U.S. flag

An official website of the United States government

Release Notes For GenBank Release 247

GBREL.TXT          Genetic Sequence Data Bank
                         December 15 2021

               NCBI-GenBank Flat File Release 247.0

                    Distribution Release Notes

  234557297 sequences,  1053275115030 bases, for traditional GenBank records
 2358202549 sequences, 15419048256410 bases, for set-based (WGS/TSA/TLS) records

  This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://www.ncbi.nlm.nih.gov/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 247.0
1.2 Cutoff Date
1.3 Important Changes in Release 247.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 247.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  [email protected]

Updates and changes to existing GenBank records:

       E-MAIL:  [email protected]

URL for GenBank's web-based submission tool (BankIt) :

       http://www.ncbi.nlm.nih.gov/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 247.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

  GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:

        ftp://ftp.ncbi.nih.gov/genbank/wgs
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	
        ftp://ftp.ncbi.nih.gov/genbank/tsa
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	
        ftp://ftp.ncbi.nih.gov/genbank/tls
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls

See the README files in those areas for more information.

  Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:

	ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/

  Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.

1.2 Cutoff Date

  This full release, 247.0, incorporates data processed by the INSDC databases
as of Tuesday December 14 2021 at 5:33AM EST. For more recent data, users are
advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotide' database (see Section 6.4 of this document).

1.3 Important Changes in Release 247.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 154 with this release:
  
  - the BCT division is now composed of 688 files (+25)
  - the CON division is now composed of 223 files (+1)
  - the INV division is now composed of 488 files (+27)
  - the MAM division is now composed of 116 files (+17)
  - the PLN division is now composed of 728 files (+5)
  - the PRI division is now composed of  56 files (+1)
  - the VRL division is now composed of 375 files (+78)

1.4 Upcoming Changes

  No changes to the GenBank flatfile format are planned at this time.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the ENA and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : [email protected]

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the ENA and DDBJ databases.
BankIt may be used with any modern web browser. You can access BankIt
from GenBank's home page:   

	http://www.ncbi.nlm.nih.gov/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] .

