobrachium nipponense
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
187 Dec 2011 135117731375 146413798
188 Feb 2012 137384889783 149819246
189 Apr 2012 139266481398 151824421
190 Jun 2012 141343240755 154130210
191 Aug 2012 143081765233 156424033
192 Oct 2012 145430961262 157889737
193 Dec 2012 148390863904 161140325
194 Feb 2013 150141354858 162886727
195 Apr 2013 151178979155 164136731
196 Jun 2013 152599230112 165740164
197 Aug 2013 154192921011 167295840
198 Oct 2013 155176494699 168335396
199 Dec 2013 156230531562 169331407
200 Feb 2014 157943793171 171123749
201 Apr 2014 159813411760 171744486
202 Jun 2014 161822845643 173353076
203 Aug 2014 165722980375 174108750
204 Oct 2014 181563676918 178322253
205 Dec 2014 184938063614 179295769
206 Feb 2015 187893826750 181336445
207 Apr 2015 189739230107 182188746
208 Jun 2015 193921042946 185019352
209 Aug 2015 199823644287 187066846
210 Oct 2015 202237081559 188372017
211 Dec 2015 203939111071 189232925
212 Feb 2016 207018196067 190250235
213 Apr 2016 211423912047 193739511
214 Jun 2016 213200907819 194463572
215 Aug 2016 217971437647 196120831
216 Oct 2016 220731315250 197390691
217 Dec 2016 224973060433 198565475
218 Feb 2017 228719437638 199341377
219 Apr 2017 231824951552 200877884
220 Jun 2017 234997362623 201663568
221 Aug 2017 240343378258 203180606
222 Oct 2017 244914705468 203953682
223 Dec 2017 249722163594 206293625
224 Feb 2018 253630708098 207040555
225 Apr 2018 260189141631 208452303
226 Jun 2018 263957884539 209775348
227 Aug 2018 260806936411 208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
228 Oct 2018 279668290132 209656636
229 Dec 2018 285688542186 211281415
230 Feb 2019 303709510632 212260377
231 Apr 2019 321680566570 212775414
232 Jun 2019 329835282370 213383758
233 Aug 2019 366733917629 213865349
234 Oct 2019 386197018538 216763706
235 Dec 2019 388417258009 215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
236 Feb 2020 399376854872 216214215
237 Apr 2020 415770027949 216531829
238 Jun 2020 427823258901 217122233
239 Aug 2020 654057069549 218642238
240 Oct 2020 698688094046 219055207
241 Dec 2020 723003822007 221467827
242 Feb 2021 776291211106 226241476
243 Apr 2021 832400799511 227123201
244 Jun 2021 866009790959 227888889
245 Aug 2021 940513260726 231982592
246 Oct 2021 1014763752113 233642893
247 Dec 2021 1053275115030 234557297
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
187 Dec 2011 239868309609 73729553
188 Feb 2012 261370512675 78656704
189 Apr 2012 272693351548 80905298
190 Jun 2012 287577367116 82076779
191 Aug 2012 308196411905 84020064
192 Oct 2012 333881846451 86480509
193 Dec 2012 356002922838 92767765
194 Feb 2013 390900990416 103101291
195 Apr 2013 418026593606 110509314
196 Jun 2013 453829752320 112488036
197 Aug 2013 500420412665 124812020
198 Oct 2013 535842167741 130203205
199 Dec 2013 556764321498 133818570
200 Feb 2014 591378698544 139725795
201 Apr 2014 621015432437 143446790
202 Jun 2014 719581958743 175779064
203 Aug 2014 774052098731 189080419
204 Oct 2014 805549167708 196049974
205 Dec 2014 848977922022 200301550
206 Feb 2015 873281414087 205465046
207 Apr 2015 969102906813 243779199
208 Jun 2015 1038937210221 258702138
209 Aug 2015 1163275601001 302955543
210 Oct 2015 1222635267498 309198943
211 Dec 2015 1297865618365 317122157
212 Feb 2016 1399865495608 333012760
213 Apr 2016 1452207704949 338922537
214 Jun 2016 1556175944648 350278081
215 Aug 2016 1637224970324 359796497
216 Oct 2016 1676238489250 363213315
217 Dec 2016 1817189565845 395301176
218 Feb 2017 1892966308635 409490397
219 Apr 2017 2035032639807 451840147
220 Jun 2017 2164683993369 487891767
221 Aug 2017 2242294609510 499965722
222 Oct 2017 2318156361999 508825331
223 Dec 2017 2466098053327 551063065
224 Feb 2018 2608532210351 564286852
225 Apr 2018 2784740996536 621379029
226 Jun 2018 2944617324086 639804105
227 Aug 2018 3204855013281 665309765
228 Oct 2018 3444172142207 722438528
229 Dec 2018 3656719423096 773773190
230 Feb 2019 4164513961679 945019312
231 Apr 2019 4421986382065 993732214
232 Jun 2019 4847677297950 1022913321
233 Aug 2019 5585922333160 1075272215
234 Oct 2019 5985250251028 1097629174
235 Dec 2019 6277551200690 1127023870
236 Feb 2020 6968991265752 1206720688
237 Apr 2020 7788133221338 1267547429
238 Jun 2020 8114046262158 1302852615
239 Aug 2020 8841649410652 1408122887
240 Oct 2020 9215815569509 1432874252
241 Dec 2020 11830842428018 1517995689
242 Feb 2021 12270717209612 1563938043
243 Apr 2021 12732048052023 1590670459
244 Jun 2021 13442974346437 1632796606
245 Aug 2021 13888187863722 1653427055
246 Oct 2021 14599101574547 1721064101
247 Dec 2021 14922033922302 1734664952
The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.
TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).
Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.
Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tsa
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.
Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.
Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.
Release Date Base Pairs Entries
201 Apr 2014 23632325832 29734989
202 Jun 2014 31707343431 38011942
203 Aug 2014 33676182560 40556905
204 Oct 2014 36279458440 43567759
205 Dec 2014 46056420903 62635617
206 Feb 2015 49765340047 66706014
207 Apr 2015 55796332435 71989588
208 Jun 2015 60697472570 76974601
209 Aug 2015 69360654413 87827013
210 Oct 2015 70917172944 81790031
211 Dec 2015 77583339176 87488539
212 Feb 2016 81932555094 92132318
213 Apr 2016 87811163676 98147566
214 Jun 2016 94413958919 104677061
215 Aug 2016 103399742586 113179607
216 Oct 2016 113209225762 124199597
217 Dec 2016 125328824508 142094337
218 Feb 2017 133517212104 151431485
219 Apr 2017 149038907599 165068542
220 Jun 2017 158112969073 176812130
221 Aug 2017 167045663417 186777106
222 Oct 2017 172909268535 192754804
223 Dec 2017 181394660188 201559502
224 Feb 2018 193940551226 214324264
225 Apr 2018 205232396043 227364990
226 Jun 2018 216556686631 238788334
227 Aug 2018 225520004678 249295386
228 Oct 2018 235875573598 259927414
229 Dec 2018 248592892188 274845473
230 Feb 2019 263936885705 294772430
231 Apr 2019 277118019688 311247136
232 Jun 2019 285390240861 319927264
233 Aug 2019 294727165179 331347807
234 Oct 2019 305371891408 342811151
235 Dec 2019 325433016129 367193844
236 Feb 2020 340994289065 386644871
237 Apr 2020 349692751528 396392280
238 Jun 2020 359947709062 409725050
239 Aug 2020 366968951160 417524567
240 Oct 2020 382996662270 435968379
241 Dec 2020 392206975386 446397378
242 Feb 2021 407605409948 463151000
243 Apr 2021 425076483459 481154920
244 Jun 2021 436594941165 494641358
245 Aug 2021 440578422611 498305045
246 Oct 2021 449891016597 508319391
247 Dec 2021 455870853358 514158576
The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.
Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
ftp://ftp.ncbi.nih.gov/genbank/tls
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.
Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.
Release Date Base Pairs Entries
217 Dec 2016 584697919 1268690
218 Feb 2017 636923295 1438349
219 Apr 2017 636923295 1438349 (unchanged)
220 Jun 2017 824191338 1628475
221 Aug 2017 824191338 1628475 (unchanged)
222 Oct 2017 2993818315 9479460
223 Dec 2017 4458042616 12695198
224 Feb 2018 4531966831 12819978
225 Apr 2018 5612769448 14782654
226 Jun 2018 5896511468 15393041
227 Aug 2018 6077824493 15822538
228 Oct 2018 8435112913 20752288
229 Dec 2018 8511829281 20924588
230 Feb 2019 9146836085 23259929
231 Apr 2019 9623321565 24240761
232 Jun 2019 10182427815 25530139
233 Aug 2019 10531800829 26363945
234 Oct 2019 10848455369 27460978
235 Dec 2019 11280596614 28227180
236 Feb 2020 13669678196 34037371
237 Apr 2020 24615270313 65521132
238 Jun 2020 27500635128 75063181
239 Aug 2020 27825059498 75682157
240 Oct 2020 28814798868 78177358
241 Dec 2020 33036509446 88039152
242 Feb 2021 33634122995 90130561
243 Apr 2021 37998534461 102395753
244 Jun 2021 38198113354 102662929
245 Aug 2021 39930167315 106995218
246 Oct 2021 40168874815 107569935
247 Dec 2021 41143480750 109379021
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
December 15 2021
NCBI-GenBank Flat File Release 247.0
Bacterial Sequences (Part 1)
51396 loci, 92682287 bases, from 51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.