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 4454 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct395.seq - Bacterial sequence entries, part 395.
330. gbbct396.seq - Bacterial sequence entries, part 396.
331. gbbct397.seq - Bacterial sequence entries, part 397.
332. gbbct398.seq - Bacterial sequence entries, part 398.
333. gbbct399.seq - Bacterial sequence entries, part 399.
334. gbbct4.seq - Bacterial sequence entries, part 4.
335. gbbct40.seq - Bacterial sequence entries, part 40.
336. gbbct400.seq - Bacterial sequence entries, part 400.
337. gbbct401.seq - Bacterial sequence entries, part 401.
338. gbbct402.seq - Bacterial sequence entries, part 402.
339. gbbct403.seq - Bacterial sequence entries, part 403.
340. gbbct404.seq - Bacterial sequence entries, part 404.
341. gbbct405.seq - Bacterial sequence entries, part 405.
342. gbbct406.seq - Bacterial sequence entries, part 406.
343. gbbct407.seq - Bacterial sequence entries, part 407.
344. gbbct408.seq - Bacterial sequence entries, part 408.
345. gbbct409.seq - Bacterial sequence entries, part 409.
346. gbbct41.seq - Bacterial sequence entries, part 41.
347. gbbct410.seq - Bacterial sequence entries, part 410.
348. gbbct411.seq - Bacterial sequence entries, part 411.
349. gbbct412.seq - Bacterial sequence entries, part 412.
350. gbbct413.seq - Bacterial sequence entries, part 413.
351. gbbct414.seq - Bacterial sequence entries, part 414.
352. gbbct415.seq - Bacterial sequence entries, part 415.
353. gbbct416.seq - Bacterial sequence entries, part 416.
354. gbbct417.seq - Bacterial sequence entries, part 417.
355. gbbct418.seq - Bacterial sequence entries, part 418.
356. gbbct419.seq - Bacterial sequence entries, part 419.
357. gbbct42.seq - Bacterial sequence entries, part 42.
358. gbbct420.seq - Bacterial sequence entries, part 420.
359. gbbct421.seq - Bacterial sequence entries, part 421.
360. gbbct422.seq - Bacterial sequence entries, part 422.
361. gbbct423.seq - Bacterial sequence entries, part 423.
362. gbbct424.seq - Bacterial sequence entries, part 424.
363. gbbct425.seq - Bacterial sequence entries, part 425.
364. gbbct426.seq - Bacterial sequence entries, part 426.
365. gbbct427.seq - Bacterial sequence entries, part 427.
366. gbbct428.seq - Bacterial sequence entries, part 428.
367. gbbct429.seq - Bacterial sequence entries, part 429.
368. gbbct43.seq - Bacterial sequence entries, part 43.
369. gbbct430.seq - Bacterial sequence entries, part 430.
370. gbbct431.seq - Bacterial sequence entries, part 431.
371. gbbct432.seq - Bacterial sequence entries, part 432.
372. gbbct433.seq - Bacterial sequence entries, part 433.
373. gbbct434.seq - Bacterial sequence entries, part 434.
374. gbbct435.seq - Bacterial sequence entries, part 435.
375. gbbct436.seq - Bacterial sequence entries, part 436.
376. gbbct437.seq - Bacterial sequence entries, part 437.
377. gbbct438.seq - Bacterial sequence entries, part 438.
378. gbbct439.seq - Bacterial sequence entries, part 439.
379. gbbct44.seq - Bacterial sequence entries, part 44.
380. gbbct440.seq - Bacterial sequence entries, part 440.
381. gbbct441.seq - Bacterial sequence entries, part 441.
382. gbbct442.seq - Bacterial sequence entries, part 442.
383. gbbct443.seq - Bacterial sequence entries, part 443.
384. gbbct444.seq - Bacterial sequence entries, part 444.
385. gbbct445.seq - Bacterial sequence entries, part 445.
386. gbbct446.seq - Bacterial sequence entries, part 446.
387. gbbct447.seq - Bacterial sequence entries, part 447.
388. gbbct448.seq - Bacterial sequence entries, part 448.
389. gbbct449.seq - Bacterial sequence entries, part 449.
390. gbbct45.seq - Bacterial sequence entries, part 45.
391. gbbct450.seq - Bacterial sequence entries, part 450.
392. gbbct451.seq - Bacterial sequence entries, part 451.
393. gbbct452.seq - Bacterial sequence entries, part 452.
394. gbbct453.seq - Bacterial sequence entries, part 453.
395. gbbct454.seq - Bacterial sequence entries, part 454.
396. gbbct455.seq - Bacterial sequence entries, part 455.
397. gbbct456.seq - Bacterial sequence entries, part 456.
398. gbbct457.seq - Bacterial sequence entries, part 457.
399. gbbct458.seq - Bacterial sequence entries, part 458.
400. gbbct459.seq - Bacterial sequence entries, part 459.
401. gbbct46.seq - Bacterial sequence entries, part 46.
402. gbbct460.seq - Bacterial sequence entries, part 460.
403. gbbct461.seq - Bacterial sequence entries, part 461.
404. gbbct462.seq - Bacterial sequence entries, part 462.
405. gbbct463.seq - Bacterial sequence entries, part 463.
406. gbbct464.seq - Bacterial sequence entries, part 464.
407. gbbct465.seq - Bacterial sequence entries, part 465.
408. gbbct466.seq - Bacterial sequence entries, part 466.
409. gbbct467.seq - Bacterial sequence entries, part 467.
410. gbbct468.seq - Bacterial sequence entries, part 468.
411. gbbct469.seq - Bacterial sequence entries, part 469.
412. gbbct47.seq - Bacterial sequence entries, part 47.
413. gbbct470.seq - Bacterial sequence entries, part 470.
414. gbbct471.seq - Bacterial sequence entries, part 471.
415. gbbct472.seq - Bacterial sequence entries, part 472.
416. gbbct473.seq - Bacterial sequence entries, part 473.
417. gbbct474.seq - Bacterial sequence entries, part 474.
418. gbbct475.seq - Bacterial sequence entries, part 475.
419. gbbct476.seq - Bacterial sequence entries, part 476.
420. gbbct477.seq - Bacterial sequence entries, part 477.
421. gbbct478.seq - Bacterial sequence entries, part 478.
422. gbbct479.seq - Bacterial sequence entries, part 479.
423. gbbct48.seq - Bacterial sequence entries, part 48.
424. gbbct480.seq - Bacterial sequence entries, part 480.
425. gbbct481.seq - Bacterial sequence entries, part 481.
426. gbbct482.seq - Bacterial sequence entries, part 482.
427. gbbct483.seq - Bacterial sequence entries, part 483.
428. gbbct484.seq - Bacterial sequence entries, part 484.
429. gbbct485.seq - Bacterial sequence entries, part 485.
430. gbbct486.seq - Bacterial sequence entries, part 486.
431. gbbct487.seq - Bacterial sequence entries, part 487.
432. gbbct488.seq - Bacterial sequence entries, part 488.
433. gbbct489.seq - Bacterial sequence entries, part 489.
434. gbbct49.seq - Bacterial sequence entries, part 49.
435. gbbct490.seq - Bacterial sequence entries, part 490.
436. gbbct491.seq - Bacterial sequence entries, part 491.
437. gbbct492.seq - Bacterial sequence entries, part 492.
438. gbbct493.seq - Bacterial sequence entries, part 493.
439. gbbct494.seq - Bacterial sequence entries, part 494.
440. gbbct495.seq - Bacterial sequence entries, part 495.
441. gbbct496.seq - Bacterial sequence entries, part 496.
442. gbbct497.seq - Bacterial sequence entries, part 497.
443. gbbct498.seq - Bacterial sequence entries, part 498.
444. gbbct499.seq - Bacterial sequence entries, part 499.
445. gbbct5.seq - Bacterial sequence entries, part 5.
446. gbbct50.seq - Bacterial sequence entries, part 50.
447. gbbct500.seq - Bacterial sequence entries, part 500.
448. gbbct501.seq - Bacterial sequence entries, part 501.
449. gbbct502.seq - Bacterial sequence entries, part 502.
450. gbbct503.seq - Bacterial sequence entries, part 503.
451. gbbct504.seq - Bacterial sequence entries, part 504.
452. gbbct505.seq - Bacterial sequence entries, part 505.
453. gbbct506.seq - Bacterial sequence entries, part 506.
454. gbbct507.seq - Bacterial sequence entries, part 507.
455. gbbct508.seq - Bacterial sequence entries, part 508.
456. gbbct509.seq - Bacterial sequence entries, part 509.
457. gbbct51.seq - Bacterial sequence entries, part 51.
458. gbbct510.seq - Bacterial sequence entries, part 510.
459. gbbct511.seq - Bacterial sequence entries, part 511.
460. gbbct512.seq - Bacterial sequence entries, part 512.
461. gbbct513.seq - Bacterial sequence entries, part 513.
462. gbbct514.seq - Bacterial sequence entries, part 514.
463. gbbct515.seq - Bacterial sequence entries, part 515.
464. gbbct516.seq - Bacterial sequence entries, part 516.
465. gbbct517.seq - Bacterial sequence entries, part 517.
466. gbbct518.seq - Bacterial sequence entries, part 518.
467. gbbct519.seq - Bacterial sequence entries, part 519.
468. gbbct52.seq - Bacterial sequence entries, part 52.
469. gbbct520.seq - Bacterial sequence entries, part 520.
470. gbbct521.seq - Bacterial sequence entries, part 521.
471. gbbct522.seq - Bacterial sequence entries, part 522.
472. gbbct523.seq - Bacterial sequence entries, part 523.
473. gbbct524.seq - Bacterial sequence entries, part 524.
474. gbbct525.seq - Bacterial sequence entries, part 525.
475. gbbct526.seq - Bacterial sequence entries, part 526.
476. gbbct527.seq - Bacterial sequence entries, part 527.
477. gbbct528.seq - Bacterial sequence entries, part 528.
478. gbbct529.seq - Bacterial sequence entries, part 529.
479. gbbct53.seq - Bacterial sequence entries, part 53.
480. gbbct530.seq - Bacterial sequence entries, part 530.
481. gbbct531.seq - Bacterial sequence entries, part 531.
482. gbbct532.seq - Bacterial sequence entries, part 532.
483. gbbct533.seq - Bacterial sequence entries, part 533.
484. gbbct534.seq - Bacterial sequence entries, part 534.
485. gbbct535.seq - Bacterial sequence entries, part 535.
486. gbbct536.seq - Bacterial sequence entries, part 536.
487. gbbct537.seq - Bacterial sequence entries, part 537.
488. gbbct538.seq - Bacterial sequence entries, part 538.
489. gbbct539.seq - Bacterial sequence entries, part 539.
490. gbbct54.seq - Bacterial sequence entries, part 54.
491. gbbct540.seq - Bacterial sequence entries, part 540.
492. gbbct541.seq - Bacterial sequence entries, part 541.
493. gbbct542.seq - Bacterial sequence entries, part 542.
494. gbbct543.seq - Bacterial sequence entries, part 543.
495. gbbct544.seq - Bacterial sequence entries, part 544.
496. gbbct545.seq - Bacterial sequence entries, part 545.
497. gbbct546.seq - Bacterial sequence entries, part 546.
498. gbbct547.seq - Bacterial sequence entries, part 547.
499. gbbct548.seq - Bacterial sequence entries, part 548.
500. gbbct549.seq - Bacterial sequence entries, part 549.
501. gbbct55.seq - Bacterial sequence entries, part 55.
502. gbbct550.seq - Bacterial sequence entries, part 550.
503. gbbct551.seq - Bacterial sequence entries, part 551.
504. gbbct552.seq - Bacterial sequence entries, part 552.
505. gbbct553.seq - Bacterial sequence entries, part 553.
506. gbbct554.seq - Bacterial sequence entries, part 554.
507. gbbct555.seq - Bacterial sequence entries, part 555.
508. gbbct556.seq - Bacterial sequence entries, part 556.
509. gbbct557.seq - Bacterial sequence entries, part 557.
510. gbbct558.seq - Bacterial sequence entries, part 558.
511. gbbct559.seq - Bacterial sequence entries, part 559.
512. gbbct56.seq - Bacterial sequence entries, part 56.
513. gbbct560.seq - Bacterial sequence entries, part 560.
514. gbbct561.seq - Bacterial sequence entries, part 561.
515. gbbct562.seq - Bacterial sequence entries, part 562.
516. gbbct563.seq - Bacterial sequence entries, part 563.
517. gbbct564.seq - Bacterial sequence entries, part 564.
518. gbbct565.seq - Bacterial sequence entries, part 565.
519. gbbct566.seq - Bacterial sequence entries, part 566.
520. gbbct567.seq - Bacterial sequence entries, part 567.
521. gbbct568.seq - Bacterial sequence entries, part 568.
522. gbbct569.seq - Bacterial sequence entries, part 569.
523. gbbct57.seq - Bacterial sequence entries, part 57.
524. gbbct570.seq - Bacterial sequence entries, part 570.
525. gbbct571.seq - Bacterial sequence entries, part 571.
526. gbbct572.seq - Bacterial sequence entries, part 572.
527. gbbct573.seq - Bacterial sequence entries, part 573.
528. gbbct574.seq - Bacterial sequence entries, part 574.
529. gbbct575.seq - Bacterial sequence entries, part 575.
530. gbbct576.seq - Bacterial sequence entries, part 576.
531. gbbct577.seq - Bacterial sequence entries, part 577.
532. gbbct578.seq - Bacterial sequence entries, part 578.
533. gbbct579.seq - Bacterial sequence entries, part 579.
534. gbbct58.seq - Bacterial sequence entries, part 58.
535. gbbct580.seq - Bacterial sequence entries, part 580.
536. gbbct581.seq - Bacterial sequence entries, part 581.
537. gbbct582.seq - Bacterial sequence entries, part 582.
538. gbbct583.seq - Bacterial sequence entries, part 583.
539. gbbct584.seq - Bacterial sequence entries, part 584.
540. gbbct585.seq - Bacterial sequence entries, part 585.
541. gbbct586.seq - Bacterial sequence entries, part 586.
542. gbbct587.seq - Bacterial sequence entries, part 587.
543. gbbct588.seq - Bacterial sequence entries, part 588.
544. gbbct589.seq - Bacterial sequence entries, part 589.
545. gbbct59.seq - Bacterial sequence entries, part 59.
546. gbbct590.seq - Bacterial sequence entries, part 590.
547. gbbct591.seq - Bacterial sequence entries, part 591.
548. gbbct592.seq - Bacterial sequence entries, part 592.
549. gbbct593.seq - Bacterial sequence entries, part 593.
550. gbbct594.seq - Bacterial sequence entries, part 594.
551. gbbct595.seq - Bacterial sequence entries, part 595.
552. gbbct596.seq - Bacterial sequence entries, part 596.
553. gbbct597.seq - Bacterial sequence entries, part 597.
554. gbbct598.seq - Bacterial sequence entries, part 598.
555. gbbct599.seq - Bacterial sequence entries, part 599.
556. gbbct6.seq - Bacterial sequence entries, part 6.
557. gbbct60.seq - Bacterial sequence entries, part 60.
558. gbbct600.seq - Bacterial sequence entries, part 600.
559. gbbct601.seq - Bacterial sequence entries, part 601.
560. gbbct602.seq - Bacterial sequence entries, part 602.
561. gbbct603.seq - Bacterial sequence entries, part 603.
562. gbbct604.seq - Bacterial sequence entries, part 604.
563. gbbct605.seq - Bacterial sequence entries, part 605.
564. gbbct606.seq - Bacterial sequence entries, part 606.
565. gbbct607.seq - Bacterial sequence entries, part 607.
566. gbbct608.seq - Bacterial sequence entries, part 608.
567. gbbct609.seq - Bacterial sequence entries, part 609.
568. gbbct61.seq - Bacterial sequence entries, part 61.
569. gbbct610.seq - Bacterial sequence entries, part 610.
570. gbbct611.seq - Bacterial sequence entries, part 611.
571. gbbct612.seq - Bacterial sequence entries, part 612.
572. gbbct613.seq - Bacterial sequence entries, part 613.
573. gbbct614.seq - Bacterial sequence entries, part 614.
574. gbbct615.seq - Bacterial sequence entries, part 615.
575. gbbct616.seq - Bacterial sequence entries, part 616.
576. gbbct617.seq - Bacterial sequence entries, part 617.
577. gbbct618.seq - Bacterial sequence entries, part 618.
578. gbbct619.seq - Bacterial sequence entries, part 619.
579. gbbct62.seq - Bacterial sequence entries, part 62.
580. gbbct620.seq - Bacterial sequence entries, part 620.
581. gbbct621.seq - Bacterial sequence entries, part 621.
582. gbbct622.seq - Bacterial sequence entries, part 622.
583. gbbct623.seq - Bacterial sequence entries, part 623.
584. gbbct624.seq - Bacterial sequence entries, part 624.
585. gbbct625.seq - Bacterial sequence entries, part 625.
586. gbbct626.seq - Bacterial sequence entries, part 626.
587. gbbct627.seq - Bacterial sequence entries, part 627.
588. gbbct628.seq - Bacterial sequence entries, part 628.
589. gbbct629.seq - Bacterial sequence entries, part 629.
590. gbbct63.seq - Bacterial sequence entries, part 63.
591. gbbct630.seq - Bacterial sequence entries, part 630.
592. gbbct631.seq - Bacterial sequence entries, part 631.
593. gbbct632.seq - Bacterial sequence entries, part 632.
594. gbbct633.seq - Bacterial sequence entries, part 633.
595. gbbct634.seq - Bacterial sequence entries, part 634.
596. gbbct635.seq - Bacterial sequence entries, part 635.
597. gbbct636.seq - Bacterial sequence entries, part 636.
598. gbbct637.seq - Bacterial sequence entries, part 637.
599. gbbct638.seq - Bacterial sequence entries, part 638.
600. gbbct639.seq - Bacterial sequence entries, part 639.
601. gbbct64.seq - Bacterial sequence entries, part 64.
602. gbbct640.seq - Bacterial sequence entries, part 640.
603. gbbct641.seq - Bacterial sequence entries, part 641.
604. gbbct642.seq - Bacterial sequence entries, part 642.
605. gbbct643.seq - Bacterial sequence entries, part 643.
606. gbbct644.seq - Bacterial sequence entries, part 644.
607. gbbct645.seq - Bacterial sequence entries, part 645.
608. gbbct646.seq - Bacterial sequence entries, part 646.
609. gbbct647.seq - Bacterial sequence entries, part 647.
610. gbbct648.seq - Bacterial sequence entries, part 648.
611. gbbct649.seq - Bacterial sequence entries, part 649.
612. gbbct65.seq - Bacterial sequence entries, part 65.
613. gbbct650.seq - Bacterial sequence entries, part 650.
614. gbbct651.seq - Bacterial sequence entries, part 651.
615. gbbct652.seq - Bacterial sequence entries, part 652.
616. gbbct653.seq - Bacterial sequence entries, part 653.
617. gbbct654.seq - Bacterial sequence entries, part 654.
618. gbbct655.seq - Bacterial sequence entries, part 655.
619. gbbct656.seq - Bacterial sequence entries, part 656.
620. gbbct657.seq - Bacterial sequence entries, part 657.
621. gbbct658.seq - Bacterial sequence entries, part 658.
622. gbbct659.seq - Bacterial sequence entries, part 659.
623. gbbct66.seq - Bacterial sequence entries, part 66.
624. gbbct660.seq - Bacterial sequence entries, part 660.
625. gbbct661.seq - Bacterial sequence entries, part 661.
626. gbbct662.seq - Bacterial sequence entries, part 662.
627. gbbct663.seq - Bacterial sequence entries, part 663.
628. gbbct664.seq - Bacterial sequence entries, part 664.
629. gbbct665.seq - Bacterial sequence entries, part 665.
630. gbbct666.seq - Bacterial sequence entries, part 666.
631. gbbct667.seq - Bacterial sequence entries, part 667.
632. gbbct668.seq - Bacterial sequence entries, part 668.
633. gbbct669.seq - Bacterial sequence entries, part 669.
634. gbbct67.seq - Bacterial sequence entries, part 67.
635. gbbct670.seq - Bacterial sequence entries, part 670.
636. gbbct671.seq - Bacterial sequence entries, part 671.
637. gbbct672.seq - Bacterial sequence entries, part 672.
638. gbbct673.seq - Bacterial sequence entries, part 673.
639. gbbct674.seq - Bacterial sequence entries, part 674.
640. gbbct675.seq - Bacterial sequence entries, part 675.
641. gbbct676.seq - Bacterial sequence entries, part 676.
642. gbbct677.seq - Bacterial sequence entries, part 677.
643. gbbct678.seq - Bacterial sequence entries, part 678.
644. gbbct679.seq - Bacterial sequence entries, part 679.
645. gbbct68.seq - Bacterial sequence entries, part 68.
646. gbbct680.seq - Bacterial sequence entries, part 680.
647. gbbct681.seq - Bacterial sequence entries, part 681.
648. gbbct682.seq - Bacterial sequence entries, part 682.
649. gbbct683.seq - Bacterial sequence entries, part 683.
650. gbbct684.seq - Bacterial sequence entries, part 684.
651. gbbct685.seq - Bacterial sequence entries, part 685.
652. gbbct686.seq - Bacterial sequence entries, part 686.
653. gbbct687.seq - Bacterial sequence entries, part 687.
654. gbbct688.seq - Bacterial sequence entries, part 688.
655. gbbct69.seq - Bacterial sequence entries, part 69.
656. gbbct7.seq - Bacterial sequence entries, part 7.
657. gbbct70.seq - Bacterial sequence entries, part 70.
658. gbbct71.seq - Bacterial sequence entries, part 71.
659. gbbct72.seq - Bacterial sequence entries, part 72.
660. gbbct73.seq - Bacterial sequence entries, part 73.
661. gbbct74.seq - Bacterial sequence entries, part 74.
662. gbbct75.seq - Bacterial sequence entries, part 75.
663. gbbct76.seq - Bacterial sequence entries, part 76.
664. gbbct77.seq - Bacterial sequence entries, part 77.
665. gbbct78.seq - Bacterial sequence entries, part 78.
666. gbbct79.seq - Bacterial sequence entries, part 79.
667. gbbct8.seq - Bacterial sequence entries, part 8.
668. gbbct80.seq - Bacterial sequence entries, part 80.
669. gbbct81.seq - Bacterial sequence entries, part 81.
670. gbbct82.seq - Bacterial sequence entries, part 82.
671. gbbct83.seq - Bacterial sequence entries, part 83.
672. gbbct84.seq - Bacterial sequence entries, part 84.
673. gbbct85.seq - Bacterial sequence entries, part 85.
674. gbbct86.seq - Bacterial sequence entries, part 86.
675. gbbct87.seq - Bacterial sequence entries, part 87.
676. gbbct88.seq - Bacterial sequence entries, part 88.
677. gbbct89.seq - Bacterial sequence entries, part 89.
678. gbbct9.seq - Bacterial sequence entries, part 9.
679. gbbct90.seq - Bacterial sequence entries, part 90.
680. gbbct91.seq - Bacterial sequence entries, part 91.
681. gbbct92.seq - Bacterial sequence entries, part 92.
682. gbbct93.seq - Bacterial sequence entries, part 93.
683. gbbct94.seq - Bacterial sequence entries, part 94.
684. gbbct95.seq - Bacterial sequence entries, part 95.
685. gbbct96.seq - Bacterial sequence entries, part 96.
686. gbbct97.seq - Bacterial sequence entries, part 97.
687. gbbct98.seq - Bacterial sequence entries, part 98.
688. gbbct99.seq - Bacterial sequence entries, part 99.
689. gbchg.txt - Accession numbers of entries updated since the previous release.
690. gbcon1.seq - Constructed sequence entries, part 1.
691. gbcon10.seq - Constructed sequence entries, part 10.
692. gbcon100.seq - Constructed sequence entries, part 100.
693. gbcon101.seq - Constructed sequence entries, part 101.
694. gbcon102.seq - Constructed sequence entries, part 102.
695. gbcon103.seq - Constructed sequence entries, part 103.
696. gbcon104.seq - Constructed sequence entries, part 104.
697. gbcon105.seq - Constructed sequence entries, part 105.
698. gbcon106.seq - Constructed sequence entries, part 106.
699. gbcon107.seq - Constructed sequence entries, part 107.
700. gbcon108.seq - Constructed sequence entries, part 108.
701. gbcon109.seq - Constructed sequence entries, part 109.
702. gbcon11.seq - Constructed sequence entries, part 11.
703. gbcon110.seq - Constructed sequence entries, part 110.
704. gbcon111.seq - Constructed sequence entries, part 111.
705. gbcon112.seq - Constructed sequence entries, part 112.
706. gbcon113.seq - Constructed sequence entries, part 113.
707. gbcon114.seq - Constructed sequence entries, part 114.
708. gbcon115.seq - Constructed sequence entries, part 115.
709. gbcon116.seq - Constructed sequence entries, part 116.
710. gbcon117.seq - Constructed sequence entries, part 117.
711. gbcon118.seq - Constructed sequence entries, part 118.
712. gbcon119.seq - Constructed sequence entries, part 119.
713. gbcon12.seq - Constructed sequence entries, part 12.
714. gbcon120.seq - Constructed sequence entries, part 120.
715. gbcon121.seq - Constructed sequence entries, part 121.
716. gbcon122.seq - Constructed sequence entries, part 122.
717. gbcon123.seq - Constructed sequence entries, part 123.
718. gbcon124.seq - Constructed sequence entries, part 124.
719. gbcon125.seq - Constructed sequence entries, part 125.
720. gbcon126.seq - Constructed sequence entries, part 126.
721. gbcon127.seq - Constructed sequence entries, part 127.
722. gbcon128.seq - Constructed sequence entries, part 128.
723. gbcon129.seq - Constructed sequence entries, part 129.
724. gbcon13.seq - Constructed sequence entries, part 13.
725. gbcon130.seq - Constructed sequence entries, part 130.
726. gbcon131.seq - Constructed sequence entries, part 131.
727. gbcon132.seq - Constructed sequence entries, part 132.
728. gbcon133.seq - Constructed sequence entries, part 133.
729. gbcon134.seq - Constructed sequence entries, part 134.
730. gbcon135.seq - Constructed sequence entries, part 135.
731. gbcon136.seq - Constructed sequence entries, part 136.
732. gbcon137.seq - Constructed sequence entries, part 137.
733. gbcon138.seq - Constructed sequence entries, part 138.
734. gbcon139.seq - Constructed sequence entries, part 139.
735. gbcon14.seq - Constructed sequence entries, part 14.
736. gbcon140.seq - Constructed sequence entries, part 140.
737. gbcon141.seq - Constructed sequence entries, part 141.
738. gbcon142.seq - Constructed sequence entries, part 142.
739. gbcon143.seq - Constructed sequence entries, part 143.
740. gbcon144.seq - Constructed sequence entries, part 144.
741. gbcon145.seq - Constructed sequence entries, part 145.
742. gbcon146.seq - Constructed sequence entries, part 146.
743. gbcon147.seq - Constructed sequence entries, part 147.
744. gbcon148.seq - Constructed sequence entries, part 148.
745. gbcon149.seq - Constructed sequence entries, part 149.
746. gbcon15.seq - Constructed sequence entries, part 15.
747. gbcon150.seq - Constructed sequence entries, part 150.
748. gbcon151.seq - Constructed sequence entries, part 151.
749. gbcon152.seq - Constructed sequence entries, part 152.
750. gbcon153.seq - Constructed sequence entries, part 153.
751. gbcon154.seq - Constructed sequence entries, part 154.
752. gbcon155.seq - Constructed sequence entries, part 155.
753. gbcon156.seq - Constructed sequence entries, part 156.
754. gbcon157.seq - Constructed sequence entries, part 157.
755. gbcon158.seq - Constructed sequence entries, part 158.
756. gbcon159.seq - Constructed sequence entries, part 159.
757. gbcon16.seq - Constructed sequence entries, part 16.
758. gbcon160.seq - Constructed sequence entries, part 160.
759. gbcon161.seq - Constructed sequence entries, part 161.
760. gbcon162.seq - Constructed sequence entries, part 162.
761. gbcon163.seq - Constructed sequence entries, part 163.
762. gbcon164.seq - Constructed sequence entries, part 164.
763. gbcon165.seq - Constructed sequence entries, part 165.
764. gbcon166.seq - Constructed sequence entries, part 166.
765. gbcon167.seq - Constructed sequence entries, part 167.
766. gbcon168.seq - Constructed sequence entries, part 168.
767. gbcon169.seq - Constructed sequence entries, part 169.
768. gbcon17.seq - Constructed sequence entries, part 17.
769. gbcon170.seq - Constructed sequence entries, part 170.
770. gbcon171.seq - Constructed sequence entries, part 171.
771. gbcon172.seq - Constructed sequence entries, part 172.
772. gbcon173.seq - Constructed sequence entries, part 173.
773. gbcon174.seq - Constructed sequence entries, part 174.
774. gbcon175.seq - Constructed sequence entries, part 175.
775. gbcon176.seq - Constructed sequence entries, part 176.
776. gbcon177.seq - Constructed sequence entries, part 177.
777. gbcon178.seq - Constructed sequence entries, part 178.
778. gbcon179.seq - Constructed sequence entries, part 179.
779. gbcon18.seq - Constructed sequence entries, part 18.
780. gbcon180.seq - Constructed sequence entries, part 180.
781. gbcon181.seq - Constructed sequence entries, part 181.
782. gbcon182.seq - Constructed sequence entries, part 182.
783. gbcon183.seq - Constructed sequence entries, part 183.
784. gbcon184.seq - Constructed sequence entries, part 184.
785. gbcon185.seq - Constructed sequence entries, part 185.
786. gbcon186.seq - Constructed sequence entries, part 186.
787. gbcon187.seq - Constructed sequence entries, part 187.
788. gbcon188.seq - Constructed sequence entries, part 188.
789. gbcon189.seq - Constructed sequence entries, part 189.
790. gbcon19.seq - Constructed sequence entries, part 19.
791. gbcon190.seq - Constructed sequence entries, part 190.
792. gbcon191.seq - Constructed sequence entries, part 191.
793. gbcon192.seq - Constructed sequence entries, part 192.
794. gbcon193.seq - Constructed sequence entries, part 193.
795. gbcon194.seq - Constructed sequence entries, part 194.
796. gbcon195.seq - Constructed sequence entries, part 195.
797. gbcon196.seq - Constructed sequence entries, part 196.
798. gbcon197.seq - Constructed sequence entries, part 197.
799. gbcon198.seq - Constructed sequence entries, part 198.
800. gbcon199.seq - Constructed sequence entries, part 199.
801. gbcon2.seq - Constructed sequence entries, part 2.
802. gbcon20.seq - Constructed sequence entries, part 20.
803. gbcon200.seq - Constructed sequence entries, part 200.
804. gbcon201.seq - Constructed sequence entries, part 201.
805. gbcon202.seq - Constructed sequence entries, part 202.
806. gbcon203.seq - Constructed sequence entries, part 203.
807. gbcon204.seq - Constructed sequence entries, part 204.
808. gbcon205.seq - Constructed sequence entries, part 205.
809. gbcon206.seq - Constructed sequence entries, part 206.
810. gbcon207.seq - Constructed sequence entries, part 207.
811. gbcon208.seq - Constructed sequence entries, part 208.
812. gbcon209.seq - Constructed sequence entries, part 209.
813. gbcon21.seq - Constructed sequence entries, part 21.
814. gbcon210.seq - Constructed sequence entries, part 210.
815. gbcon211.seq - Constructed sequence entries, part 211.
816. gbcon212.seq - Constructed sequence entries, part 212.
817. gbcon213.seq - Constructed sequence entries, part 213.
818. gbcon214.seq - Constructed sequence entries, part 214.
819. gbcon215.seq - Constructed sequence entries, part 215.
820. gbcon216.seq - Constructed sequence entries, part 216.
821. gbcon217.seq - Constructed sequence entries, part 217.
822. gbcon218.seq - Constructed sequence entries, part 218.
823. gbcon219.seq - Constructed sequence entries, part 219.
824. gbcon22.seq - Constructed sequence entries, part 22.
825. gbcon220.seq - Constructed sequence entries, part 220.
826. gbcon221.seq - Constructed sequence entries, part 221.
827. gbcon222.seq - Constructed sequence entries, part 222.
828. gbcon223.seq - Constructed sequence entries, part 223.
829. gbcon23.seq - Constructed sequence entries, part 23.
830. gbcon24.seq - Constructed sequence entries, part 24.
831. gbcon25.seq - Constructed sequence entries, part 25.
832. gbcon26.seq - Constructed sequence entries, part 26.
833. gbcon27.seq - Constructed sequence entries, part 27.
834. gbcon28.seq - Constructed sequence entries, part 28.
835. gbcon29.seq - Constructed sequence entries, part 29.
836. gbcon3.seq - Constructed sequence entries, part 3.
837. gbcon30.seq - Constructed sequence entries, part 30.
838. gbcon31.seq - Constructed sequence entries, part 31.
839. gbcon32.seq - Constructed sequence entries, part 32.
840. gbcon33.seq - Constructed sequence entries, part 33.
841. gbcon34.seq - Constructed sequence entries, part 34.
842. gbcon35.seq - Constructed sequence entries, part 35.
843. gbcon36.seq - Constructed sequence entries, part 36.
844. gbcon37.seq - Constructed sequence entries, part 37.
845. gbcon38.seq - Constructed sequence entries, part 38.
846. gbcon39.seq - Constructed sequence entries, part 39.
847. gbcon4.seq - Constructed sequence entries, part 4.
848. gbcon40.seq - Constructed sequence entries, part 40.
849. gbcon41.seq - Constructed sequence entries, part 41.
850. gbcon42.seq - Constructed sequence entries, part 42.
851. gbcon43.seq - Constructed sequence entries, part 43.
852. gbcon44.seq - Constructed sequence entries, part 44.
853. gbcon45.seq - Constructed sequence entries, part 45.
854. gbcon46.seq - Constructed sequence entries, part 46.
855. gbcon47.seq - Constructed sequence entries, part 47.
856. gbcon48.seq - Constructed sequence entries, part 48.
857. gbcon49.seq - Constructed sequence entries, part 49.
858. gbcon5.seq - Constructed sequence entries, part 5.
859. gbcon50.seq - Constructed sequence entries, part 50.
860. gbcon51.seq - Constructed sequence entries, part 51.
861. gbcon52.seq - Constructed sequence entries, part 52.
862. gbcon53.seq - Constructed sequence entries, part 53.
863. gbcon54.seq - Constructed sequence entries, part 54.
864. gbcon55.seq - Constructed sequence entries, part 55.
865. gbcon56.seq - Constructed sequence entries, part 56.
866. gbcon57.seq - Constructed sequence entries, part 57.
867. gbcon58.seq - Constructed sequence entries, part 58.
868. gbcon59.seq - Constructed sequence entries, part 59.
869. gbcon6.seq - Constructed sequence entries, part 6.
870. gbcon60.seq - Constructed sequence entries, part 60.
871. gbcon61.seq - Constructed sequence entries, part 61.
872. gbcon62.seq - Constructed sequence entries, part 62.
873. gbcon63.seq - Constructed sequence entries, part 63.
874. gbcon64.seq - Constructed sequence entries, part 64.
875. gbcon65.seq - Constructed sequence entries, part 65.
876. gbcon66.seq - Constructed sequence entries, part 66.
877. gbcon67.seq - Constructed sequence entries, part 67.
878. gbcon68.seq - Constructed sequence entries, part 68.
879. gbcon69.seq - Constructed sequence entries, part 69.
880. gbcon7.seq - Constructed sequence entries, part 7.
881. gbcon70.seq - Constructed sequence entries, part 70.
882. gbcon71.seq - Constructed sequence entries, part 71.
883. gbcon72.seq - Constructed sequence entries, part 72.
884. gbcon73.seq - Constructed sequence entries, part 73.
885. gbcon74.seq - Constructed sequence entries, part 74.
886. gbcon75.seq - Constructed sequence entries, part 75.
887. gbcon76.seq - Constructed sequence entries, part 76.
888. gbcon77.seq - Constructed sequence entries, part 77.
889. gbcon78.seq - Constructed sequence entries, part 78.
890. gbcon79.seq - Constructed sequence entries, part 79.
891. gbcon8.seq - Constructed sequence entries, part 8.
892. gbcon80.seq - Constructed sequence entries, part 80.
893. gbcon81.seq - Constructed sequence entries, part 81.
894. gbcon82.seq - Constructed sequence entries, part 82.
895. gbcon83.seq - Constructed sequence entries, part 83.
896. gbcon84.seq - Constructed sequence entries, part 84.
897. gbcon85.seq - Constructed sequence entries, part 85.
898. gbcon86.seq - Constructed sequence entries, part 86.
899. gbcon87.seq - Constructed sequence entries, part 87.
900. gbcon88.seq - Constructed sequence entries, part 88.
901. gbcon89.seq - Constructed sequence entries, part 89.
902. gbcon9.seq - Constructed sequence entries, part 9.
903. gbcon90.seq - Constructed sequence entries, part 90.
904. gbcon91.seq - Constructed sequence entries, part 91.
905. gbcon92.seq - Constructed sequence entries, part 92.
906. gbcon93.seq - Constructed sequence entries, part 93.
907. gbcon94.seq - Constructed sequence entries, part 94.
908. gbcon95.seq - Constructed sequence entries, part 95.
909. gbcon96.seq - Constructed sequence entries, part 96.
910. gbcon97.seq - Constructed sequence entries, part 97.
911. gbcon98.seq - Constructed sequence entries, part 98.
912. gbcon99.seq - Constructed sequence entries, part 99.
913. gbdel.txt - Accession numbers of entries deleted since the previous release.
914. gbenv1.seq - Environmental sampling sequence entries, part 1.
915. gbenv10.seq - Environmental sampling sequence entries, part 10.
916. gbenv11.seq - Environmental sampling sequence entries, part 11.
917. gbenv12.seq - Environmental sampling sequence entries, part 12.
918. gbenv13.seq - Environmental sampling sequence entries, part 13.
919. gbenv14.seq - Environmental sampling sequence entries, part 14.
920. gbenv15.seq - Environmental sampling sequence entries, part 15.
921. gbenv16.seq - Environmental sampling sequence entries, part 16.
922. gbenv17.seq - Environmental sampling sequence entries, part 17.
923. gbenv18.seq - Environmental sampling sequence entries, part 18.
924. gbenv19.seq - Environmental sampling sequence entries, part 19.
925. gbenv2.seq - Environmental sampling sequence entries, part 2.
926. gbenv20.seq - Environmental sampling sequence entries, part 20.
927. gbenv21.seq - Environmental sampling sequence entries, part 21.
928. gbenv22.seq - Environmental sampling sequence entries, part 22.
929. gbenv23.seq - Environmental sampling sequence entries, part 23.
930. gbenv24.seq - Environmental sampling sequence entries, part 24.
931. gbenv25.seq - Environmental sampling sequence entries, part 25.
932. gbenv26.seq - Environmental sampling sequence entries, part 26.
933. gbenv27.seq - Environmental sampling sequence entries, part 27.
934. gbenv28.seq - Environmental sampling sequence entries, part 28.
935. gbenv29.seq - Environmental sampling sequence entries, part 29.
936. gbenv3.seq - Environmental sampling sequence entries, part 3.
937. gbenv30.seq - Environmental sampling sequence entries, part 30.
938. gbenv31.seq - Environmental sampling sequence entries, part 31.
939. gbenv32.seq - Environmental sampling sequence entries, part 32.
940. gbenv33.seq - Environmental sampling sequence entries, part 33.
941. gbenv34.seq - Environmental sampling sequence entries, part 34.
942. gbenv35.seq - Environmental sampling sequence entries, part 35.
943. gbenv36.seq - Environmental sampling sequence entries, part 36.
944. gbenv37.seq - Environmental sampling sequence entries, part 37.
945. gbenv38.seq - Environmental sampling sequence entries, part 38.
946. gbenv39.seq - Environmental sampling sequence entries, part 39.
947. gbenv4.seq - Environmental sampling sequence entries, part 4.
948. gbenv40.seq - Environmental sampling sequence entries, part 40.
949. gbenv41.seq - Environmental sampling sequence entries, part 41.
950. gbenv42.seq - Environmental sampling sequence entries, part 42.
951. gbenv43.seq - Environmental sampling sequence entries, part 43.
952. gbenv44.seq - Environmental sampling sequence entries, part 44.
953. gbenv45.seq - Environmental sampling sequence entries, part 45.
954. gbenv46.seq - Environmental sampling sequence entries, part 46.
955. gbenv47.seq - Environmental sampling sequence entries, part 47.
956. gbenv48.seq - Environmental sampling sequence entries, part 48.
957. gbenv49.seq - Environmental sampling sequence entries, part 49.
958. gbenv5.seq - Environmental sampling sequence entries, part 5.
959. gbenv50.seq - Environmental sampling sequence entries, part 50.
960. gbenv51.seq - Environmental sampling sequence entries, part 51.
961. gbenv52.seq - Environmental sampling sequence entries, part 52.
962. gbenv53.seq - Environmental sampling sequence entries, part 53.
963. gbenv54.seq - Environmental sampling sequence entries, part 54.
964. gbenv55.seq - Environmental sampling sequence entries, part 55.
965. gbenv56.seq - Environmental sampling sequence entries, part 56.
966. gbenv57.seq - Environmental sampling sequence entries, part 57.
967. gbenv58.seq - Environmental sampling sequence entries, part 58.
968. gbenv59.seq - Environmental sampling sequence entries, part 59.
969. gbenv6.seq - Environmental sampling sequence entries, part 6.
970. gbenv60.seq - Environmental sampling sequence entries, part 60.
971. gbenv61.seq - Environmental sampling sequence entries, part 61.
972. gbenv62.seq - Environmental sampling sequence entries, part 62.
973. gbenv63.seq - Environmental sampling sequence entries, part 63.
974. gbenv64.seq - Environmental sampling sequence entries, part 64.
975. gbenv65.seq - Environmental sampling sequence entries, part 65.
976. gbenv66.seq - Environmental sampling sequence entries, part 66.
977. gbenv67.seq - Environmental sampling sequence entries, part 67.
978. gbenv68.seq - Environmental sampling sequence entries, part 68.
979. gbenv69.seq - Environmental sampling sequence entries, part 69.
980. gbenv7.seq - Environmental sampling sequence entries, part 7.
981. gbenv70.seq - Environmental sampling sequence entries, part 70.
982. gbenv8.seq - Environmental sampling sequence entries, part 8.
983. gbenv9.seq - Environmental sampling sequence entries, part 9.
984. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
985. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
986. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
987. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
988. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
989. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
990. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
991. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
992. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
993. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
994. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
995. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
996. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
997. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
998. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
999. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
1000. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
1001. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
1002. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
1003. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
1004. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
1005. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
1006. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
1007. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
1008. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
1009. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
1010. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
1011. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
1012. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
1013. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
1014. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
1015. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
1016. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
1017. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
1018. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
1019. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
1020. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
1021. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
1022. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
1023. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
1024. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
1025. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
1026. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
1027. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
1028. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
1029. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
1030. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
1031. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
1032. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
1033. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
1034. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
1035. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
1036. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
1037. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
1038. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
1039. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
1040. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
1041. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
1042. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
1043. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
1044. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
1045. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
1046. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
1047. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
1048. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
1049. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
1050. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
1051. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
1052. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
1053. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
1054. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
1055. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
1056. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
1057. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
1058. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
1059. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
1060. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
1061. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
1062. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
1063. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
1064. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
1065. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
1066. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
1067. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
1068. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
1069. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
1070. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
1071. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
1072. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
1073. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
1074. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
1075. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
1076. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
1077. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
1078. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
1079. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
1080. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
1081. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
1082. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
1083. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
1084. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
1085. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
1086. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
1087. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
1088. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
1089. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
1090. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
1091. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
1092. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
1093. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
1094. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
1095. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
1096. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
1097. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
1098. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
1099. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
1100. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
1101. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
1102. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
1103. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
1104. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
1105. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
1106. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
1107. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
1108. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
1109. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
1110. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
1111. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
1112. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
1113. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
1114. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
1115. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
1116. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
1117. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
1118. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
1119. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
1120. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
1121. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
1122. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
1123. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
1124. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
1125. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
1126. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
1127. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
1128. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
1129. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
1130. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
1131. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
1132. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
1133. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
1134. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
1135. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
1136. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
1137. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
1138. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
1139. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
1140. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
1141. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
1142. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
1143. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
1144. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
1145. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
1146. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
1147. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
1148. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
1149. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
1150. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
1151. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
1152. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
1153. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
1154. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
1155. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
1156. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
1157. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
1158. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
1159. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
1160. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
1161. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
1162. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
1163. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
1164. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
1165. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
1166. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
1167. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
1168. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
1169. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
1170. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
1171. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
1172. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
1173. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
1174. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
1175. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
1176. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
1177. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
1178. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
1179. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
1180. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
1181. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
1182. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
1183. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
1184. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
1185. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
1186. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
1187. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
1188. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
1189. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
1190. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
1191. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
1192. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
1193. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
1194. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
1195. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
1196. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
1197. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
1198. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
1199. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
1200. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
1201. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
1202. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
1203. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
1204. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
1205. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
1206. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
1207. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
1208. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
1209. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
1210. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
1211. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1212. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1213. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1214. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1215. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1216. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1217. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1218. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1219. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1220. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1221. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1222. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1223. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1224. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1225. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1226. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1227. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1228. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1229. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1230. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1231. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1232. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1233. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1234. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1235. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1236. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1237. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1238. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1239. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1240. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1241. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1242. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1243. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1244. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1245. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1246. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1247. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1248. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1249. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1250. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1251. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1252. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1253. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1254. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1255. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1256. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1257. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1258. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1259. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1260. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1261. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1262. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1263. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1264. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1265. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1266. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1267. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1268. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1269. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1270. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1271. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1272. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1273. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1274. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1275. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1276. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1277. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1278. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1279. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1280. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1281. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1282. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1283. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1284. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1285. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1286. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1287. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1288. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1289. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1290. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1291. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1292. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1293. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1294. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1295. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1296. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1297. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1298. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1299. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1300. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1301. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1302. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1303. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1304. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1305. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1306. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1307. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1308. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1309. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1310. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1311. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1312. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1313. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1314. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1315. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1316. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1317. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1318. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1319. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1320. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1321. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1322. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1323. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1324. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1325. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1326. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1327. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1328. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1329. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1330. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1331. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1332. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1333. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1334. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1335. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1336. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1337. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1338. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1339. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1340. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1341. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1342. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1343. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1344. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1345. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1346. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1347. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1348. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1349. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1350. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1351. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1352. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1353. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1354. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1355. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1356. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1357. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1358. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1359. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1360. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1361. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1362. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1363. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1364. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1365. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1366. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1367. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1368. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1369. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1370. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1371. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1372. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1373. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1374. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1375. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1376. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1377. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1378. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1379. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1380. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1381. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1382. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1383. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1384. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1385. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1386. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1387. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1388. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1389. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1390. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1391. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1392. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1393. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1394. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1395. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1396. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1397. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1398. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1399. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1400. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1401. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1402. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1403. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1404. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1405. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1406. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1407. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1408. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1409. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1410. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1411. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
1412. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
1413. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
1414. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
1415. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
1416. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
1417. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1418. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
1419. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
1420. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
1421. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
1422. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
1423. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
1424. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
1425. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
1426. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
1427. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
1428. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1429. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1430. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
1431. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
1432. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
1433. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
1434. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
1435. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
1436. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
1437. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
1438. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
1439. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
1440. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1441. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
1442. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
1443. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
1444. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
1445. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
1446. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
1447. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
1448. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
1449. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
1450. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
1451. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1452. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
1453. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
1454. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
1455. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
1456. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
1457. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
1458. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
1459. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
1460. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
1461. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
1462. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1463. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
1464. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
1465. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
1466. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
1467. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
1468. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
1469. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
1470. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
1471. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
1472. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
1473. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1474. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
1475. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
1476. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
1477. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
1478. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
1479. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
1480. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
1481. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
1482. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
1483. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
1484. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1485. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
1486. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
1487. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
1488. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
1489. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
1490. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
1491. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
1492. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
1493. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
1494. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
1495. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1496. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