NOTE : Presentation of GI sequence identifiers in the GenBank
flatfile format was discontinued as of March 2017.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, possibly 'LINEAGE'. But because changes like this can be
very disruptive for customers, implementation has not yet been scheduled.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
3.4.4.1 : Important notice about parsing the LOCUS line
Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.
Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.
Consider this LOCUS line for a typical complete bacterial genome:
LOCUS CP032762 5868661 bp DNA circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:
LOCUS AZZZAA02123456789 9999999999 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:
LOCUS AZZZAA0212345678910000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:
LOCUS AZZZAA02123456789 10000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.
3.4.4.2 : Data elements of the LOCUS line
The data elements of the LOCUS line format and their typical/historical
column positions are as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus Name (usually identical to the Accession Number)
29-29 space
30-40 Sequence Length, right-justified
41-41 space
42-43 'bp'
44-44 space
45-47 Strandedness : spaces (if not known), ss- (single-stranded),
ds- (double-stranded), or ms- (mixed-stranded)
48-53 Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA).
Left justified.
54-55 space
56-63 Molecule Topology : 'linear' followed by two spaces,
or 'circular'
64-64 space
65-67 Division Code
68-68 space
69-79 Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.
The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :
LOCUS HUMPDNRC 273 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S125 polymorphic dinucleotide repeat.
ACCESSION L10620
LOCUS HUMPDNRG 169 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S114 polymorphic dinucleotide repeat.
ACCESSION L10624
But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:
LOCUS AF035771 1357 bp mRNA linear PRI 30-JUN-1998
DEFINITION Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
complete cds.
ACCESSION AF035771
The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :
PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags)
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites)
GSS - GSS sequences (Genome Survey Sequences)
HTG - HTGS sequences (High Throughput Genomic sequences)
HTC - HTC sequences (High Throughput cDNA sequences)
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences
The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1
^^^^^^^^^^
Compound
Accession.Version
Number
A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:
http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS ANHA01000001 503 bp DNA linear BCT 23-NOV-2012
DEFINITION Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION ANHA01000001 ANHA01000000
VERSION ANHA01000001.1
DBLINK BioProject: PRJNA177352
BioSample: SAMN01795900
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK BioProject:PRJNA174162,PRJNA999998,PRJNA999999
And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.
As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".
DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:
http://www.ncbi.nlm.nih.gov/bioproject
At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:
http://www.ncbi.nlm.nih.gov/books/NBK54016/
DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:
http://www.ncbi.nlm.nih.gov/assembly
At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:
http://www.ncbi.nlm.nih.gov/assembly/help/
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:
http://www.insdc.org/documents/feature-table
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.2
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
The list of valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.3
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS KZ271580 141308 bp DNA linear CON 17-AUG-2017
DEFINITION Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION KZ271580 LQNL01000000
VERSION KZ271580.1
DBLINK BioProject: PRJNA230512
BioSample: SAMN04226856
KEYWORDS WGS; HIGH_QUALITY_DRAFT.
...
mRNA complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/product="hypothetical protein"
CDS complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/codon_start=1
/product="hypothetical protein"
/protein_id="OZC04795.1"
/db_xref="GI:1233056989"
/translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Scaffold/CON-division join() sequence
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.
The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] .
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Sayers E, Cavanaugh M, Clark K, Ostell J, Pruitt K,
Karsch-Mizrachi I, "GenBank", Nucleic Acids Research,
Volume 47, Issue D1, January 2019, pp. D94-D99
PMID: 30365038
PMCID: PMC6323954
DOI: 10.1093/nar/gky989
The following statement is an example of how one might cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'
(1) Sayers, E. et al, Nucleic Acids Res. 47(D1):D94-D99 (2019)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: Simply direct your web browser of choice to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] .
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 218.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
Vincent Calhoun, Andreina Castillo Siri, Larry Chlumsky, Karen Clark,
Scott Durkin, Francescopaolo di Cello, Michel Eschenbrenner,
Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Augustus Tilley,
Beverly Underwood, Simone Walker and Linda Yankie
Data Management and Preparation
Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
Sergiy Gotvyanskyy, Eugene Gribov, Jonathan Kans, Leonid Khotomliansky,
Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh, Alex Kotliarov,
Frank Ludwig, Anatoly Mnev, Vasuki Palanigobu,
Anton Perkov, Andriy Petrow, Sergey Petrunin, Wenyao Shi, Denis Sinyakov,
Thomas Smith, Vladimir Soussov, Elena Starchenko, Hanzhen Sun,
Andrei Vereshchagin, Jewen Xiao, Eugene Yaschenko, Liwei Zhou
Database Administration
Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
Benjamin Slade, Constantin Vasilyev
Customer Support
Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian
Project Direction
Steve Sherry : Acting Director, NCBI
Kim Pruitt : Branch Chief, NCBI/IEB
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