1497. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
1498. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
1499. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
1500. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
1501. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
1502. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
1503. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
1504. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
1505. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
1506. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1507. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
1508. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
1509. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
1510. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
1511. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
1512. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
1513. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1514. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1515. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1516. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1517. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1518. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1519. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1520. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1521. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1522. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1523. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1524. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1525. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1526. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1527. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1528. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1529. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1530. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1531. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1532. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1533. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1534. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1535. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1536. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1537. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1538. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1539. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1540. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1541. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1542. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1543. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1544. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1545. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1546. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1547. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1548. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1549. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1550. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1551. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1552. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1553. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1554. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1555. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1556. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1557. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1558. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1559. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1560. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1561. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1562. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1563. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1564. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1565. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1566. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1567. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1568. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1569. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1570. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1571. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1572. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1573. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1574. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1575. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1576. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1577. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1578. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1579. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1580. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1581. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1582. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1583. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1584. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1585. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1586. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1587. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1588. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1589. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1590. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1591. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1592. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1593. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1594. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1595. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1596. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1597. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1598. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1599. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1600. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1601. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1602. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1603. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1604. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1605. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1606. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1607. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1608. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1609. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1610. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1611. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1612. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1613. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1614. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1615. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1616. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1617. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1618. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1619. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1620. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1621. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1622. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1623. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1624. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1625. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1626. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1627. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1628. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1629. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1630. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1631. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1632. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1633. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1634. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1635. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1636. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1637. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1638. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1639. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1640. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1641. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1642. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1643. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1644. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1645. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1646. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1647. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1648. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1649. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1650. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1651. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1652. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1653. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1654. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1655. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1656. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1657. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1658. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1659. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1660. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1661. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1662. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1663. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1664. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1665. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1666. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1667. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1668. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1669. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1670. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1671. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1672. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1673. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1674. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1675. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1676. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1677. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1678. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1679. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1680. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1681. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1682. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1683. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1684. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1685. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1686. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1687. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1688. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1689. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1690. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1691. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1692. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1693. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1694. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1695. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1696. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1697. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1698. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1699. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1700. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1701. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1702. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1703. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1704. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1705. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1706. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1707. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1708. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1709. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1710. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1711. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1712. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1713. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1714. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1715. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1716. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1717. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1718. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1719. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1720. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1721. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1722. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1723. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1724. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1725. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1726. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1727. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1728. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1729. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1730. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1731. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1732. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1733. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1734. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1735. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1736. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1737. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1738. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1739. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1740. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1741. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1742. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1743. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1744. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1745. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1746. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1747. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1748. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1749. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1750. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1751. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1752. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1753. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1754. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1755. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1756. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1757. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1758. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1759. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1760. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1761. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1762. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1763. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1764. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1765. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1766. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1767. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1768. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1769. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1770. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1771. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1772. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1773. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1774. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1775. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1776. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1777. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1778. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1779. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1780. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1781. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1782. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1783. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1784. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1785. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1786. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1787. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1788. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1789. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1790. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1791. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1792. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1793. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1794. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1795. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1796. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1797. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1798. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1799. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1800. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1801. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1802. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1803. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1804. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1805. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1806. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1807. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1808. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1809. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1810. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1811. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1812. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1813. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1814. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1815. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1816. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1817. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1818. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1819. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1820. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1821. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1822. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1823. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1824. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1825. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1826. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1827. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1828. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1829. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1830. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1831. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1832. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1833. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1834. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1835. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1836. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1837. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1838. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1839. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1840. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1841. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1842. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1843. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1844. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1845. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1846. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1847. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1848. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1849. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1850. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1851. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1852. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1853. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1854. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1855. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1856. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1857. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1858. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1859. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1860. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1861. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1862. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1863. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1864. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1865. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1866. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1867. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1868. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1869. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1870. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1871. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1872. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1873. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1874. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1875. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1876. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1877. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1878. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1879. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1880. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1881. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1882. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1883. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1884. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1885. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1886. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1887. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1888. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1889. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1890. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1891. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1892. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1893. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1894. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1895. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1896. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1897. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1898. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1899. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1900. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1901. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1902. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1903. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1904. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1905. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1906. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1907. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1908. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1909. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1910. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1911. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1912. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1913. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1914. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1915. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1916. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1917. gbinv1.seq - Invertebrate sequence entries, part 1.
1918. gbinv10.seq - Invertebrate sequence entries, part 10.
1919. gbinv100.seq - Invertebrate sequence entries, part 100.
1920. gbinv101.seq - Invertebrate sequence entries, part 101.
1921. gbinv102.seq - Invertebrate sequence entries, part 102.
1922. gbinv103.seq - Invertebrate sequence entries, part 103.
1923. gbinv104.seq - Invertebrate sequence entries, part 104.
1924. gbinv105.seq - Invertebrate sequence entries, part 105.
1925. gbinv106.seq - Invertebrate sequence entries, part 106.
1926. gbinv107.seq - Invertebrate sequence entries, part 107.
1927. gbinv108.seq - Invertebrate sequence entries, part 108.
1928. gbinv109.seq - Invertebrate sequence entries, part 109.
1929. gbinv11.seq - Invertebrate sequence entries, part 11.
1930. gbinv110.seq - Invertebrate sequence entries, part 110.
1931. gbinv111.seq - Invertebrate sequence entries, part 111.
1932. gbinv112.seq - Invertebrate sequence entries, part 112.
1933. gbinv113.seq - Invertebrate sequence entries, part 113.
1934. gbinv114.seq - Invertebrate sequence entries, part 114.
1935. gbinv115.seq - Invertebrate sequence entries, part 115.
1936. gbinv116.seq - Invertebrate sequence entries, part 116.
1937. gbinv117.seq - Invertebrate sequence entries, part 117.
1938. gbinv118.seq - Invertebrate sequence entries, part 118.
1939. gbinv119.seq - Invertebrate sequence entries, part 119.
1940. gbinv12.seq - Invertebrate sequence entries, part 12.
1941. gbinv120.seq - Invertebrate sequence entries, part 120.
1942. gbinv121.seq - Invertebrate sequence entries, part 121.
1943. gbinv122.seq - Invertebrate sequence entries, part 122.
1944. gbinv123.seq - Invertebrate sequence entries, part 123.
1945. gbinv124.seq - Invertebrate sequence entries, part 124.
1946. gbinv125.seq - Invertebrate sequence entries, part 125.
1947. gbinv126.seq - Invertebrate sequence entries, part 126.
1948. gbinv127.seq - Invertebrate sequence entries, part 127.
1949. gbinv128.seq - Invertebrate sequence entries, part 128.
1950. gbinv129.seq - Invertebrate sequence entries, part 129.
1951. gbinv13.seq - Invertebrate sequence entries, part 13.
1952. gbinv130.seq - Invertebrate sequence entries, part 130.
1953. gbinv131.seq - Invertebrate sequence entries, part 131.
1954. gbinv132.seq - Invertebrate sequence entries, part 132.
1955. gbinv133.seq - Invertebrate sequence entries, part 133.
1956. gbinv134.seq - Invertebrate sequence entries, part 134.
1957. gbinv135.seq - Invertebrate sequence entries, part 135.
1958. gbinv136.seq - Invertebrate sequence entries, part 136.
1959. gbinv137.seq - Invertebrate sequence entries, part 137.
1960. gbinv138.seq - Invertebrate sequence entries, part 138.
1961. gbinv139.seq - Invertebrate sequence entries, part 139.
1962. gbinv14.seq - Invertebrate sequence entries, part 14.
1963. gbinv140.seq - Invertebrate sequence entries, part 140.
1964. gbinv141.seq - Invertebrate sequence entries, part 141.
1965. gbinv142.seq - Invertebrate sequence entries, part 142.
1966. gbinv143.seq - Invertebrate sequence entries, part 143.
1967. gbinv144.seq - Invertebrate sequence entries, part 144.
1968. gbinv145.seq - Invertebrate sequence entries, part 145.
1969. gbinv146.seq - Invertebrate sequence entries, part 146.
1970. gbinv147.seq - Invertebrate sequence entries, part 147.
1971. gbinv148.seq - Invertebrate sequence entries, part 148.
1972. gbinv149.seq - Invertebrate sequence entries, part 149.
1973. gbinv15.seq - Invertebrate sequence entries, part 15.
1974. gbinv150.seq - Invertebrate sequence entries, part 150.
1975. gbinv151.seq - Invertebrate sequence entries, part 151.
1976. gbinv152.seq - Invertebrate sequence entries, part 152.
1977. gbinv153.seq - Invertebrate sequence entries, part 153.
1978. gbinv154.seq - Invertebrate sequence entries, part 154.
1979. gbinv155.seq - Invertebrate sequence entries, part 155.
1980. gbinv156.seq - Invertebrate sequence entries, part 156.
1981. gbinv157.seq - Invertebrate sequence entries, part 157.
1982. gbinv158.seq - Invertebrate sequence entries, part 158.
1983. gbinv159.seq - Invertebrate sequence entries, part 159.
1984. gbinv16.seq - Invertebrate sequence entries, part 16.
1985. gbinv160.seq - Invertebrate sequence entries, part 160.
1986. gbinv161.seq - Invertebrate sequence entries, part 161.
1987. gbinv162.seq - Invertebrate sequence entries, part 162.
1988. gbinv163.seq - Invertebrate sequence entries, part 163.
1989. gbinv164.seq - Invertebrate sequence entries, part 164.
1990. gbinv165.seq - Invertebrate sequence entries, part 165.
1991. gbinv166.seq - Invertebrate sequence entries, part 166.
1992. gbinv167.seq - Invertebrate sequence entries, part 167.
1993. gbinv168.seq - Invertebrate sequence entries, part 168.
1994. gbinv169.seq - Invertebrate sequence entries, part 169.
1995. gbinv17.seq - Invertebrate sequence entries, part 17.
1996. gbinv170.seq - Invertebrate sequence entries, part 170.
1997. gbinv171.seq - Invertebrate sequence entries, part 171.
1998. gbinv172.seq - Invertebrate sequence entries, part 172.
1999. gbinv173.seq - Invertebrate sequence entries, part 173.
2000. gbinv174.seq - Invertebrate sequence entries, part 174.
2001. gbinv175.seq - Invertebrate sequence entries, part 175.
2002. gbinv176.seq - Invertebrate sequence entries, part 176.
2003. gbinv177.seq - Invertebrate sequence entries, part 177.
2004. gbinv178.seq - Invertebrate sequence entries, part 178.
2005. gbinv179.seq - Invertebrate sequence entries, part 179.
2006. gbinv18.seq - Invertebrate sequence entries, part 18.
2007. gbinv180.seq - Invertebrate sequence entries, part 180.
2008. gbinv181.seq - Invertebrate sequence entries, part 181.
2009. gbinv182.seq - Invertebrate sequence entries, part 182.
2010. gbinv183.seq - Invertebrate sequence entries, part 183.
2011. gbinv184.seq - Invertebrate sequence entries, part 184.
2012. gbinv185.seq - Invertebrate sequence entries, part 185.
2013. gbinv186.seq - Invertebrate sequence entries, part 186.
2014. gbinv187.seq - Invertebrate sequence entries, part 187.
2015. gbinv188.seq - Invertebrate sequence entries, part 188.
2016. gbinv189.seq - Invertebrate sequence entries, part 189.
2017. gbinv19.seq - Invertebrate sequence entries, part 19.
2018. gbinv190.seq - Invertebrate sequence entries, part 190.
2019. gbinv191.seq - Invertebrate sequence entries, part 191.
2020. gbinv192.seq - Invertebrate sequence entries, part 192.
2021. gbinv193.seq - Invertebrate sequence entries, part 193.
2022. gbinv194.seq - Invertebrate sequence entries, part 194.
2023. gbinv195.seq - Invertebrate sequence entries, part 195.
2024. gbinv196.seq - Invertebrate sequence entries, part 196.
2025. gbinv197.seq - Invertebrate sequence entries, part 197.
2026. gbinv198.seq - Invertebrate sequence entries, part 198.
2027. gbinv199.seq - Invertebrate sequence entries, part 199.
2028. gbinv2.seq - Invertebrate sequence entries, part 2.
2029. gbinv20.seq - Invertebrate sequence entries, part 20.
2030. gbinv200.seq - Invertebrate sequence entries, part 200.
2031. gbinv201.seq - Invertebrate sequence entries, part 201.
2032. gbinv202.seq - Invertebrate sequence entries, part 202.
2033. gbinv203.seq - Invertebrate sequence entries, part 203.
2034. gbinv204.seq - Invertebrate sequence entries, part 204.
2035. gbinv205.seq - Invertebrate sequence entries, part 205.
2036. gbinv206.seq - Invertebrate sequence entries, part 206.
2037. gbinv207.seq - Invertebrate sequence entries, part 207.
2038. gbinv208.seq - Invertebrate sequence entries, part 208.
2039. gbinv209.seq - Invertebrate sequence entries, part 209.
2040. gbinv21.seq - Invertebrate sequence entries, part 21.
2041. gbinv210.seq - Invertebrate sequence entries, part 210.
2042. gbinv211.seq - Invertebrate sequence entries, part 211.
2043. gbinv212.seq - Invertebrate sequence entries, part 212.
2044. gbinv213.seq - Invertebrate sequence entries, part 213.
2045. gbinv214.seq - Invertebrate sequence entries, part 214.
2046. gbinv215.seq - Invertebrate sequence entries, part 215.
2047. gbinv216.seq - Invertebrate sequence entries, part 216.
2048. gbinv217.seq - Invertebrate sequence entries, part 217.
2049. gbinv218.seq - Invertebrate sequence entries, part 218.
2050. gbinv219.seq - Invertebrate sequence entries, part 219.
2051. gbinv22.seq - Invertebrate sequence entries, part 22.
2052. gbinv220.seq - Invertebrate sequence entries, part 220.
2053. gbinv221.seq - Invertebrate sequence entries, part 221.
2054. gbinv222.seq - Invertebrate sequence entries, part 222.
2055. gbinv223.seq - Invertebrate sequence entries, part 223.
2056. gbinv224.seq - Invertebrate sequence entries, part 224.
2057. gbinv225.seq - Invertebrate sequence entries, part 225.
2058. gbinv226.seq - Invertebrate sequence entries, part 226.
2059. gbinv227.seq - Invertebrate sequence entries, part 227.
2060. gbinv228.seq - Invertebrate sequence entries, part 228.
2061. gbinv229.seq - Invertebrate sequence entries, part 229.
2062. gbinv23.seq - Invertebrate sequence entries, part 23.
2063. gbinv230.seq - Invertebrate sequence entries, part 230.
2064. gbinv231.seq - Invertebrate sequence entries, part 231.
2065. gbinv232.seq - Invertebrate sequence entries, part 232.
2066. gbinv233.seq - Invertebrate sequence entries, part 233.
2067. gbinv234.seq - Invertebrate sequence entries, part 234.
2068. gbinv235.seq - Invertebrate sequence entries, part 235.
2069. gbinv236.seq - Invertebrate sequence entries, part 236.
2070. gbinv237.seq - Invertebrate sequence entries, part 237.
2071. gbinv238.seq - Invertebrate sequence entries, part 238.
2072. gbinv239.seq - Invertebrate sequence entries, part 239.
2073. gbinv24.seq - Invertebrate sequence entries, part 24.
2074. gbinv240.seq - Invertebrate sequence entries, part 240.
2075. gbinv241.seq - Invertebrate sequence entries, part 241.
2076. gbinv242.seq - Invertebrate sequence entries, part 242.
2077. gbinv243.seq - Invertebrate sequence entries, part 243.
2078. gbinv244.seq - Invertebrate sequence entries, part 244.
2079. gbinv245.seq - Invertebrate sequence entries, part 245.
2080. gbinv246.seq - Invertebrate sequence entries, part 246.
2081. gbinv247.seq - Invertebrate sequence entries, part 247.
2082. gbinv248.seq - Invertebrate sequence entries, part 248.
2083. gbinv249.seq - Invertebrate sequence entries, part 249.
2084. gbinv25.seq - Invertebrate sequence entries, part 25.
2085. gbinv250.seq - Invertebrate sequence entries, part 250.
2086. gbinv251.seq - Invertebrate sequence entries, part 251.
2087. gbinv252.seq - Invertebrate sequence entries, part 252.
2088. gbinv253.seq - Invertebrate sequence entries, part 253.
2089. gbinv254.seq - Invertebrate sequence entries, part 254.
2090. gbinv255.seq - Invertebrate sequence entries, part 255.
2091. gbinv256.seq - Invertebrate sequence entries, part 256.
2092. gbinv257.seq - Invertebrate sequence entries, part 257.
2093. gbinv258.seq - Invertebrate sequence entries, part 258.
2094. gbinv259.seq - Invertebrate sequence entries, part 259.
2095. gbinv26.seq - Invertebrate sequence entries, part 26.
2096. gbinv260.seq - Invertebrate sequence entries, part 260.
2097. gbinv261.seq - Invertebrate sequence entries, part 261.
2098. gbinv262.seq - Invertebrate sequence entries, part 262.
2099. gbinv263.seq - Invertebrate sequence entries, part 263.
2100. gbinv264.seq - Invertebrate sequence entries, part 264.
2101. gbinv265.seq - Invertebrate sequence entries, part 265.
2102. gbinv266.seq - Invertebrate sequence entries, part 266.
2103. gbinv267.seq - Invertebrate sequence entries, part 267.
2104. gbinv268.seq - Invertebrate sequence entries, part 268.
2105. gbinv269.seq - Invertebrate sequence entries, part 269.
2106. gbinv27.seq - Invertebrate sequence entries, part 27.
2107. gbinv270.seq - Invertebrate sequence entries, part 270.
2108. gbinv271.seq - Invertebrate sequence entries, part 271.
2109. gbinv272.seq - Invertebrate sequence entries, part 272.
2110. gbinv273.seq - Invertebrate sequence entries, part 273.
2111. gbinv274.seq - Invertebrate sequence entries, part 274.
2112. gbinv275.seq - Invertebrate sequence entries, part 275.
2113. gbinv276.seq - Invertebrate sequence entries, part 276.
2114. gbinv277.seq - Invertebrate sequence entries, part 277.
2115. gbinv278.seq - Invertebrate sequence entries, part 278.
2116. gbinv279.seq - Invertebrate sequence entries, part 279.
2117. gbinv28.seq - Invertebrate sequence entries, part 28.
2118. gbinv280.seq - Invertebrate sequence entries, part 280.
2119. gbinv281.seq - Invertebrate sequence entries, part 281.
2120. gbinv282.seq - Invertebrate sequence entries, part 282.
2121. gbinv283.seq - Invertebrate sequence entries, part 283.
2122. gbinv284.seq - Invertebrate sequence entries, part 284.
2123. gbinv285.seq - Invertebrate sequence entries, part 285.
2124. gbinv286.seq - Invertebrate sequence entries, part 286.
2125. gbinv287.seq - Invertebrate sequence entries, part 287.
2126. gbinv288.seq - Invertebrate sequence entries, part 288.
2127. gbinv289.seq - Invertebrate sequence entries, part 289.
2128. gbinv29.seq - Invertebrate sequence entries, part 29.
2129. gbinv290.seq - Invertebrate sequence entries, part 290.
2130. gbinv291.seq - Invertebrate sequence entries, part 291.
2131. gbinv292.seq - Invertebrate sequence entries, part 292.
2132. gbinv293.seq - Invertebrate sequence entries, part 293.
2133. gbinv294.seq - Invertebrate sequence entries, part 294.
2134. gbinv295.seq - Invertebrate sequence entries, part 295.
2135. gbinv296.seq - Invertebrate sequence entries, part 296.
2136. gbinv297.seq - Invertebrate sequence entries, part 297.
2137. gbinv298.seq - Invertebrate sequence entries, part 298.
2138. gbinv299.seq - Invertebrate sequence entries, part 299.
2139. gbinv3.seq - Invertebrate sequence entries, part 3.
2140. gbinv30.seq - Invertebrate sequence entries, part 30.
2141. gbinv300.seq - Invertebrate sequence entries, part 300.
2142. gbinv301.seq - Invertebrate sequence entries, part 301.
2143. gbinv302.seq - Invertebrate sequence entries, part 302.
2144. gbinv303.seq - Invertebrate sequence entries, part 303.
2145. gbinv304.seq - Invertebrate sequence entries, part 304.
2146. gbinv305.seq - Invertebrate sequence entries, part 305.
2147. gbinv306.seq - Invertebrate sequence entries, part 306.
2148. gbinv307.seq - Invertebrate sequence entries, part 307.
2149. gbinv308.seq - Invertebrate sequence entries, part 308.
2150. gbinv309.seq - Invertebrate sequence entries, part 309.
2151. gbinv31.seq - Invertebrate sequence entries, part 31.
2152. gbinv310.seq - Invertebrate sequence entries, part 310.
2153. gbinv311.seq - Invertebrate sequence entries, part 311.
2154. gbinv312.seq - Invertebrate sequence entries, part 312.
2155. gbinv313.seq - Invertebrate sequence entries, part 313.
2156. gbinv314.seq - Invertebrate sequence entries, part 314.
2157. gbinv315.seq - Invertebrate sequence entries, part 315.
2158. gbinv316.seq - Invertebrate sequence entries, part 316.
2159. gbinv317.seq - Invertebrate sequence entries, part 317.
2160. gbinv318.seq - Invertebrate sequence entries, part 318.
2161. gbinv319.seq - Invertebrate sequence entries, part 319.
2162. gbinv32.seq - Invertebrate sequence entries, part 32.
2163. gbinv320.seq - Invertebrate sequence entries, part 320.
2164. gbinv321.seq - Invertebrate sequence entries, part 321.
2165. gbinv322.seq - Invertebrate sequence entries, part 322.
2166. gbinv323.seq - Invertebrate sequence entries, part 323.
2167. gbinv324.seq - Invertebrate sequence entries, part 324.
2168. gbinv325.seq - Invertebrate sequence entries, part 325.
2169. gbinv326.seq - Invertebrate sequence entries, part 326.
2170. gbinv327.seq - Invertebrate sequence entries, part 327.
2171. gbinv328.seq - Invertebrate sequence entries, part 328.
2172. gbinv329.seq - Invertebrate sequence entries, part 329.
2173. gbinv33.seq - Invertebrate sequence entries, part 33.
2174. gbinv330.seq - Invertebrate sequence entries, part 330.
2175. gbinv331.seq - Invertebrate sequence entries, part 331.
2176. gbinv332.seq - Invertebrate sequence entries, part 332.
2177. gbinv333.seq - Invertebrate sequence entries, part 333.
2178. gbinv334.seq - Invertebrate sequence entries, part 334.
2179. gbinv335.seq - Invertebrate sequence entries, part 335.
2180. gbinv336.seq - Invertebrate sequence entries, part 336.
2181. gbinv337.seq - Invertebrate sequence entries, part 337.
2182. gbinv338.seq - Invertebrate sequence entries, part 338.
2183. gbinv339.seq - Invertebrate sequence entries, part 339.
2184. gbinv34.seq - Invertebrate sequence entries, part 34.
2185. gbinv340.seq - Invertebrate sequence entries, part 340.
2186. gbinv341.seq - Invertebrate sequence entries, part 341.
2187. gbinv342.seq - Invertebrate sequence entries, part 342.
2188. gbinv343.seq - Invertebrate sequence entries, part 343.
2189. gbinv344.seq - Invertebrate sequence entries, part 344.
2190. gbinv345.seq - Invertebrate sequence entries, part 345.
2191. gbinv346.seq - Invertebrate sequence entries, part 346.
2192. gbinv347.seq - Invertebrate sequence entries, part 347.
2193. gbinv348.seq - Invertebrate sequence entries, part 348.
2194. gbinv349.seq - Invertebrate sequence entries, part 349.
2195. gbinv35.seq - Invertebrate sequence entries, part 35.
2196. gbinv350.seq - Invertebrate sequence entries, part 350.
2197. gbinv351.seq - Invertebrate sequence entries, part 351.
2198. gbinv352.seq - Invertebrate sequence entries, part 352.
2199. gbinv353.seq - Invertebrate sequence entries, part 353.
2200. gbinv354.seq - Invertebrate sequence entries, part 354.
2201. gbinv355.seq - Invertebrate sequence entries, part 355.
2202. gbinv356.seq - Invertebrate sequence entries, part 356.
2203. gbinv357.seq - Invertebrate sequence entries, part 357.
2204. gbinv358.seq - Invertebrate sequence entries, part 358.
2205. gbinv359.seq - Invertebrate sequence entries, part 359.
2206. gbinv36.seq - Invertebrate sequence entries, part 36.
2207. gbinv360.seq - Invertebrate sequence entries, part 360.
2208. gbinv361.seq - Invertebrate sequence entries, part 361.
2209. gbinv362.seq - Invertebrate sequence entries, part 362.
2210. gbinv363.seq - Invertebrate sequence entries, part 363.
2211. gbinv364.seq - Invertebrate sequence entries, part 364.
2212. gbinv365.seq - Invertebrate sequence entries, part 365.
2213. gbinv366.seq - Invertebrate sequence entries, part 366.
2214. gbinv367.seq - Invertebrate sequence entries, part 367.
2215. gbinv368.seq - Invertebrate sequence entries, part 368.
2216. gbinv369.seq - Invertebrate sequence entries, part 369.
2217. gbinv37.seq - Invertebrate sequence entries, part 37.
2218. gbinv370.seq - Invertebrate sequence entries, part 370.
2219. gbinv371.seq - Invertebrate sequence entries, part 371.
2220. gbinv372.seq - Invertebrate sequence entries, part 372.
2221. gbinv373.seq - Invertebrate sequence entries, part 373.
2222. gbinv374.seq - Invertebrate sequence entries, part 374.
2223. gbinv375.seq - Invertebrate sequence entries, part 375.
2224. gbinv376.seq - Invertebrate sequence entries, part 376.
2225. gbinv377.seq - Invertebrate sequence entries, part 377.
2226. gbinv378.seq - Invertebrate sequence entries, part 378.
2227. gbinv379.seq - Invertebrate sequence entries, part 379.
2228. gbinv38.seq - Invertebrate sequence entries, part 38.
2229. gbinv380.seq - Invertebrate sequence entries, part 380.
2230. gbinv381.seq - Invertebrate sequence entries, part 381.
2231. gbinv382.seq - Invertebrate sequence entries, part 382.
2232. gbinv383.seq - Invertebrate sequence entries, part 383.
2233. gbinv384.seq - Invertebrate sequence entries, part 384.
2234. gbinv385.seq - Invertebrate sequence entries, part 385.
2235. gbinv386.seq - Invertebrate sequence entries, part 386.
2236. gbinv387.seq - Invertebrate sequence entries, part 387.
2237. gbinv388.seq - Invertebrate sequence entries, part 388.
2238. gbinv389.seq - Invertebrate sequence entries, part 389.
2239. gbinv39.seq - Invertebrate sequence entries, part 39.
2240. gbinv390.seq - Invertebrate sequence entries, part 390.
2241. gbinv391.seq - Invertebrate sequence entries, part 391.
2242. gbinv392.seq - Invertebrate sequence entries, part 392.
2243. gbinv393.seq - Invertebrate sequence entries, part 393.
2244. gbinv394.seq - Invertebrate sequence entries, part 394.
2245. gbinv395.seq - Invertebrate sequence entries, part 395.
2246. gbinv396.seq - Invertebrate sequence entries, part 396.
2247. gbinv397.seq - Invertebrate sequence entries, part 397.
2248. gbinv398.seq - Invertebrate sequence entries, part 398.
2249. gbinv399.seq - Invertebrate sequence entries, part 399.
2250. gbinv4.seq - Invertebrate sequence entries, part 4.
2251. gbinv40.seq - Invertebrate sequence entries, part 40.
2252. gbinv400.seq - Invertebrate sequence entries, part 400.
2253. gbinv401.seq - Invertebrate sequence entries, part 401.
2254. gbinv402.seq - Invertebrate sequence entries, part 402.
2255. gbinv403.seq - Invertebrate sequence entries, part 403.
2256. gbinv404.seq - Invertebrate sequence entries, part 404.
2257. gbinv405.seq - Invertebrate sequence entries, part 405.
2258. gbinv406.seq - Invertebrate sequence entries, part 406.
2259. gbinv407.seq - Invertebrate sequence entries, part 407.
2260. gbinv408.seq - Invertebrate sequence entries, part 408.
2261. gbinv409.seq - Invertebrate sequence entries, part 409.
2262. gbinv41.seq - Invertebrate sequence entries, part 41.
2263. gbinv410.seq - Invertebrate sequence entries, part 410.
2264. gbinv411.seq - Invertebrate sequence entries, part 411.
2265. gbinv412.seq - Invertebrate sequence entries, part 412.
2266. gbinv413.seq - Invertebrate sequence entries, part 413.
2267. gbinv414.seq - Invertebrate sequence entries, part 414.
2268. gbinv415.seq - Invertebrate sequence entries, part 415.
2269. gbinv416.seq - Invertebrate sequence entries, part 416.
2270. gbinv417.seq - Invertebrate sequence entries, part 417.
2271. gbinv418.seq - Invertebrate sequence entries, part 418.
2272. gbinv419.seq - Invertebrate sequence entries, part 419.
2273. gbinv42.seq - Invertebrate sequence entries, part 42.
2274. gbinv420.seq - Invertebrate sequence entries, part 420.
2275. gbinv421.seq - Invertebrate sequence entries, part 421.
2276. gbinv422.seq - Invertebrate sequence entries, part 422.
2277. gbinv423.seq - Invertebrate sequence entries, part 423.
2278. gbinv424.seq - Invertebrate sequence entries, part 424.
2279. gbinv425.seq - Invertebrate sequence entries, part 425.
2280. gbinv426.seq - Invertebrate sequence entries, part 426.
2281. gbinv427.seq - Invertebrate sequence entries, part 427.
2282. gbinv428.seq - Invertebrate sequence entries, part 428.
2283. gbinv429.seq - Invertebrate sequence entries, part 429.
2284. gbinv43.seq - Invertebrate sequence entries, part 43.
2285. gbinv430.seq - Invertebrate sequence entries, part 430.
2286. gbinv431.seq - Invertebrate sequence entries, part 431.
2287. gbinv432.seq - Invertebrate sequence entries, part 432.
2288. gbinv433.seq - Invertebrate sequence entries, part 433.
2289. gbinv434.seq - Invertebrate sequence entries, part 434.
2290. gbinv435.seq - Invertebrate sequence entries, part 435.
2291. gbinv436.seq - Invertebrate sequence entries, part 436.
2292. gbinv437.seq - Invertebrate sequence entries, part 437.
2293. gbinv438.seq - Invertebrate sequence entries, part 438.
2294. gbinv439.seq - Invertebrate sequence entries, part 439.
2295. gbinv44.seq - Invertebrate sequence entries, part 44.
2296. gbinv440.seq - Invertebrate sequence entries, part 440.
2297. gbinv441.seq - Invertebrate sequence entries, part 441.
2298. gbinv442.seq - Invertebrate sequence entries, part 442.
2299. gbinv443.seq - Invertebrate sequence entries, part 443.
2300. gbinv444.seq - Invertebrate sequence entries, part 444.
2301. gbinv445.seq - Invertebrate sequence entries, part 445.
2302. gbinv446.seq - Invertebrate sequence entries, part 446.
2303. gbinv447.seq - Invertebrate sequence entries, part 447.
2304. gbinv448.seq - Invertebrate sequence entries, part 448.
2305. gbinv449.seq - Invertebrate sequence entries, part 449.
2306. gbinv45.seq - Invertebrate sequence entries, part 45.
2307. gbinv450.seq - Invertebrate sequence entries, part 450.
2308. gbinv451.seq - Invertebrate sequence entries, part 451.
2309. gbinv452.seq - Invertebrate sequence entries, part 452.
2310. gbinv453.seq - Invertebrate sequence entries, part 453.
2311. gbinv454.seq - Invertebrate sequence entries, part 454.
2312. gbinv455.seq - Invertebrate sequence entries, part 455.
2313. gbinv456.seq - Invertebrate sequence entries, part 456.
2314. gbinv457.seq - Invertebrate sequence entries, part 457.
2315. gbinv458.seq - Invertebrate sequence entries, part 458.
2316. gbinv459.seq - Invertebrate sequence entries, part 459.
2317. gbinv46.seq - Invertebrate sequence entries, part 46.
2318. gbinv460.seq - Invertebrate sequence entries, part 460.
2319. gbinv461.seq - Invertebrate sequence entries, part 461.
2320. gbinv462.seq - Invertebrate sequence entries, part 462.
2321. gbinv463.seq - Invertebrate sequence entries, part 463.
2322. gbinv464.seq - Invertebrate sequence entries, part 464.
2323. gbinv465.seq - Invertebrate sequence entries, part 465.
2324. gbinv466.seq - Invertebrate sequence entries, part 466.
2325. gbinv467.seq - Invertebrate sequence entries, part 467.
2326. gbinv468.seq - Invertebrate sequence entries, part 468.
2327. gbinv469.seq - Invertebrate sequence entries, part 469.
2328. gbinv47.seq - Invertebrate sequence entries, part 47.
2329. gbinv470.seq - Invertebrate sequence entries, part 470.
2330. gbinv471.seq - Invertebrate sequence entries, part 471.
2331. gbinv472.seq - Invertebrate sequence entries, part 472.
2332. gbinv473.seq - Invertebrate sequence entries, part 473.
2333. gbinv474.seq - Invertebrate sequence entries, part 474.
2334. gbinv475.seq - Invertebrate sequence entries, part 475.
2335. gbinv476.seq - Invertebrate sequence entries, part 476.
2336. gbinv477.seq - Invertebrate sequence entries, part 477.
2337. gbinv478.seq - Invertebrate sequence entries, part 478.
2338. gbinv479.seq - Invertebrate sequence entries, part 479.
2339. gbinv48.seq - Invertebrate sequence entries, part 48.
2340. gbinv480.seq - Invertebrate sequence entries, part 480.
2341. gbinv481.seq - Invertebrate sequence entries, part 481.
2342. gbinv482.seq - Invertebrate sequence entries, part 482.
2343. gbinv483.seq - Invertebrate sequence entries, part 483.
2344. gbinv484.seq - Invertebrate sequence entries, part 484.
2345. gbinv485.seq - Invertebrate sequence entries, part 485.
2346. gbinv486.seq - Invertebrate sequence entries, part 486.
2347. gbinv487.seq - Invertebrate sequence entries, part 487.
2348. gbinv488.seq - Invertebrate sequence entries, part 488.
2349. gbinv49.seq - Invertebrate sequence entries, part 49.
2350. gbinv5.seq - Invertebrate sequence entries, part 5.
2351. gbinv50.seq - Invertebrate sequence entries, part 50.
2352. gbinv51.seq - Invertebrate sequence entries, part 51.
2353. gbinv52.seq - Invertebrate sequence entries, part 52.
2354. gbinv53.seq - Invertebrate sequence entries, part 53.
2355. gbinv54.seq - Invertebrate sequence entries, part 54.
2356. gbinv55.seq - Invertebrate sequence entries, part 55.
2357. gbinv56.seq - Invertebrate sequence entries, part 56.
2358. gbinv57.seq - Invertebrate sequence entries, part 57.
2359. gbinv58.seq - Invertebrate sequence entries, part 58.
2360. gbinv59.seq - Invertebrate sequence entries, part 59.
2361. gbinv6.seq - Invertebrate sequence entries, part 6.
2362. gbinv60.seq - Invertebrate sequence entries, part 60.
2363. gbinv61.seq - Invertebrate sequence entries, part 61.
2364. gbinv62.seq - Invertebrate sequence entries, part 62.
2365. gbinv63.seq - Invertebrate sequence entries, part 63.
2366. gbinv64.seq - Invertebrate sequence entries, part 64.
2367. gbinv65.seq - Invertebrate sequence entries, part 65.
2368. gbinv66.seq - Invertebrate sequence entries, part 66.
2369. gbinv67.seq - Invertebrate sequence entries, part 67.
2370. gbinv68.seq - Invertebrate sequence entries, part 68.
2371. gbinv69.seq - Invertebrate sequence entries, part 69.
2372. gbinv7.seq - Invertebrate sequence entries, part 7.
2373. gbinv70.seq - Invertebrate sequence entries, part 70.
2374. gbinv71.seq - Invertebrate sequence entries, part 71.
2375. gbinv72.seq - Invertebrate sequence entries, part 72.
2376. gbinv73.seq - Invertebrate sequence entries, part 73.
2377. gbinv74.seq - Invertebrate sequence entries, part 74.
2378. gbinv75.seq - Invertebrate sequence entries, part 75.
2379. gbinv76.seq - Invertebrate sequence entries, part 76.
2380. gbinv77.seq - Invertebrate sequence entries, part 77.
2381. gbinv78.seq - Invertebrate sequence entries, part 78.
2382. gbinv79.seq - Invertebrate sequence entries, part 79.
2383. gbinv8.seq - Invertebrate sequence entries, part 8.
2384. gbinv80.seq - Invertebrate sequence entries, part 80.
2385. gbinv81.seq - Invertebrate sequence entries, part 81.
2386. gbinv82.seq - Invertebrate sequence entries, part 82.
2387. gbinv83.seq - Invertebrate sequence entries, part 83.
2388. gbinv84.seq - Invertebrate sequence entries, part 84.
2389. gbinv85.seq - Invertebrate sequence entries, part 85.
2390. gbinv86.seq - Invertebrate sequence entries, part 86.
2391. gbinv87.seq - Invertebrate sequence entries, part 87.
2392. gbinv88.seq - Invertebrate sequence entries, part 88.
2393. gbinv89.seq - Invertebrate sequence entries, part 89.
2394. gbinv9.seq - Invertebrate sequence entries, part 9.
2395. gbinv90.seq - Invertebrate sequence entries, part 90.
2396. gbinv91.seq - Invertebrate sequence entries, part 91.
2397. gbinv92.seq - Invertebrate sequence entries, part 92.
2398. gbinv93.seq - Invertebrate sequence entries, part 93.
2399. gbinv94.seq - Invertebrate sequence entries, part 94.
2400. gbinv95.seq - Invertebrate sequence entries, part 95.
2401. gbinv96.seq - Invertebrate sequence entries, part 96.
2402. gbinv97.seq - Invertebrate sequence entries, part 97.
2403. gbinv98.seq - Invertebrate sequence entries, part 98.
2404. gbinv99.seq - Invertebrate sequence entries, part 99.
2405. gbmam1.seq - Other mammalian sequence entries, part 1.
2406. gbmam10.seq - Other mammalian sequence entries, part 10.
2407. gbmam100.seq - Other mammalian sequence entries, part 100.
2408. gbmam101.seq - Other mammalian sequence entries, part 101.
2409. gbmam102.seq - Other mammalian sequence entries, part 102.
2410. gbmam103.seq - Other mammalian sequence entries, part 103.
2411. gbmam104.seq - Other mammalian sequence entries, part 104.
2412. gbmam105.seq - Other mammalian sequence entries, part 105.
2413. gbmam106.seq - Other mammalian sequence entries, part 106.
2414. gbmam107.seq - Other mammalian sequence entries, part 107.
2415. gbmam108.seq - Other mammalian sequence entries, part 108.
2416. gbmam109.seq - Other mammalian sequence entries, part 109.
2417. gbmam11.seq - Other mammalian sequence entries, part 11.
2418. gbmam110.seq - Other mammalian sequence entries, part 110.
2419. gbmam111.seq - Other mammalian sequence entries, part 111.
2420. gbmam112.seq - Other mammalian sequence entries, part 112.
2421. gbmam113.seq - Other mammalian sequence entries, part 113.
2422. gbmam114.seq - Other mammalian sequence entries, part 114.
2423. gbmam115.seq - Other mammalian sequence entries, part 115.
2424. gbmam116.seq - Other mammalian sequence entries, part 116.
2425. gbmam12.seq - Other mammalian sequence entries, part 12.
2426. gbmam13.seq - Other mammalian sequence entries, part 13.
2427. gbmam14.seq - Other mammalian sequence entries, part 14.
2428. gbmam15.seq - Other mammalian sequence entries, part 15.
2429. gbmam16.seq - Other mammalian sequence entries, part 16.
2430. gbmam17.seq - Other mammalian sequence entries, part 17.
2431. gbmam18.seq - Other mammalian sequence entries, part 18.
2432. gbmam19.seq - Other mammalian sequence entries, part 19.
2433. gbmam2.seq - Other mammalian sequence entries, part 2.
2434. gbmam20.seq - Other mammalian sequence entries, part 20.
2435. gbmam21.seq - Other mammalian sequence entries, part 21.
2436. gbmam22.seq - Other mammalian sequence entries, part 22.
2437. gbmam23.seq - Other mammalian sequence entries, part 23.
2438. gbmam24.seq - Other mammalian sequence entries, part 24.
2439. gbmam25.seq - Other mammalian sequence entries, part 25.
2440. gbmam26.seq - Other mammalian sequence entries, part 26.
2441. gbmam27.seq - Other mammalian sequence entries, part 27.
2442. gbmam28.seq - Other mammalian sequence entries, part 28.
2443. gbmam29.seq - Other mammalian sequence entries, part 29.
2444. gbmam3.seq - Other mammalian sequence entries, part 3.
2445. gbmam30.seq - Other mammalian sequence entries, part 30.
2446. gbmam31.seq - Other mammalian sequence entries, part 31.
2447. gbmam32.seq - Other mammalian sequence entries, part 32.
2448. gbmam33.seq - Other mammalian sequence entries, part 33.
2449. gbmam34.seq - Other mammalian sequence entries, part 34.
2450. gbmam35.seq - Other mammalian sequence entries, part 35.
2451. gbmam36.seq - Other mammalian sequence entries, part 36.
2452. gbmam37.seq - Other mammalian sequence entries, part 37.
2453. gbmam38.seq - Other mammalian sequence entries, part 38.
2454. gbmam39.seq - Other mammalian sequence entries, part 39.
2455. gbmam4.seq - Other mammalian sequence entries, part 4.
2456. gbmam40.seq - Other mammalian sequence entries, part 40.
2457. gbmam41.seq - Other mammalian sequence entries, part 41.
2458. gbmam42.seq - Other mammalian sequence entries, part 42.
2459. gbmam43.seq - Other mammalian sequence entries, part 43.
2460. gbmam44.seq - Other mammalian sequence entries, part 44.
2461. gbmam45.seq - Other mammalian sequence entries, part 45.
2462. gbmam46.seq - Other mammalian sequence entries, part 46.
2463. gbmam47.seq - Other mammalian sequence entries, part 47.
2464. gbmam48.seq - Other mammalian sequence entries, part 48.
2465. gbmam49.seq - Other mammalian sequence entries, part 49.
2466. gbmam5.seq - Other mammalian sequence entries, part 5.
2467. gbmam50.seq - Other mammalian sequence entries, part 50.
2468. gbmam51.seq - Other mammalian sequence entries, part 51.
2469. gbmam52.seq - Other mammalian sequence entries, part 52.
2470. gbmam53.seq - Other mammalian sequence entries, part 53.
2471. gbmam54.seq - Other mammalian sequence entries, part 54.
2472. gbmam55.seq - Other mammalian sequence entries, part 55.
2473. gbmam56.seq - Other mammalian sequence entries, part 56.
2474. gbmam57.seq - Other mammalian sequence entries, part 57.
2475. gbmam58.seq - Other mammalian sequence entries, part 58.
2476. gbmam59.seq - Other mammalian sequence entries, part 59.
2477. gbmam6.seq - Other mammalian sequence entries, part 6.
2478. gbmam60.seq - Other mammalian sequence entries, part 60.
2479. gbmam61.seq - Other mammalian sequence entries, part 61.
2480. gbmam62.seq - Other mammalian sequence entries, part 62.
2481. gbmam63.seq - Other mammalian sequence entries, part 63.
2482. gbmam64.seq - Other mammalian sequence entries, part 64.
2483. gbmam65.seq - Other mammalian sequence entries, part 65.
2484. gbmam66.seq - Other mammalian sequence entries, part 66.
2485. gbmam67.seq - Other mammalian sequence entries, part 67.
2486. gbmam68.seq - Other mammalian sequence entries, part 68.
2487. gbmam69.seq - Other mammalian sequence entries, part 69.
2488. gbmam7.seq - Other mammalian sequence entries, part 7.
2489. gbmam70.seq - Other mammalian sequence entries, part 70.
2490. gbmam71.seq - Other mammalian sequence entries, part 71.
2491. gbmam72.seq - Other mammalian sequence entries, part 72.
2492. gbmam73.seq - Other mammalian sequence entries, part 73.
2493. gbmam74.seq - Other mammalian sequence entries, part 74.
2494. gbmam75.seq - Other mammalian sequence entries, part 75.
2495. gbmam76.seq - Other mammalian sequence entries, part 76.
2496. gbmam77.seq - Other mammalian sequence entries, part 77.
2497. gbmam78.seq - Other mammalian sequence entries, part 78.
2498. gbmam79.seq - Other mammalian sequence entries, part 79.
2499. gbmam8.seq - Other mammalian sequence entries, part 8.
2500. gbmam80.seq - Other mammalian sequence entries, part 80.
2501. gbmam81.seq - Other mammalian sequence entries, part 81.
2502. gbmam82.seq - Other mammalian sequence entries, part 82.
2503. gbmam83.seq - Other mammalian sequence entries, part 83.
2504. gbmam84.seq - Other mammalian sequence entries, part 84.
2505. gbmam85.seq - Other mammalian sequence entries, part 85.
2506. gbmam86.seq - Other mammalian sequence entries, part 86.
2507. gbmam87.seq - Other mammalian sequence entries, part 87.
2508. gbmam88.seq - Other mammalian sequence entries, part 88.
2509. gbmam89.seq - Other mammalian sequence entries, part 89.
2510. gbmam9.seq - Other mammalian sequence entries, part 9.
2511. gbmam90.seq - Other mammalian sequence entries, part 90.
2512. gbmam91.seq - Other mammalian sequence entries, part 91.
2513. gbmam92.seq - Other mammalian sequence entries, part 92.
2514. gbmam93.seq - Other mammalian sequence entries, part 93.
2515. gbmam94.seq - Other mammalian sequence entries, part 94.
2516. gbmam95.seq - Other mammalian sequence entries, part 95.
2517. gbmam96.seq - Other mammalian sequence entries, part 96.
2518. gbmam97.seq - Other mammalian sequence entries, part 97.
2519. gbmam98.seq - Other mammalian sequence entries, part 98.
2520. gbmam99.seq - Other mammalian sequence entries, part 99.
2521. gbnew.txt - Accession numbers of entries new since the previous release.
2522. gbpat1.seq - Patent sequence entries, part 1.
2523. gbpat10.seq - Patent sequence entries, part 10.
2524. gbpat100.seq - Patent sequence entries, part 100.
2525. gbpat101.seq - Patent sequence entries, part 101.
2526. gbpat102.seq - Patent sequence entries, part 102.
2527. gbpat103.seq - Patent sequence entries, part 103.
2528. gbpat104.seq - Patent sequence entries, part 104.
2529. gbpat105.seq - Patent sequence entries, part 105.
2530. gbpat106.seq - Patent sequence entries, part 106.
2531. gbpat107.seq - Patent sequence entries, part 107.
2532. gbpat108.seq - Patent sequence entries, part 108.
2533. gbpat109.seq - Patent sequence entries, part 109.
2534. gbpat11.seq - Patent sequence entries, part 11.
2535. gbpat110.seq - Patent sequence entries, part 110.
2536. gbpat111.seq - Patent sequence entries, part 111.
2537. gbpat112.seq - Patent sequence entries, part 112.
2538. gbpat113.seq - Patent sequence entries, part 113.
2539. gbpat114.seq - Patent sequence entries, part 114.
2540. gbpat115.seq - Patent sequence entries, part 115.
2541. gbpat116.seq - Patent sequence entries, part 116.
2542. gbpat117.seq - Patent sequence entries, part 117.
2543. gbpat118.seq - Patent sequence entries, part 118.
2544. gbpat119.seq - Patent sequence entries, part 119.
2545. gbpat12.seq - Patent sequence entries, part 12.
2546. gbpat120.seq - Patent sequence entries, part 120.
2547. gbpat121.seq - Patent sequence entries, part 121.
2548. gbpat122.seq - Patent sequence entries, part 122.
2549. gbpat123.seq - Patent sequence entries, part 123.
2550. gbpat124.seq - Patent sequence entries, part 124.
2551. gbpat125.seq - Patent sequence entries, part 125.
2552. gbpat126.seq - Patent sequence entries, part 126.
2553. gbpat127.seq - Patent sequence entries, part 127.
2554. gbpat128.seq - Patent sequence entries, part 128.
2555. gbpat129.seq - Patent sequence entries, part 129.
2556. gbpat13.seq - Patent sequence entries, part 13.
2557. gbpat130.seq - Patent sequence entries, part 130.
2558. gbpat131.seq - Patent sequence entries, part 131.
2559. gbpat132.seq - Patent sequence entries, part 132.
2560. gbpat133.seq - Patent sequence entries, part 133.
2561. gbpat134.seq - Patent sequence entries, part 134.
2562. gbpat135.seq - Patent sequence entries, part 135.
2563. gbpat136.seq - Patent sequence entries, part 136.
2564. gbpat137.seq - Patent sequence entries, part 137.
2565. gbpat138.seq - Patent sequence entries, part 138.
2566. gbpat139.seq - Patent sequence entries, part 139.
2567. gbpat14.seq - Patent sequence entries, part 14.
2568. gbpat140.seq - Patent sequence entries, part 140.
2569. gbpat141.seq - Patent sequence entries, part 141.
2570. gbpat142.seq - Patent sequence entries, part 142.
2571. gbpat143.seq - Patent sequence entries, part 143.
2572. gbpat144.seq - Patent sequence entries, part 144.
2573. gbpat145.seq - Patent sequence entries, part 145.
2574. gbpat146.seq - Patent sequence entries, part 146.
2575. gbpat147.seq - Patent sequence entries, part 147.
2576. gbpat148.seq - Patent sequence entries, part 148.
2577. gbpat149.seq - Patent sequence entries, part 149.
2578. gbpat15.seq - Patent sequence entries, part 15.
2579. gbpat150.seq - Patent sequence entries, part 150.
2580. gbpat151.seq - Patent sequence entries, part 151.
2581. gbpat152.seq - Patent sequence entries, part 152.
2582. gbpat153.seq - Patent sequence entries, part 153.
2583. gbpat154.seq - Patent sequence entries, part 154.
2584. gbpat155.seq - Patent sequence entries, part 155.
2585. gbpat156.seq - Patent sequence entries, part 156.
2586. gbpat157.seq - Patent sequence entries, part 157.
2587. gbpat158.seq - Patent sequence entries, part 158.
2588. gbpat159.seq - Patent sequence entries, part 159.
2589. gbpat16.seq - Patent sequence entries, part 16.
2590. gbpat160.seq - Patent sequence entries, part 160.
2591. gbpat161.seq - Patent sequence entries, part 161.
2592. gbpat162.seq - Patent sequence entries, part 162.
2593. gbpat163.seq - Patent sequence entries, part 163.
2594. gbpat164.seq - Patent sequence entries, part 164.
2595. gbpat165.seq - Patent sequence entries, part 165.
2596. gbpat166.seq - Patent sequence entries, part 166.
2597. gbpat167.seq - Patent sequence entries, part 167.
2598. gbpat168.seq - Patent sequence entries, part 168.
2599. gbpat169.seq - Patent sequence entries, part 169.
2600. gbpat17.seq - Patent sequence entries, part 17.
2601. gbpat170.seq - Patent sequence entries, part 170.
2602. gbpat171.seq - Patent sequence entries, part 171.
2603. gbpat172.seq - Patent sequence entries, part 172.
2604. gbpat173.seq - Patent sequence entries, part 173.
2605. gbpat174.seq - Patent sequence entries, part 174.
2606. gbpat175.seq - Patent sequence entries, part 175.
2607. gbpat176.seq - Patent sequence entries, part 176.
2608. gbpat177.seq - Patent sequence entries, part 177.
2609. gbpat178.seq - Patent sequence entries, part 178.
2610. gbpat179.seq - Patent sequence entries, part 179.
2611. gbpat18.seq - Patent sequence entries, part 18.
2612. gbpat180.seq - Patent sequence entries, part 180.
2613. gbpat181.seq - Patent sequence entries, part 181.
2614. gbpat182.seq - Patent sequence entries, part 182.
2615. gbpat183.seq - Patent sequence entries, part 183.
2616. gbpat184.seq - Patent sequence entries, part 184.
2617. gbpat185.seq - Patent sequence entries, part 185.
2618. gbpat186.seq - Patent sequence entries, part 186.
2619. gbpat187.seq - Patent sequence entries, part 187.
2620. gbpat188.seq - Patent sequence entries, part 188.
2621. gbpat189.seq - Patent sequence entries, part 189.
2622. gbpat19.seq - Patent sequence entries, part 19.
2623. gbpat190.seq - Patent sequence entries, part 190.
2624. gbpat191.seq - Patent sequence entries, part 191.
2625. gbpat192.seq - Patent sequence entries, part 192.
2626. gbpat193.seq - Patent sequence entries, part 193.
2627. gbpat194.seq - Patent sequence entries, part 194.
2628. gbpat195.seq - Patent sequence entries, part 195.
2629. gbpat196.seq - Patent sequence entries, part 196.
2630. gbpat197.seq - Patent sequence entries, part 197.
2631. gbpat198.seq - Patent sequence entries, part 198.
2632. gbpat199.seq - Patent sequence entries, part 199.
2633. gbpat2.seq - Patent sequence entries, part 2.
2634. gbpat20.seq - Patent sequence entries, part 20.
2635. gbpat200.seq - Patent sequence entries, part 200.
2636. gbpat201.seq - Patent sequence entries, part 201.
2637. gbpat202.seq - Patent sequence entries, part 202.
2638. gbpat203.seq - Patent sequence entries, part 203.
2639. gbpat204.seq - Patent sequence entries, part 204.
2640. gbpat205.seq - Patent sequence entries, part 205.
2641. gbpat206.seq - Patent sequence entries, part 206.
2642. gbpat207.seq - Patent sequence entries, part 207.
2643. gbpat208.seq - Patent sequence entries, part 208.
2644. gbpat209.seq - Patent sequence entries, part 209.
2645. gbpat21.seq - Patent sequence entries, part 21.
2646. gbpat210.seq - Patent sequence entries, part 210.
2647. gbpat211.seq - Patent sequence entries, part 211.
2648. gbpat212.seq - Patent sequence entries, part 212.
2649. gbpat213.seq - Patent sequence entries, part 213.
2650. gbpat214.seq - Patent sequence entries, part 214.
2651. gbpat215.seq - Patent sequence entries, part 215.
2652. gbpat216.seq - Patent sequence entries, part 216.
2653. gbpat217.seq - Patent sequence entries, part 217.
2654. gbpat218.seq - Patent sequence entries, part 218.
2655. gbpat219.seq - Patent sequence entries, part 219.
2656. gbpat22.seq - Patent sequence entries, part 22.
2657. gbpat220.seq - Patent sequence entries, part 220.
2658. gbpat221.seq - Patent sequence entries, part 221.
2659. gbpat222.seq - Patent sequence entries, part 222.
2660. gbpat223.seq - Patent sequence entries, part 223.
2661. gbpat224.seq - Patent sequence entries, part 224.
2662. gbpat225.seq - Patent sequence entries, part 225.
2663. gbpat226.seq - Patent sequence entries, part 226.
2664. gbpat227.seq - Patent sequence entries, part 227.
2665. gbpat228.seq - Patent sequence entries, part 228.
2666. gbpat229.seq - Patent sequence entries, part 229.
2667. gbpat23.seq - Patent sequence entries, part 23.
2668. gbpat230.seq - Patent sequence entries, part 230.
2669. gbpat231.seq - Patent sequence entries, part 231.
2670. gbpat232.seq - Patent sequence entries, part 232.
2671. gbpat233.seq - Patent sequence entries, part 233.
2672. gbpat234.seq - Patent sequence entries, part 234.
2673. gbpat235.seq - Patent sequence entries, part 235.
2674. gbpat236.seq - Patent sequence entries, part 236.
2675. gbpat237.seq - Patent sequence entries, part 237.
2676. gbpat238.seq - Patent sequence entries, part 238.
2677. gbpat239.seq - Patent sequence entries, part 239.
2678. gbpat24.seq - Patent sequence entries, part 24.
2679. gbpat240.seq - Patent sequence entries, part 240.
2680. gbpat241.seq - Patent sequence entries, part 241.
2681. gbpat242.seq - Patent sequence entries, part 242.
2682. gbpat243.seq - Patent sequence entries, part 243.
2683. gbpat244.seq - Patent sequence entries, part 244.
2684. gbpat245.seq - Patent sequence entries, part 245.
2685. gbpat246.seq - Patent sequence entries, part 246.
2686. gbpat25.seq - Patent sequence entries, part 25.
2687. gbpat26.seq - Patent sequence entries, part 26.
2688. gbpat27.seq - Patent sequence entries, part 27.
2689. gbpat28.seq - Patent sequence entries, part 28.
2690. gbpat29.seq - Patent sequence entries, part 29.
2691. gbpat3.seq - Patent sequence entries, part 3.
2692. gbpat30.seq - Patent sequence entries, part 30.
2693. gbpat31.seq - Patent sequence entries, part 31.
2694. gbpat32.seq - Patent sequence entries, part 32.
2695. gbpat33.seq - Patent sequence entries, part 33.
2696. gbpat34.seq - Patent sequence entries, part 34.
2697. gbpat35.seq - Patent sequence entries, part 35.
2698. gbpat36.seq - Patent sequence entries, part 36.
2699. gbpat37.seq - Patent sequence entries, part 37.
2700. gbpat38.seq - Patent sequence entries, part 38.
2701. gbpat39.seq - Patent sequence entries, part 39.
2702. gbpat4.seq - Patent sequence entries, part 4.
2703. gbpat40.seq - Patent sequence entries, part 40.
2704. gbpat41.seq - Patent sequence entries, part 41.
2705. gbpat42.seq - Patent sequence entries, part 42.
2706. gbpat43.seq - Patent sequence entries, part 43.
2707. gbpat44.seq - Patent sequence entries, part 44.
2708. gbpat45.seq - Patent sequence entries, part 45.
2709. gbpat46.seq - Patent sequence entries, part 46.
2710. gbpat47.seq - Patent sequence entries, part 47.
2711. gbpat48.seq - Patent sequence entries, part 48.
2712. gbpat49.seq - Patent sequence entries, part 49.
2713. gbpat5.seq - Patent sequence entries, part 5.
2714. gbpat50.seq - Patent sequence entries, part 50.
2715. gbpat51.seq - Patent sequence entries, part 51.
2716. gbpat52.seq - Patent sequence entries, part 52.
2717. gbpat53.seq - Patent sequence entries, part 53.
2718. gbpat54.seq - Patent sequence entries, part 54.
2719. gbpat55.seq - Patent sequence entries, part 55.
2720. gbpat56.seq - Patent sequence entries, part 56.
2721. gbpat57.seq - Patent sequence entries, part 57.
2722. gbpat58.seq - Patent sequence entries, part 58.
2723. gbpat59.seq - Patent sequence entries, part 59.
2724. gbpat6.seq - Patent sequence entries, part 6.
2725. gbpat60.seq - Patent sequence entries, part 60.
2726. gbpat61.seq - Patent sequence entries, part 61.
2727. gbpat62.seq - Patent sequence entries, part 62.
2728. gbpat63.seq - Patent sequence entries, part 63.
2729. gbpat64.seq - Patent sequence entries, part 64.
2730. gbpat65.seq - Patent sequence entries, part 65.
2731. gbpat66.seq - Patent sequence entries, part 66.
2732. gbpat67.seq - Patent sequence entries, part 67.
2733. gbpat68.seq - Patent sequence entries, part 68.
2734. gbpat69.seq - Patent sequence entries, part 69.
2735. gbpat7.seq - Patent sequence entries, part 7.
2736. gbpat70.seq - Patent sequence entries, part 70.
2737. gbpat71.seq - Patent sequence entries, part 71.
2738. gbpat72.seq - Patent sequence entries, part 72.
2739. gbpat73.seq - Patent sequence entries, part 73.
2740. gbpat74.seq - Patent sequence entries, part 74.
2741. gbpat75.seq - Patent sequence entries, part 75.
2742. gbpat76.seq - Patent sequence entries, part 76.
2743. gbpat77.seq - Patent sequence entries, part 77.
2744. gbpat78.seq - Patent sequence entries, part 78.
2745. gbpat79.seq - Patent sequence entries, part 79.
2746. gbpat8.seq - Patent sequence entries, part 8.
2747. gbpat80.seq - Patent sequence entries, part 80.
2748. gbpat81.seq - Patent sequence entries, part 81.
2749. gbpat82.seq - Patent sequence entries, part 82.
2750. gbpat83.seq - Patent sequence entries, part 83.
2751. gbpat84.seq - Patent sequence entries, part 84.
2752. gbpat85.seq - Patent sequence entries, part 85.
2753. gbpat86.seq - Patent sequence entries, part 86.
2754. gbpat87.seq - Patent sequence entries, part 87.
2755. gbpat88.seq - Patent sequence entries, part 88.
2756. gbpat89.seq - Patent sequence entries, part 89.
2757. gbpat9.seq - Patent sequence entries, part 9.
2758. gbpat90.seq - Patent sequence entries, part 90.
2759. gbpat91.seq - Patent sequence entries, part 91.
2760. gbpat92.seq - Patent sequence entries, part 92.
2761. gbpat93.seq - Patent sequence entries, part 93.
2762. gbpat94.seq - Patent sequence entries, part 94.
2763. gbpat95.seq - Patent sequence entries, part 95.
2764. gbpat96.seq - Patent sequence entries, part 96.
2765. gbpat97.seq - Patent sequence entries, part 97.
2766. gbpat98.seq - Patent sequence entries, part 98.
2767. gbpat99.seq - Patent sequence entries, part 99.
2768. gbphg1.seq - Phage sequence entries, part 1.
2769. gbphg2.seq - Phage sequence entries, part 2.
2770. gbphg3.seq - Phage sequence entries, part 3.
2771. gbphg4.seq - Phage sequence entries, part 4.
2772. gbphg5.seq - Phage sequence entries, part 5.
2773. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2774. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2775. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2776. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2777. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2778. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2779. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2780. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2781. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2782. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2783. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2784. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2785. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2786. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2787. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2788. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2789. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2790. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2791. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2792. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2793. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2794. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2795. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2796. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2797. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2798. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2799. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2800. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2801. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2802. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2803. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2804. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2805. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2806. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2807. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2808. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2809. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2810. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2811. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2812. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2813. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2814. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2815. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2816. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2817. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2818. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2819. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2820. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2821. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2822. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2823. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2824. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2825. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
2826. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
2827. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
2828. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
2829. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2830. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
2831. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
2832. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
2833. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
2834. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
2835. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
2836. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
2837. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
2838. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
2839. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
2840. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2841. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
2842. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
2843. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
2844. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
2845. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
2846. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
2847. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
2848. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
2849. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
2850. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
2851. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2852. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
2853. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
2854. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
2855. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
2856. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
2857. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
2858. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
2859. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
2860. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
2861. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
2862. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2863. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
2864. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
2865. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
2866. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
2867. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
2868. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
2869. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
2870. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
2871. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
2872. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
2873. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2874. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
2875. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
2876. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
2877. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
2878. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
2879. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
2880. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
2881. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
2882. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
2883. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
2884. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2885. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2886. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
2887. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
2888. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
2889. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
2890. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
2891. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
2892. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
2893. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
2894. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
2895. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
2896. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
2897. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
2898. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
2899. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
2900. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
2901. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
2902. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
2903. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
2904. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
2905. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
2906. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
2907. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
2908. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
2909. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
2910. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
2911. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
2912. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
2913. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
2914. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
2915. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
2916. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
2917. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
2918. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
2919. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
2920. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
2921. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
2922. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
2923. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
2924. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
2925. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
2926. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
2927. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
2928. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
2929. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
2930. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
2931. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
2932. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
2933. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
2934. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
2935. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
2936. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
2937. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
2938. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
2939. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
2940. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
2941. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
2942. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
2943. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
2944. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
2945. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
2946. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
2947. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
2948. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
2949. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
2950. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
2951. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
2952. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
2953. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
2954. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
2955. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
2956. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
2957. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
2958. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
2959. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
2960. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
2961. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
2962. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
2963. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
2964. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
2965. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
2966. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
2967. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
2968. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
2969. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
2970. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
2971. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
2972. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
2973. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
2974. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
2975. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
2976. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
2977. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
2978. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
2979. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
2980. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
2981. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
2982. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
2983. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
2984. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
2985. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
2986. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
2987. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
2988. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
2989. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
2990. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
2991. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
2992. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
2993. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
2994. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
2995. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
2996. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
2997. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
2998. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
2999. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
3000. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
3001. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
3002. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
3003. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
3004. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
3005. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
3006. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
3007. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
3008. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
3009. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
3010. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
3011. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
3012. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
3013. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
3014. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
3015. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
3016. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
3017. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
3018. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
3019. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
3020. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
3021. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
3022. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
3023. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
3024. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
3025. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
3026. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
3027. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
3028. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
3029. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
3030. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
3031. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
3032. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
3033. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
3034. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
3035. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
3036. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
3037. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
3038. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
3039. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
3040. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
3041. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
3042. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
3043. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
3044. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
3045. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
3046. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
3047. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
3048. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
3049. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
3050. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
3051. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
3052. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
3053. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
3054. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
3055. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
3056. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
3057. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
3058. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
3059. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
3060. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
3061. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
3062. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
3063. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
3064. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
3065. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
3066. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
3067. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
3068. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
3069. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
3070. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
3071. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
3072. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
3073. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
3074. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
3075. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
3076. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
3077. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
3078. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
3079. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
3080. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
3081. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
3082. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
3083. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
3084. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
3085. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
3086. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
3087. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
3088. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
3089. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
3090. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
3091. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
3092. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
3093. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
3094. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
3095. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
3096. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
3097. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
3098. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
3099. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
3100. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
3101. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
3102. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
3103. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
3104. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
3105. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
3106. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
3107. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
3108. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
3109. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
3110. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
3111. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
3112. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
3113. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
3114. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
3115. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
3116. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
3117. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
3118. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
3119. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
3120. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
3121. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
3122. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
3123. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
3124. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
3125. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
3126. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
3127. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
3128. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
3129. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
3130. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
3131. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
3132. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
3133. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
3134. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
3135. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
3136. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
3137. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
3138. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
3139. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
3140. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
3141. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
3142. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
3143. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
3144. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
3145. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
3146. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
3147. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
3148. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
3149. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
3150. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
3151. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
3152. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
3153. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
3154. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
3155. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
3156. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
3157. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
3158. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
3159. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
3160. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
3161. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
3162. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
3163. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
3164. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
3165. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
3166. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
3167. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
3168. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
3169. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
3170. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
3171. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
3172. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
3173. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
3174. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
3175. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
3176. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
3177. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
3178. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
3179. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
3180. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
3181. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
3182. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
3183. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
3184. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
3185. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
3186. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
3187. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
3188. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
3189. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
3190. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
3191. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
3192. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
3193. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
3194. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
3195. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
3196. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
3197. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
3198. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
3199. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
3200. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
3201. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
3202. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
3203. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
3204. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
3205. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
3206. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
3207. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
3208. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
3209. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
3210. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
3211. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
3212. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
3213. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
3214. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
3215. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
3216. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
3217. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
3218. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
3219. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
3220. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
3221. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
3222. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
3223. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
3224. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
3225. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
3226. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
3227. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
3228. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
3229. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
3230. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
3231. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
3232. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
3233. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
3234. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
3235. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
3236. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
3237. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
3238. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
3239. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
3240. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
3241. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
3242. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
3243. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
3244. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
3245. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
3246. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
3247. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
3248. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
3249. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
3250. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
3251. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
3252. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
3253. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
3254. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
3255. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
3256. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
3257. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
3258. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
3259. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
3260. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
3261. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
3262. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
3263. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
3264. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
3265. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
3266. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
3267. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
3268. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
3269. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
3270. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
3271. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548.
3272. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549.
3273. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
3274. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550.
3275. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551.
3276. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552.
3277. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553.
3278. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554.
3279. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555.
3280. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556.
3281. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557.
3282. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558.
3283. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559.
3284. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
3285. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560.
3286. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561.
3287. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562.
3288. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563.
3289. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564.
3290. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565.
3291. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566.
3292. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567.
3293. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568.
3294. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569.
3295. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
3296. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570.
3297. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571.
3298. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572.
3299. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573.
3300. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574.
3301. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575.
3302. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576.
3303. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577.
3304. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578.
3305. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579.
3306. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
3307. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580.
3308. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581.
3309. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582.
3310. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583.
3311. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584.
3312. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585.
3313. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586.
3314. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587.
3315. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588.
3316. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589.
3317. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
3318. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590.
3319. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591.
3320. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592.
3321. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593.
3322. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594.
3323. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595.
3324. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596.
3325. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597.
3326. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598.
3327. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599.
3328. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
3329. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
3330. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600.
3331. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601.
3332. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602.
3333. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603.
3334. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604.
3335. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605.
3336. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606.
3337. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607.
3338. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608.
3339. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609.
3340. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
3341. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610.
3342. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611.
3343. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612.
3344. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613.
3345. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614.
3346. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615.
3347. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616.
3348. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617.
3349. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618.
3350. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619.
3351. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
3352. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620.
3353. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621.
3354. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622.
3355. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623.
3356. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624.
3357. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625.
3358. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626.
3359. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627.
3360. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628.
3361. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629.
3362. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
3363. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630.
3364. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631.
3365. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632.
3366. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633.
3367. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634.
3368. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635.
3369. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636.
3370. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637.
3371. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638.
3372. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639.
3373. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
3374. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640.
3375. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641.
3376. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642.
3377. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643.
3378. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644.
3379. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645.
3380. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646.
3381. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647.
3382. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648.
3383. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649.
3384. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
3385. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650.
3386. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651.
3387. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652.
3388. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653.
3389. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654.
3390. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655.
3391. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656.
3392. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657.
3393. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658.
3394. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659.
3395. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
3396. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660.
3397. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661.
3398. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662.
3399. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663.
3400. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664.
3401. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665.
3402. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666.
3403. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667.
3404. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668.
3405. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669.
3406. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
3407. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670.
3408. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671.
3409. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672.
3410. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673.
3411. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674.
3412. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675.
3413. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676.
3414. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677.
3415. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678.
3416. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679.
3417. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
3418. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680.
3419. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681.
3420. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682.
3421. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683.
3422. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684.
3423. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685.
3424. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686.
3425. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687.
3426. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688.
3427. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689.
3428. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
3429. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690.
3430. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691.
3431. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692.
3432. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693.
3433. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694.
3434. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695.
3435. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696.
3436. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697.
3437. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698.
3438. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699.
3439. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
3440. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
3441. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700.
3442. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701.
3443. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702.
3444. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703.
3445. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704.
3446. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705.
3447. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706.
3448. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707.
3449. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708.
3450. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709.
3451. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
3452. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710.
3453. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711.
3454. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712.
3455. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713.
3456. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714.
3457. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715.
3458. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716.
3459. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717.
3460. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718.
3461. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719.
3462. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
3463. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720.
3464. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721.
3465. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722.
3466. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723.
3467. gbpln724.seq - Plant sequence entries (including fungi and algae), part 724.
3468. gbpln725.seq - Plant sequence entries (including fungi and algae), part 725.
3469. gbpln726.seq - Plant sequence entries (including fungi and algae), part 726.
3470. gbpln727.seq - Plant sequence entries (including fungi and algae), part 727.
3471. gbpln728.seq - Plant sequence entries (including fungi and algae), part 728.
3472. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
3473. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
3474. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
3475. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
3476. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
3477. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
3478. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
3479. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
3480. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
3481. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
3482. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
3483. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
3484. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
3485. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
3486. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
3487. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
3488. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
3489. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
3490. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
3491. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
3492. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
3493. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
3494. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
3495. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
3496. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
3497. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
3498. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
3499. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
3500. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
3501. gbpri1.seq - Primate sequence entries, part 1.
3502. gbpri10.seq - Primate sequence entries, part 10.
3503. gbpri11.seq - Primate sequence entries, part 11.
3504. gbpri12.seq - Primate sequence entries, part 12.
3505. gbpri13.seq - Primate sequence entries, part 13.
3506. gbpri14.seq - Primate sequence entries, part 14.
3507. gbpri15.seq - Primate sequence entries, part 15.
3508. gbpri16.seq - Primate sequence entries, part 16.
3509. gbpri17.seq - Primate sequence entries, part 17.
3510. gbpri18.seq - Primate sequence entries, part 18.
3511. gbpri19.seq - Primate sequence entries, part 19.
3512. gbpri2.seq - Primate sequence entries, part 2.
3513. gbpri20.seq - Primate sequence entries, part 20.
3514. gbpri21.seq - Primate sequence entries, part 21.
3515. gbpri22.seq - Primate sequence entries, part 22.
3516. gbpri23.seq - Primate sequence entries, part 23.
3517. gbpri24.seq - Primate sequence entries, part 24.
3518. gbpri25.seq - Primate sequence entries, part 25.
3519. gbpri26.seq - Primate sequence entries, part 26.
3520. gbpri27.seq - Primate sequence entries, part 27.
3521. gbpri28.seq - Primate sequence entries, part 28.
3522. gbpri29.seq - Primate sequence entries, part 29.
3523. gbpri3.seq - Primate sequence entries, part 3.
3524. gbpri30.seq - Primate sequence entries, part 30.
3525. gbpri31.seq - Primate sequence entries, part 31.
3526. gbpri32.seq - Primate sequence entries, part 32.
3527. gbpri33.seq - Primate sequence entries, part 33.
3528. gbpri34.seq - Primate sequence entries, part 34.
3529. gbpri35.seq - Primate sequence entries, part 35.
3530. gbpri36.seq - Primate sequence entries, part 36.
3531. gbpri37.seq - Primate sequence entries, part 37.
3532. gbpri38.seq - Primate sequence entries, part 38.
3533. gbpri39.seq - Primate sequence entries, part 39.
3534. gbpri4.seq - Primate sequence entries, part 4.
3535. gbpri40.seq - Primate sequence entries, part 40.
3536. gbpri41.seq - Primate sequence entries, part 41.
3537. gbpri42.seq - Primate sequence entries, part 42.
3538. gbpri43.seq - Primate sequence entries, part 43.
3539. gbpri44.seq - Primate sequence entries, part 44.
3540. gbpri45.seq - Primate sequence entries, part 45.
3541. gbpri46.seq - Primate sequence entries, part 46.
3542. gbpri47.seq - Primate sequence entries, part 47.
3543. gbpri48.seq - Primate sequence entries, part 48.
3544. gbpri49.seq - Primate sequence entries, part 49.
3545. gbpri5.seq - Primate sequence entries, part 5.
3546. gbpri50.seq - Primate sequence entries, part 50.
3547. gbpri51.seq - Primate sequence entries, part 51.
3548. gbpri52.seq - Primate sequence entries, part 52.
3549. gbpri53.seq - Primate sequence entries, part 53.
3550. gbpri54.seq - Primate sequence entries, part 54.
3551. gbpri55.seq - Primate sequence entries, part 55.
3552. gbpri56.seq - Primate sequence entries, part 56.
3553. gbpri6.seq - Primate sequence entries, part 6.
3554. gbpri7.seq - Primate sequence entries, part 7.
3555. gbpri8.seq - Primate sequence entries, part 8.
3556. gbpri9.seq - Primate sequence entries, part 9.
3557. gbrel.txt - Release notes (this document).
3558. gbrod1.seq - Rodent sequence entries, part 1.
3559. gbrod10.seq - Rodent sequence entries, part 10.
3560. gbrod11.seq - Rodent sequence entries, part 11.
3561. gbrod12.seq - Rodent sequence entries, part 12.
3562. gbrod13.seq - Rodent sequence entries, part 13.
3563. gbrod14.seq - Rodent sequence entries, part 14.
3564. gbrod15.seq - Rodent sequence entries, part 15.
3565. gbrod16.seq - Rodent sequence entries, part 16.
3566. gbrod17.seq - Rodent sequence entries, part 17.
3567. gbrod18.seq - Rodent sequence entries, part 18.
3568. gbrod19.seq - Rodent sequence entries, part 19.
3569. gbrod2.seq - Rodent sequence entries, part 2.
3570. gbrod20.seq - Rodent sequence entries, part 20.
3571. gbrod21.seq - Rodent sequence entries, part 21.
3572. gbrod22.seq - Rodent sequence entries, part 22.
3573. gbrod23.seq - Rodent sequence entries, part 23.
3574. gbrod24.seq - Rodent sequence entries, part 24.
3575. gbrod25.seq - Rodent sequence entries, part 25.
3576. gbrod26.seq - Rodent sequence entries, part 26.
3577. gbrod27.seq - Rodent sequence entries, part 27.
3578. gbrod28.seq - Rodent sequence entries, part 28.
3579. gbrod29.seq - Rodent sequence entries, part 29.
3580. gbrod3.seq - Rodent sequence entries, part 3.
3581. gbrod30.seq - Rodent sequence entries, part 30.
3582. gbrod31.seq - Rodent sequence entries, part 31.
3583. gbrod32.seq - Rodent sequence entries, part 32.
3584. gbrod33.seq - Rodent sequence entries, part 33.
3585. gbrod34.seq - Rodent sequence entries, part 34.
3586. gbrod35.seq - Rodent sequence entries, part 35.
3587. gbrod36.seq - Rodent sequence entries, part 36.
3588. gbrod37.seq - Rodent sequence entries, part 37.
3589. gbrod38.seq - Rodent sequence entries, part 38.
3590. gbrod39.seq - Rodent sequence entries, part 39.
3591. gbrod4.seq - Rodent sequence entries, part 4.
3592. gbrod40.seq - Rodent sequence entries, part 40.
3593. gbrod41.seq - Rodent sequence entries, part 41.
3594. gbrod42.seq - Rodent sequence entries, part 42.
3595. gbrod43.seq - Rodent sequence entries, part 43.
3596. gbrod44.seq - Rodent sequence entries, part 44.
3597. gbrod45.seq - Rodent sequence entries, part 45.
3598. gbrod46.seq - Rodent sequence entries, part 46.
3599. gbrod47.seq - Rodent sequence entries, part 47.
3600. gbrod48.seq - Rodent sequence entries, part 48.
3601. gbrod49.seq - Rodent sequence entries, part 49.
3602. gbrod5.seq - Rodent sequence entries, part 5.
3603. gbrod50.seq - Rodent sequence entries, part 50.
3604. gbrod51.seq - Rodent sequence entries, part 51.
3605. gbrod52.seq - Rodent sequence entries, part 52.
3606. gbrod53.seq - Rodent sequence entries, part 53.
3607. gbrod54.seq - Rodent sequence entries, part 54.
3608. gbrod55.seq - Rodent sequence entries, part 55.
3609. gbrod56.seq - Rodent sequence entries, part 56.
3610. gbrod57.seq - Rodent sequence entries, part 57.
3611. gbrod58.seq - Rodent sequence entries, part 58.
3612. gbrod59.seq - Rodent sequence entries, part 59.
3613. gbrod6.seq - Rodent sequence entries, part 6.
3614. gbrod60.seq - Rodent sequence entries, part 60.
3615. gbrod61.seq - Rodent sequence entries, part 61.
3616. gbrod62.seq - Rodent sequence entries, part 62.
3617. gbrod63.seq - Rodent sequence entries, part 63.
3618. gbrod64.seq - Rodent sequence entries, part 64.
3619. gbrod65.seq - Rodent sequence entries, part 65.
3620. gbrod66.seq - Rodent sequence entries, part 66.
3621. gbrod67.seq - Rodent sequence entries, part 67.
3622. gbrod68.seq - Rodent sequence entries, part 68.
3623. gbrod69.seq - Rodent sequence entries, part 69.
3624. gbrod7.seq - Rodent sequence entries, part 7.
3625. gbrod70.seq - Rodent sequence entries, part 70.
3626. gbrod71.seq - Rodent sequence entries, part 71.
3627. gbrod72.seq - Rodent sequence entries, part 72.
3628. gbrod73.seq - Rodent sequence entries, part 73.
3629. gbrod74.seq - Rodent sequence entries, part 74.
3630. gbrod75.seq - Rodent sequence entries, part 75.
3631. gbrod76.seq - Rodent sequence entries, part 76.
3632. gbrod77.seq - Rodent sequence entries, part 77.
3633. gbrod8.seq - Rodent sequence entries, part 8.
3634. gbrod9.seq - Rodent sequence entries, part 9.
3635. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
3636. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
3637. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
3638. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
3639. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
3640. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
3641. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
3642. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
3643. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
3644. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
3645. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
3646. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
3647. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
3648. gbsyn11.seq - Synthetic and chimeric sequence entries, part 11.
3649. gbsyn12.seq - Synthetic and chimeric sequence entries, part 12.
3650. gbsyn13.seq - Synthetic and chimeric sequence entries, part 13.
3651. gbsyn14.seq - Synthetic and chimeric sequence entries, part 14.
3652. gbsyn15.seq - Synthetic and chimeric sequence entries, part 15.
3653. gbsyn16.seq - Synthetic and chimeric sequence entries, part 16.
3654. gbsyn17.seq - Synthetic and chimeric sequence entries, part 17.
3655. gbsyn18.seq - Synthetic and chimeric sequence entries, part 18.
3656. gbsyn19.seq - Synthetic and chimeric sequence entries, part 19.
3657. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
3658. gbsyn20.seq - Synthetic and chimeric sequence entries, part 20.
3659. gbsyn21.seq - Synthetic and chimeric sequence entries, part 21.
3660. gbsyn22.seq - Synthetic and chimeric sequence entries, part 22.
3661. gbsyn23.seq - Synthetic and chimeric sequence entries, part 23.
3662. gbsyn24.seq - Synthetic and chimeric sequence entries, part 24.
3663. gbsyn25.seq - Synthetic and chimeric sequence entries, part 25.
3664. gbsyn26.seq - Synthetic and chimeric sequence entries, part 26.
3665. gbsyn27.seq - Synthetic and chimeric sequence entries, part 27.
3666. gbsyn28.seq - Synthetic and chimeric sequence entries, part 28.
3667. gbsyn29.seq - Synthetic and chimeric sequence entries, part 29.
3668. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
3669. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
3670. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
3671. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
3672. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
3673. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
3674. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
3675. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
3676. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
3677. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
3678. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
3679. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
3680. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
3681. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
3682. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
3683. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
3684. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
3685. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
3686. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
3687. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
3688. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
3689. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
3690. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
3691. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
3692. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
3693. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
3694. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
3695. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
3696. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
3697. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
3698. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
3699. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
3700. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
3701. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
3702. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
3703. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
3704. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
3705. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
3706. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
3707. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
3708. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
3709. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
3710. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
3711. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
3712. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
3713. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
3714. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
3715. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
3716. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
3717. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
3718. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
3719. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
3720. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
3721. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
3722. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
3723. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
3724. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
3725. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
3726. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
3727. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
3728. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
3729. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
3730. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
3731. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
3732. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
3733. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
3734. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
3735. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
3736. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
3737. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
3738. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
3739. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
3740. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
3741. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
3742. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
3743. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
3744. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
3745. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
3746. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
3747. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
3748. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
3749. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
3750. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
3751. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
3752. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
3753. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
3754. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
3755. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
3756. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
3757. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
3758. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
3759. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
3760. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
3761. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
3762. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
3763. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
3764. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
3765. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
3766. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
3767. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
3768. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
3769. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
3770. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
3771. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
3772. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
3773. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
3774. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
3775. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
3776. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
3777. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
3778. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
3779. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
3780. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
3781. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
3782. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
3783. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
3784. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
3785. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
3786. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
3787. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
3788. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
3789. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
3790. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
3791. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
3792. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
3793. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
3794. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
3795. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
3796. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
3797. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
3798. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
3799. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
3800. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
3801. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
3802. gbuna1.seq - Unannotated sequence entries, part 1.
3803. gbvrl1.seq - Viral sequence entries, part 1.
3804. gbvrl10.seq - Viral sequence entries, part 10.
3805. gbvrl100.seq - Viral sequence entries, part 100.
3806. gbvrl101.seq - Viral sequence entries, part 101.
3807. gbvrl102.seq - Viral sequence entries, part 102.
3808. gbvrl103.seq - Viral sequence entries, part 103.
3809. gbvrl104.seq - Viral sequence entries, part 104.
3810. gbvrl105.seq - Viral sequence entries, part 105.
3811. gbvrl106.seq - Viral sequence entries, part 106.
3812. gbvrl107.seq - Viral sequence entries, part 107.
3813. gbvrl108.seq - Viral sequence entries, part 108.
3814. gbvrl109.seq - Viral sequence entries, part 109.
3815. gbvrl11.seq - Viral sequence entries, part 11.
3816. gbvrl110.seq - Viral sequence entries, part 110.
3817. gbvrl111.seq - Viral sequence entries, part 111.
3818. gbvrl112.seq - Viral sequence entries, part 112.
3819. gbvrl113.seq - Viral sequence entries, part 113.
3820. gbvrl114.seq - Viral sequence entries, part 114.
3821. gbvrl115.seq - Viral sequence entries, part 115.
3822. gbvrl116.seq - Viral sequence entries, part 116.
3823. gbvrl117.seq - Viral sequence entries, part 117.
3824. gbvrl118.seq - Viral sequence entries, part 118.
3825. gbvrl119.seq - Viral sequence entries, part 119.
3826. gbvrl12.seq - Viral sequence entries, part 12.
3827. gbvrl120.seq - Viral sequence entries, part 120.
3828. gbvrl121.seq - Viral sequence entries, part 121.
3829. gbvrl122.seq - Viral sequence entries, part 122.
3830. gbvrl123.seq - Viral sequence entries, part 123.
3831. gbvrl124.seq - Viral sequence entries, part 124.
3832. gbvrl125.seq - Viral sequence entries, part 125.
3833. gbvrl126.seq - Viral sequence entries, part 126.
3834. gbvrl127.seq - Viral sequence entries, part 127.
3835. gbvrl128.seq - Viral sequence entries, part 128.
3836. gbvrl129.seq - Viral sequence entries, part 129.
3837. gbvrl13.seq - Viral sequence entries, part 13.
3838. gbvrl130.seq - Viral sequence entries, part 130.
3839. gbvrl131.seq - Viral sequence entries, part 131.
3840. gbvrl132.seq - Viral sequence entries, part 132.
3841. gbvrl133.seq - Viral sequence entries, part 133.
3842. gbvrl134.seq - Viral sequence entries, part 134.
3843. gbvrl135.seq - Viral sequence entries, part 135.
3844. gbvrl136.seq - Viral sequence entries, part 136.
3845. gbvrl137.seq - Viral sequence entries, part 137.
3846. gbvrl138.seq - Viral sequence entries, part 138.
3847. gbvrl139.seq - Viral sequence entries, part 139.
3848. gbvrl14.seq - Viral sequence entries, part 14.
3849. gbvrl140.seq - Viral sequence entries, part 140.
3850. gbvrl141.seq - Viral sequence entries, part 141.
3851. gbvrl142.seq - Viral sequence entries, part 142.
3852. gbvrl143.seq - Viral sequence entries, part 143.
3853. gbvrl144.seq - Viral sequence entries, part 144.
3854. gbvrl145.seq - Viral sequence entries, part 145.
3855. gbvrl146.seq - Viral sequence entries, part 146.
3856. gbvrl147.seq - Viral sequence entries, part 147.
3857. gbvrl148.seq - Viral sequence entries, part 148.
3858. gbvrl149.seq - Viral sequence entries, part 149.
3859. gbvrl15.seq - Viral sequence entries, part 15.
3860. gbvrl150.seq - Viral sequence entries, part 150.
3861. gbvrl151.seq - Viral sequence entries, part 151.
3862. gbvrl152.seq - Viral sequence entries, part 152.
3863. gbvrl153.seq - Viral sequence entries, part 153.
3864. gbvrl154.seq - Viral sequence entries, part 154.
3865. gbvrl155.seq - Viral sequence entries, part 155.
3866. gbvrl156.seq - Viral sequence entries, part 156.
3867. gbvrl157.seq - Viral sequence entries, part 157.
3868. gbvrl158.seq - Viral sequence entries, part 158.
3869. gbvrl159.seq - Viral sequence entries, part 159.
3870. gbvrl16.seq - Viral sequence entries, part 16.
3871. gbvrl160.seq - Viral sequence entries, part 160.
3872. gbvrl161.seq - Viral sequence entries, part 161.
3873. gbvrl162.seq - Viral sequence entries, part 162.
3874. gbvrl163.seq - Viral sequence entries, part 163.
3875. gbvrl164.seq - Viral sequence entries, part 164.
3876. gbvrl165.seq - Viral sequence entries, part 165.
3877. gbvrl166.seq - Viral sequence entries, part 166.
3878. gbvrl167.seq - Viral sequence entries, part 167.
3879. gbvrl168.seq - Viral sequence entries, part 168.
3880. gbvrl169.seq - Viral sequence entries, part 169.
3881. gbvrl17.seq - Viral sequence entries, part 17.
3882. gbvrl170.seq - Viral sequence entries, part 170.
3883. gbvrl171.seq - Viral sequence entries, part 171.
3884. gbvrl172.seq - Viral sequence entries, part 172.
3885. gbvrl173.seq - Viral sequence entries, part 173.
3886. gbvrl174.seq - Viral sequence entries, part 174.
3887. gbvrl175.seq - Viral sequence entries, part 175.
3888. gbvrl176.seq - Viral sequence entries, part 176.
3889. gbvrl177.seq - Viral sequence entries, part 177.
3890. gbvrl178.seq - Viral sequence entries, part 178.
3891. gbvrl179.seq - Viral sequence entries, part 179.
3892. gbvrl18.seq - Viral sequence entries, part 18.
3893. gbvrl180.seq - Viral sequence entries, part 180.
3894. gbvrl181.seq - Viral sequence entries, part 181.
3895. gbvrl182.seq - Viral sequence entries, part 182.
3896. gbvrl183.seq - Viral sequence entries, part 183.
3897. gbvrl184.seq - Viral sequence entries, part 184.
3898. gbvrl185.seq - Viral sequence entries, part 185.
3899. gbvrl186.seq - Viral sequence entries, part 186.
3900. gbvrl187.seq - Viral sequence entries, part 187.
3901. gbvrl188.seq - Viral sequence entries, part 188.
3902. gbvrl189.seq - Viral sequence entries, part 189.
3903. gbvrl19.seq - Viral sequence entries, part 19.
3904. gbvrl190.seq - Viral sequence entries, part 190.
3905. gbvrl191.seq - Viral sequence entries, part 191.
3906. gbvrl192.seq - Viral sequence entries, part 192.
3907. gbvrl193.seq - Viral sequence entries, part 193.
3908. gbvrl194.seq - Viral sequence entries, part 194.
3909. gbvrl195.seq - Viral sequence entries, part 195.
3910. gbvrl196.seq - Viral sequence entries, part 196.
3911. gbvrl197.seq - Viral sequence entries, part 197.
3912. gbvrl198.seq - Viral sequence entries, part 198.
3913. gbvrl199.seq - Viral sequence entries, part 199.
3914. gbvrl2.seq - Viral sequence entries, part 2.
3915. gbvrl20.seq - Viral sequence entries, part 20.
3916. gbvrl200.seq - Viral sequence entries, part 200.
3917. gbvrl201.seq - Viral sequence entries, part 201.
3918. gbvrl202.seq - Viral sequence entries, part 202.
3919. gbvrl203.seq - Viral sequence entries, part 203.
3920. gbvrl204.seq - Viral sequence entries, part 204.
3921. gbvrl205.seq - Viral sequence entries, part 205.
3922. gbvrl206.seq - Viral sequence entries, part 206.
3923. gbvrl207.seq - Viral sequence entries, part 207.
3924. gbvrl208.seq - Viral sequence entries, part 208.
3925. gbvrl209.seq - Viral sequence entries, part 209.
3926. gbvrl21.seq - Viral sequence entries, part 21.
3927. gbvrl210.seq - Viral sequence entries, part 210.
3928. gbvrl211.seq - Viral sequence entries, part 211.
3929. gbvrl212.seq - Viral sequence entries, part 212.
3930. gbvrl213.seq - Viral sequence entries, part 213.
3931. gbvrl214.seq - Viral sequence entries, part 214.
3932. gbvrl215.seq - Viral sequence entries, part 215.
3933. gbvrl216.seq - Viral sequence entries, part 216.
3934. gbvrl217.seq - Viral sequence entries, part 217.
3935. gbvrl218.seq - Viral sequence entries, part 218.
3936. gbvrl219.seq - Viral sequence entries, part 219.
3937. gbvrl22.seq - Viral sequence entries, part 22.
3938. gbvrl220.seq - Viral sequence entries, part 220.
3939. gbvrl221.seq - Viral sequence entries, part 221.
3940. gbvrl222.seq - Viral sequence entries, part 222.
3941. gbvrl223.seq - Viral sequence entries, part 223.
3942. gbvrl224.seq - Viral sequence entries, part 224.
3943. gbvrl225.seq - Viral sequence entries, part 225.
3944. gbvrl226.seq - Viral sequence entries, part 226.
3945. gbvrl227.seq - Viral sequence entries, part 227.
3946. gbvrl228.seq - Viral sequence entries, part 228.
3947. gbvrl229.seq - Viral sequence entries, part 229.
3948. gbvrl23.seq - Viral sequence entries, part 23.
3949. gbvrl230.seq - Viral sequence entries, part 230.
3950. gbvrl231.seq - Viral sequence entries, part 231.
3951. gbvrl232.seq - Viral sequence entries, part 232.
3952. gbvrl233.seq - Viral sequence entries, part 233.
3953. gbvrl234.seq - Viral sequence entries, part 234.
3954. gbvrl235.seq - Viral sequence entries, part 235.
3955. gbvrl236.seq - Viral sequence entries, part 236.
3956. gbvrl237.seq - Viral sequence entries, part 237.
3957. gbvrl238.seq - Viral sequence entries, part 238.
3958. gbvrl239.seq - Viral sequence entries, part 239.
3959. gbvrl24.seq - Viral sequence entries, part 24.
3960. gbvrl240.seq - Viral sequence entries, part 240.
3961. gbvrl241.seq - Viral sequence entries, part 241.
3962. gbvrl242.seq - Viral sequence entries, part 242.
3963. gbvrl243.seq - Viral sequence entries, part 243.
3964. gbvrl244.seq - Viral sequence entries, part 244.
3965. gbvrl245.seq - Viral sequence entries, part 245.
3966. gbvrl246.seq - Viral sequence entries, part 246.
3967. gbvrl247.seq - Viral sequence entries, part 247.
3968. gbvrl248.seq - Viral sequence entries, part 248.
3969. gbvrl249.seq - Viral sequence entries, part 249.
3970. gbvrl25.seq - Viral sequence entries, part 25.
3971. gbvrl250.seq - Viral sequence entries, part 250.
3972. gbvrl251.seq - Viral sequence entries, part 251.
3973. gbvrl252.seq - Viral sequence entries, part 252.
3974. gbvrl253.seq - Viral sequence entries, part 253.
3975. gbvrl254.seq - Viral sequence entries, part 254.
3976. gbvrl255.seq - Viral sequence entries, part 255.
3977. gbvrl256.seq - Viral sequence entries, part 256.
3978. gbvrl257.seq - Viral sequence entries, part 257.
3979. gbvrl258.seq - Viral sequence entries, part 258.
3980. gbvrl259.seq - Viral sequence entries, part 259.
3981. gbvrl26.seq - Viral sequence entries, part 26.
3982. gbvrl260.seq - Viral sequence entries, part 260.
3983. gbvrl261.seq - Viral sequence entries, part 261.
3984. gbvrl262.seq - Viral sequence entries, part 262.
3985. gbvrl263.seq - Viral sequence entries, part 263.
3986. gbvrl264.seq - Viral sequence entries, part 264.
3987. gbvrl265.seq - Viral sequence entries, part 265.
3988. gbvrl266.seq - Viral sequence entries, part 266.
3989. gbvrl267.seq - Viral sequence entries, part 267.
3990. gbvrl268.seq - Viral sequence entries, part 268.
3991. gbvrl269.seq - Viral sequence entries, part 269.
3992. gbvrl27.seq - Viral sequence entries, part 27.
3993. gbvrl270.seq - Viral sequence entries, part 270.
3994. gbvrl271.seq - Viral sequence entries, part 271.
3995. gbvrl272.seq - Viral sequence entries, part 272.
3996. gbvrl273.seq - Viral sequence entries, part 273.
3997. gbvrl274.seq - Viral sequence entries, part 274.
3998. gbvrl275.seq - Viral sequence entries, part 275.
3999. gbvrl276.seq - Viral sequence entries, part 276.
4000. gbvrl277.seq - Viral sequence entries, part 277.
4001. gbvrl278.seq - Viral sequence entries, part 278.
4002. gbvrl279.seq - Viral sequence entries, part 279.
4003. gbvrl28.seq - Viral sequence entries, part 28.
4004. gbvrl280.seq - Viral sequence entries, part 280.
4005. gbvrl281.seq - Viral sequence entries, part 281.
4006. gbvrl282.seq - Viral sequence entries, part 282.
4007. gbvrl283.seq - Viral sequence entries, part 283.
4008. gbvrl284.seq - Viral sequence entries, part 284.
4009. gbvrl285.seq - Viral sequence entries, part 285.
4010. gbvrl286.seq - Viral sequence entries, part 286.
4011. gbvrl287.seq - Viral sequence entries, part 287.
4012. gbvrl288.seq - Viral sequence entries, part 288.
4013. gbvrl289.seq - Viral sequence entries, part 289.
4014. gbvrl29.seq - Viral sequence entries, part 29.
4015. gbvrl290.seq - Viral sequence entries, part 290.
4016. gbvrl291.seq - Viral sequence entries, part 291.
4017. gbvrl292.seq - Viral sequence entries, part 292.
4018. gbvrl293.seq - Viral sequence entries, part 293.
4019. gbvrl294.seq - Viral sequence entries, part 294.
4020. gbvrl295.seq - Viral sequence entries, part 295.
4021. gbvrl296.seq - Viral sequence entries, part 296.
4022. gbvrl297.seq - Viral sequence entries, part 297.
4023. gbvrl298.seq - Viral sequence entries, part 298.
4024. gbvrl299.seq - Viral sequence entries, part 299.
4025. gbvrl3.seq - Viral sequence entries, part 3.
4026. gbvrl30.seq - Viral sequence entries, part 30.
4027. gbvrl300.seq - Viral sequence entries, part 300.
4028. gbvrl301.seq - Viral sequence entries, part 301.
4029. gbvrl302.seq - Viral sequence entries, part 302.
4030. gbvrl303.seq - Viral sequence entries, part 303.
4031. gbvrl304.seq - Viral sequence entries, part 304.
4032. gbvrl305.seq - Viral sequence entries, part 305.
4033. gbvrl306.seq - Viral sequence entries, part 306.
4034. gbvrl307.seq - Viral sequence entries, part 307.
4035. gbvrl308.seq - Viral sequence entries, part 308.
4036. gbvrl309.seq - Viral sequence entries, part 309.
4037. gbvrl31.seq - Viral sequence entries, part 31.
4038. gbvrl310.seq - Viral sequence entries, part 310.
4039. gbvrl311.seq - Viral sequence entries, part 311.
4040. gbvrl312.seq - Viral sequence entries, part 312.
4041. gbvrl313.seq - Viral sequence entries, part 313.
4042. gbvrl314.seq - Viral sequence entries, part 314.
4043. gbvrl315.seq - Viral sequence entries, part 315.
4044. gbvrl316.seq - Viral sequence entries, part 316.
4045. gbvrl317.seq - Viral sequence entries, part 317.
4046. gbvrl318.seq - Viral sequence entries, part 318.
4047. gbvrl319.seq - Viral sequence entries, part 319.
4048. gbvrl32.seq - Viral sequence entries, part 32.
4049. gbvrl320.seq - Viral sequence entries, part 320.
4050. gbvrl321.seq - Viral sequence entries, part 321.
4051. gbvrl322.seq - Viral sequence entries, part 322.
4052. gbvrl323.seq - Viral sequence entries, part 323.
4053. gbvrl324.seq - Viral sequence entries, part 324.
4054. gbvrl325.seq - Viral sequence entries, part 325.
4055. gbvrl326.seq - Viral sequence entries, part 326.
4056. gbvrl327.seq - Viral sequence entries, part 327.
4057. gbvrl328.seq - Viral sequence entries, part 328.
4058. gbvrl329.seq - Viral sequence entries, part 329.
4059. gbvrl33.seq - Viral sequence entries, part 33.
4060. gbvrl330.seq - Viral sequence entries, part 330.
4061. gbvrl331.seq - Viral sequence entries, part 331.
4062. gbvrl332.seq - Viral sequence entries, part 332.
4063. gbvrl333.seq - Viral sequence entries, part 333.
4064. gbvrl334.seq - Viral sequence entries, part 334.
4065. gbvrl335.seq - Viral sequence entries, part 335.
4066. gbvrl336.seq - Viral sequence entries, part 336.
4067. gbvrl337.seq - Viral sequence entries, part 337.
4068. gbvrl338.seq - Viral sequence entries, part 338.
4069. gbvrl339.seq - Viral sequence entries, part 339.
4070. gbvrl34.seq - Viral sequence entries, part 34.
4071. gbvrl340.seq - Viral sequence entries, part 340.
4072. gbvrl341.seq - Viral sequence entries, part 341.
4073. gbvrl342.seq - Viral sequence entries, part 342.
4074. gbvrl343.seq - Viral sequence entries, part 343.
4075. gbvrl344.seq - Viral sequence entries, part 344.
4076. gbvrl345.seq - Viral sequence entries, part 345.
4077. gbvrl346.seq - Viral sequence entries, part 346.
4078. gbvrl347.seq - Viral sequence entries, part 347.
4079. gbvrl348.seq - Viral sequence entries, part 348.
4080. gbvrl349.seq - Viral sequence entries, part 349.
4081. gbvrl35.seq - Viral sequence entries, part 35.
4082. gbvrl350.seq - Viral sequence entries, part 350.
4083. gbvrl351.seq - Viral sequence entries, part 351.
4084. gbvrl352.seq - Viral sequence entries, part 352.
4085. gbvrl353.seq - Viral sequence entries, part 353.
4086. gbvrl354.seq - Viral sequence entries, part 354.
4087. gbvrl355.seq - Viral sequence entries, part 355.
4088. gbvrl356.seq - Viral sequence entries, part 356.
4089. gbvrl357.seq - Viral sequence entries, part 357.
4090. gbvrl358.seq - Viral sequence entries, part 358.
4091. gbvrl359.seq - Viral sequence entries, part 359.
4092. gbvrl36.seq - Viral sequence entries, part 36.
4093. gbvrl360.seq - Viral sequence entries, part 360.
4094. gbvrl361.seq - Viral sequence entries, part 361.
4095. gbvrl362.seq - Viral sequence entries, part 362.
4096. gbvrl363.seq - Viral sequence entries, part 363.
4097. gbvrl364.seq - Viral sequence entries, part 364.
4098. gbvrl365.seq - Viral sequence entries, part 365.
4099. gbvrl366.seq - Viral sequence entries, part 366.
4100. gbvrl367.seq - Viral sequence entries, part 367.
4101. gbvrl368.seq - Viral sequence entries, part 368.
4102. gbvrl369.seq - Viral sequence entries, part 369.
4103. gbvrl37.seq - Viral sequence entries, part 37.
4104. gbvrl370.seq - Viral sequence entries, part 370.
4105. gbvrl371.seq - Viral sequence entries, part 371.
4106. gbvrl372.seq - Viral sequence entries, part 372.
4107. gbvrl373.seq - Viral sequence entries, part 373.
4108. gbvrl374.seq - Viral sequence entries, part 374.
4109. gbvrl375.seq - Viral sequence entries, part 375.
4110. gbvrl38.seq - Viral sequence entries, part 38.
4111. gbvrl39.seq - Viral sequence entries, part 39.
4112. gbvrl4.seq - Viral sequence entries, part 4.
4113. gbvrl40.seq - Viral sequence entries, part 40.
4114. gbvrl41.seq - Viral sequence entries, part 41.
4115. gbvrl42.seq - Viral sequence entries, part 42.
4116. gbvrl43.seq - Viral sequence entries, part 43.
4117. gbvrl44.seq - Viral sequence entries, part 44.
4118. gbvrl45.seq - Viral sequence entries, part 45.
4119. gbvrl46.seq - Viral sequence entries, part 46.
4120. gbvrl47.seq - Viral sequence entries, part 47.
4121. gbvrl48.seq - Viral sequence entries, part 48.
4122. gbvrl49.seq - Viral sequence entries, part 49.
4123. gbvrl5.seq - Viral sequence entries, part 5.
4124. gbvrl50.seq - Viral sequence entries, part 50.
4125. gbvrl51.seq - Viral sequence entries, part 51.
4126. gbvrl52.seq - Viral sequence entries, part 52.
4127. gbvrl53.seq - Viral sequence entries, part 53.
4128. gbvrl54.seq - Viral sequence entries, part 54.
4129. gbvrl55.seq - Viral sequence entries, part 55.
4130. gbvrl56.seq - Viral sequence entries, part 56.
4131. gbvrl57.seq - Viral sequence entries, part 57.
4132. gbvrl58.seq - Viral sequence entries, part 58.
4133. gbvrl59.seq - Viral sequence entries, part 59.
4134. gbvrl6.seq - Viral sequence entries, part 6.
4135. gbvrl60.seq - Viral sequence entries, part 60.
4136. gbvrl61.seq - Viral sequence entries, part 61.
4137. gbvrl62.seq - Viral sequence entries, part 62.
4138. gbvrl63.seq - Viral sequence entries, part 63.
4139. gbvrl64.seq - Viral sequence entries, part 64.
4140. gbvrl65.seq - Viral sequence entries, part 65.
4141. gbvrl66.seq - Viral sequence entries, part 66.
4142. gbvrl67.seq - Viral sequence entries, part 67.
4143. gbvrl68.seq - Viral sequence entries, part 68.
4144. gbvrl69.seq - Viral sequence entries, part 69.
4145. gbvrl7.seq - Viral sequence entries, part 7.
4146. gbvrl70.seq - Viral sequence entries, part 70.
4147. gbvrl71.seq - Viral sequence entries, part 71.
4148. gbvrl72.seq - Viral sequence entries, part 72.
4149. gbvrl73.seq - Viral sequence entries, part 73.
4150. gbvrl74.seq - Viral sequence entries, part 74.
4151. gbvrl75.seq - Viral sequence entries, part 75.
4152. gbvrl76.seq - Viral sequence entries, part 76.
4153. gbvrl77.seq - Viral sequence entries, part 77.
4154. gbvrl78.seq - Viral sequence entries, part 78.
4155. gbvrl79.seq - Viral sequence entries, part 79.
4156. gbvrl8.seq - Viral sequence entries, part 8.
4157. gbvrl80.seq - Viral sequence entries, part 80.
4158. gbvrl81.seq - Viral sequence entries, part 81.
4159. gbvrl82.seq - Viral sequence entries, part 82.
4160. gbvrl83.seq - Viral sequence entries, part 83.
4161. gbvrl84.seq - Viral sequence entries, part 84.
4162. gbvrl85.seq - Viral sequence entries, part 85.
4163. gbvrl86.seq - Viral sequence entries, part 86.
4164. gbvrl87.seq - Viral sequence entries, part 87.
4165. gbvrl88.seq - Viral sequence entries, part 88.
4166. gbvrl89.seq - Viral sequence entries, part 89.
4167. gbvrl9.seq - Viral sequence entries, part 9.
4168. gbvrl90.seq - Viral sequence entries, part 90.
4169. gbvrl91.seq - Viral sequence entries, part 91.
4170. gbvrl92.seq - Viral sequence entries, part 92.
4171. gbvrl93.seq - Viral sequence entries, part 93.
4172. gbvrl94.seq - Viral sequence entries, part 94.
4173. gbvrl95.seq - Viral sequence entries, part 95.
4174. gbvrl96.seq - Viral sequence entries, part 96.
4175. gbvrl97.seq - Viral sequence entries, part 97.
4176. gbvrl98.seq - Viral sequence entries, part 98.
4177. gbvrl99.seq - Viral sequence entries, part 99.
4178. gbvrt1.seq - Other vertebrate sequence entries, part 1.
4179. gbvrt10.seq - Other vertebrate sequence entries, part 10.
4180. gbvrt100.seq - Other vertebrate sequence entries, part 100.
4181. gbvrt101.seq - Other vertebrate sequence entries, part 101.
4182. gbvrt102.seq - Other vertebrate sequence entries, part 102.
4183. gbvrt103.seq - Other vertebrate sequence entries, part 103.
4184. gbvrt104.seq - Other vertebrate sequence entries, part 104.
4185. gbvrt105.seq - Other vertebrate sequence entries, part 105.
4186. gbvrt106.seq - Other vertebrate sequence entries, part 106.
4187. gbvrt107.seq - Other vertebrate sequence entries, part 107.
4188. gbvrt108.seq - Other vertebrate sequence entries, part 108.
4189. gbvrt109.seq - Other vertebrate sequence entries, part 109.
4190. gbvrt11.seq - Other vertebrate sequence entries, part 11.
4191. gbvrt110.seq - Other vertebrate sequence entries, part 110.
4192. gbvrt111.seq - Other vertebrate sequence entries, part 111.
4193. gbvrt112.seq - Other vertebrate sequence entries, part 112.
4194. gbvrt113.seq - Other vertebrate sequence entries, part 113.
4195. gbvrt114.seq - Other vertebrate sequence entries, part 114.
4196. gbvrt115.seq - Other vertebrate sequence entries, part 115.
4197. gbvrt116.seq - Other vertebrate sequence entries, part 116.
4198. gbvrt117.seq - Other vertebrate sequence entries, part 117.
4199. gbvrt118.seq - Other vertebrate sequence entries, part 118.
4200. gbvrt119.seq - Other vertebrate sequence entries, part 119.
4201. gbvrt12.seq - Other vertebrate sequence entries, part 12.
4202. gbvrt120.seq - Other vertebrate sequence entries, part 120.
4203. gbvrt121.seq - Other vertebrate sequence entries, part 121.
4204. gbvrt122.seq - Other vertebrate sequence entries, part 122.
4205. gbvrt123.seq - Other vertebrate sequence entries, part 123.
4206. gbvrt124.seq - Other vertebrate sequence entries, part 124.
4207. gbvrt125.seq - Other vertebrate sequence entries, part 125.
4208. gbvrt126.seq - Other vertebrate sequence entries, part 126.
4209. gbvrt127.seq - Other vertebrate sequence entries, part 127.
4210. gbvrt128.seq - Other vertebrate sequence entries, part 128.
4211. gbvrt129.seq - Other vertebrate sequence entries, part 129.
4212. gbvrt13.seq - Other vertebrate sequence entries, part 13.
4213. gbvrt130.seq - Other vertebrate sequence entries, part 130.
4214. gbvrt131.seq - Other vertebrate sequence entries, part 131.
4215. gbvrt132.seq - Other vertebrate sequence entries, part 132.
4216. gbvrt133.seq - Other vertebrate sequence entries, part 133.
4217. gbvrt134.seq - Other vertebrate sequence entries, part 134.
4218. gbvrt135.seq - Other vertebrate sequence entries, part 135.
4219. gbvrt136.seq - Other vertebrate sequence entries, part 136.
4220. gbvrt137.seq - Other vertebrate sequence entries, part 137.
4221. gbvrt138.seq - Other vertebrate sequence entries, part 138.
4222. gbvrt139.seq - Other vertebrate sequence entries, part 139.
4223. gbvrt14.seq - Other vertebrate sequence entries, part 14.
4224. gbvrt140.seq - Other vertebrate sequence entries, part 140.
4225. gbvrt141.seq - Other vertebrate sequence entries, part 141.
4226. gbvrt142.seq - Other vertebrate sequence entries, part 142.
4227. gbvrt143.seq - Other vertebrate sequence entries, part 143.
4228. gbvrt144.seq - Other vertebrate sequence entries, part 144.
4229. gbvrt145.seq - Other vertebrate sequence entries, part 145.
4230. gbvrt146.seq - Other vertebrate sequence entries, part 146.
4231. gbvrt147.seq - Other vertebrate sequence entries, part 147.
4232. gbvrt148.seq - Other vertebrate sequence entries, part 148.
4233. gbvrt149.seq - Other vertebrate sequence entries, part 149.
4234. gbvrt15.seq - Other vertebrate sequence entries, part 15.
4235. gbvrt150.seq - Other vertebrate sequence entries, part 150.
4236. gbvrt151.seq - Other vertebrate sequence entries, part 151.
4237. gbvrt152.seq - Other vertebrate sequence entries, part 152.
4238. gbvrt153.seq - Other vertebrate sequence entries, part 153.
4239. gbvrt154.seq - Other vertebrate sequence entries, part 154.
4240. gbvrt155.seq - Other vertebrate sequence entries, part 155.
4241. gbvrt156.seq - Other vertebrate sequence entries, part 156.
4242. gbvrt157.seq - Other vertebrate sequence entries, part 157.
4243. gbvrt158.seq - Other vertebrate sequence entries, part 158.
4244. gbvrt159.seq - Other vertebrate sequence entries, part 159.
4245. gbvrt16.seq - Other vertebrate sequence entries, part 16.
4246. gbvrt160.seq - Other vertebrate sequence entries, part 160.
4247. gbvrt161.seq - Other vertebrate sequence entries, part 161.
4248. gbvrt162.seq - Other vertebrate sequence entries, part 162.
4249. gbvrt163.seq - Other vertebrate sequence entries, part 163.
4250. gbvrt164.seq - Other vertebrate sequence entries, part 164.
4251. gbvrt165.seq - Other vertebrate sequence entries, part 165.
4252. gbvrt166.seq - Other vertebrate sequence entries, part 166.
4253. gbvrt167.seq - Other vertebrate sequence entries, part 167.
4254. gbvrt168.seq - Other vertebrate sequence entries, part 168.
4255. gbvrt169.seq - Other vertebrate sequence entries, part 169.
4256. gbvrt17.seq - Other vertebrate sequence entries, part 17.
4257. gbvrt170.seq - Other vertebrate sequence entries, part 170.
4258. gbvrt171.seq - Other vertebrate sequence entries, part 171.
4259. gbvrt172.seq - Other vertebrate sequence entries, part 172.
4260. gbvrt173.seq - Other vertebrate sequence entries, part 173.
4261. gbvrt174.seq - Other vertebrate sequence entries, part 174.
4262. gbvrt175.seq - Other vertebrate sequence entries, part 175.
4263. gbvrt176.seq - Other vertebrate sequence entries, part 176.
4264. gbvrt177.seq - Other vertebrate sequence entries, part 177.
4265. gbvrt178.seq - Other vertebrate sequence entries, part 178.
4266. gbvrt179.seq - Other vertebrate sequence entries, part 179.
4267. gbvrt18.seq - Other vertebrate sequence entries, part 18.
4268. gbvrt180.seq - Other vertebrate sequence entries, part 180.
4269. gbvrt181.seq - Other vertebrate sequence entries, part 181.
4270. gbvrt182.seq - Other vertebrate sequence entries, part 182.
4271. gbvrt183.seq - Other vertebrate sequence entries, part 183.
4272. gbvrt184.seq - Other vertebrate sequence entries, part 184.
4273. gbvrt185.seq - Other vertebrate sequence entries, part 185.
4274. gbvrt186.seq - Other vertebrate sequence entries, part 186.
4275. gbvrt187.seq - Other vertebrate sequence entries, part 187.
4276. gbvrt188.seq - Other vertebrate sequence entries, part 188.
4277. gbvrt189.seq - Other vertebrate sequence entries, part 189.
4278. gbvrt19.seq - Other vertebrate sequence entries, part 19.
4279. gbvrt190.seq - Other vertebrate sequence entries, part 190.
4280. gbvrt191.seq - Other vertebrate sequence entries, part 191.
4281. gbvrt192.seq - Other vertebrate sequence entries, part 192.
4282. gbvrt193.seq - Other vertebrate sequence entries, part 193.
4283. gbvrt194.seq - Other vertebrate sequence entries, part 194.
4284. gbvrt195.seq - Other vertebrate sequence entries, part 195.
4285. gbvrt196.seq - Other vertebrate sequence entries, part 196.
4286. gbvrt197.seq - Other vertebrate sequence entries, part 197.
4287. gbvrt198.seq - Other vertebrate sequence entries, part 198.
4288. gbvrt199.seq - Other vertebrate sequence entries, part 199.
4289. gbvrt2.seq - Other vertebrate sequence entries, part 2.
4290. gbvrt20.seq - Other vertebrate sequence entries, part 20.
4291. gbvrt200.seq - Other vertebrate sequence entries, part 200.
4292. gbvrt201.seq - Other vertebrate sequence entries, part 201.
4293. gbvrt202.seq - Other vertebrate sequence entries, part 202.
4294. gbvrt203.seq - Other vertebrate sequence entries, part 203.
4295. gbvrt204.seq - Other vertebrate sequence entries, part 204.
4296. gbvrt205.seq - Other vertebrate sequence entries, part 205.
4297. gbvrt206.seq - Other vertebrate sequence entries, part 206.
4298. gbvrt207.seq - Other vertebrate sequence entries, part 207.
4299. gbvrt208.seq - Other vertebrate sequence entries, part 208.
4300. gbvrt209.seq - Other vertebrate sequence entries, part 209.
4301. gbvrt21.seq - Other vertebrate sequence entries, part 21.
4302. gbvrt210.seq - Other vertebrate sequence entries, part 210.
4303. gbvrt211.seq - Other vertebrate sequence entries, part 211.
4304. gbvrt212.seq - Other vertebrate sequence entries, part 212.
4305. gbvrt213.seq - Other vertebrate sequence entries, part 213.
4306. gbvrt214.seq - Other vertebrate sequence entries, part 214.
4307. gbvrt215.seq - Other vertebrate sequence entries, part 215.
4308. gbvrt216.seq - Other vertebrate sequence entries, part 216.
4309. gbvrt217.seq - Other vertebrate sequence entries, part 217.
4310. gbvrt218.seq - Other vertebrate sequence entries, part 218.
4311. gbvrt219.seq - Other vertebrate sequence entries, part 219.
4312. gbvrt22.seq - Other vertebrate sequence entries, part 22.
4313. gbvrt220.seq - Other vertebrate sequence entries, part 220.
4314. gbvrt221.seq - Other vertebrate sequence entries, part 221.
4315. gbvrt222.seq - Other vertebrate sequence entries, part 222.
4316. gbvrt223.seq - Other vertebrate sequence entries, part 223.
4317. gbvrt224.seq - Other vertebrate sequence entries, part 224.
4318. gbvrt225.seq - Other vertebrate sequence entries, part 225.
4319. gbvrt226.seq - Other vertebrate sequence entries, part 226.
4320. gbvrt227.seq - Other vertebrate sequence entries, part 227.
4321. gbvrt228.seq - Other vertebrate sequence entries, part 228.
4322. gbvrt229.seq - Other vertebrate sequence entries, part 229.
4323. gbvrt23.seq - Other vertebrate sequence entries, part 23.
4324. gbvrt230.seq - Other vertebrate sequence entries, part 230.
4325. gbvrt231.seq - Other vertebrate sequence entries, part 231.
4326. gbvrt232.seq - Other vertebrate sequence entries, part 232.
4327. gbvrt233.seq - Other vertebrate sequence entries, part 233.
4328. gbvrt234.seq - Other vertebrate sequence entries, part 234.
4329. gbvrt235.seq - Other vertebrate sequence entries, part 235.
4330. gbvrt236.seq - Other vertebrate sequence entries, part 236.
4331. gbvrt237.seq - Other vertebrate sequence entries, part 237.
4332. gbvrt238.seq - Other vertebrate sequence entries, part 238.
4333. gbvrt239.seq - Other vertebrate sequence entries, part 239.
4334. gbvrt24.seq - Other vertebrate sequence entries, part 24.
4335. gbvrt240.seq - Other vertebrate sequence entries, part 240.
4336. gbvrt241.seq - Other vertebrate sequence entries, part 241.
4337. gbvrt242.seq - Other vertebrate sequence entries, part 242.
4338. gbvrt243.seq - Other vertebrate sequence entries, part 243.
4339. gbvrt244.seq - Other vertebrate sequence entries, part 244.
4340. gbvrt245.seq - Other vertebrate sequence entries, part 245.
4341. gbvrt246.seq - Other vertebrate sequence entries, part 246.
4342. gbvrt247.seq - Other vertebrate sequence entries, part 247.
4343. gbvrt248.seq - Other vertebrate sequence entries, part 248.
4344. gbvrt249.seq - Other vertebrate sequence entries, part 249.
4345. gbvrt25.seq - Other vertebrate sequence entries, part 25.
4346. gbvrt250.seq - Other vertebrate sequence entries, part 250.
4347. gbvrt251.seq - Other vertebrate sequence entries, part 251.
4348. gbvrt252.seq - Other vertebrate sequence entries, part 252.
4349. gbvrt253.seq - Other vertebrate sequence entries, part 253.
4350. gbvrt254.seq - Other vertebrate sequence entries, part 254.
4351. gbvrt255.seq - Other vertebrate sequence entries, part 255.
4352. gbvrt256.seq - Other vertebrate sequence entries, part 256.
4353. gbvrt257.seq - Other vertebrate sequence entries, part 257.
4354. gbvrt258.seq - Other vertebrate sequence entries, part 258.
4355. gbvrt259.seq - Other vertebrate sequence entries, part 259.
4356. gbvrt26.seq - Other vertebrate sequence entries, part 26.
4357. gbvrt260.seq - Other vertebrate sequence entries, part 260.
4358. gbvrt261.seq - Other vertebrate sequence entries, part 261.
4359. gbvrt262.seq - Other vertebrate sequence entries, part 262.
4360. gbvrt263.seq - Other vertebrate sequence entries, part 263.
4361. gbvrt264.seq - Other vertebrate sequence entries, part 264.
4362. gbvrt265.seq - Other vertebrate sequence entries, part 265.
4363. gbvrt266.seq - Other vertebrate sequence entries, part 266.
4364. gbvrt267.seq - Other vertebrate sequence entries, part 267.
4365. gbvrt268.seq - Other vertebrate sequence entries, part 268.
4366. gbvrt269.seq - Other vertebrate sequence entries, part 269.
4367. gbvrt27.seq - Other vertebrate sequence entries, part 27.
4368. gbvrt270.seq - Other vertebrate sequence entries, part 270.
4369. gbvrt271.seq - Other vertebrate sequence entries, part 271.
4370. gbvrt272.seq - Other vertebrate sequence entries, part 272.
4371. gbvrt273.seq - Other vertebrate sequence entries, part 273.
4372. gbvrt274.seq - Other vertebrate sequence entries, part 274.
4373. gbvrt275.seq - Other vertebrate sequence entries, part 275.
4374. gbvrt276.seq - Other vertebrate sequence entries, part 276.
4375. gbvrt277.seq - Other vertebrate sequence entries, part 277.
4376. gbvrt28.seq - Other vertebrate sequence entries, part 28.
4377. gbvrt29.seq - Other vertebrate sequence entries, part 29.
4378. gbvrt3.seq - Other vertebrate sequence entries, part 3.
4379. gbvrt30.seq - Other vertebrate sequence entries, part 30.
4380. gbvrt31.seq - Other vertebrate sequence entries, part 31.
4381. gbvrt32.seq - Other vertebrate sequence entries, part 32.
4382. gbvrt33.seq - Other vertebrate sequence entries, part 33.
4383. gbvrt34.seq - Other vertebrate sequence entries, part 34.
4384. gbvrt35.seq - Other vertebrate sequence entries, part 35.
4385. gbvrt36.seq - Other vertebrate sequence entries, part 36.
4386. gbvrt37.seq - Other vertebrate sequence entries, part 37.
4387. gbvrt38.seq - Other vertebrate sequence entries, part 38.
4388. gbvrt39.seq - Other vertebrate sequence entries, part 39.
4389. gbvrt4.seq - Other vertebrate sequence entries, part 4.
4390. gbvrt40.seq - Other vertebrate sequence entries, part 40.
4391. gbvrt41.seq - Other vertebrate sequence entries, part 41.
4392. gbvrt42.seq - Other vertebrate sequence entries, part 42.
4393. gbvrt43.seq - Other vertebrate sequence entries, part 43.
4394. gbvrt44.seq - Other vertebrate sequence entries, part 44.
4395. gbvrt45.seq - Other vertebrate sequence entries, part 45.
4396. gbvrt46.seq - Other vertebrate sequence entries, part 46.
4397. gbvrt47.seq - Other vertebrate sequence entries, part 47.
4398. gbvrt48.seq - Other vertebrate sequence entries, part 48.
4399. gbvrt49.seq - Other vertebrate sequence entries, part 49.
4400. gbvrt5.seq - Other vertebrate sequence entries, part 5.
4401. gbvrt50.seq - Other vertebrate sequence entries, part 50.
4402. gbvrt51.seq - Other vertebrate sequence entries, part 51.
4403. gbvrt52.seq - Other vertebrate sequence entries, part 52.
4404. gbvrt53.seq - Other vertebrate sequence entries, part 53.
4405. gbvrt54.seq - Other vertebrate sequence entries, part 54.
4406. gbvrt55.seq - Other vertebrate sequence entries, part 55.
4407. gbvrt56.seq - Other vertebrate sequence entries, part 56.
4408. gbvrt57.seq - Other vertebrate sequence entries, part 57.
4409. gbvrt58.seq - Other vertebrate sequence entries, part 58.
4410. gbvrt59.seq - Other vertebrate sequence entries, part 59.
4411. gbvrt6.seq - Other vertebrate sequence entries, part 6.
4412. gbvrt60.seq - Other vertebrate sequence entries, part 60.
4413. gbvrt61.seq - Other vertebrate sequence entries, part 61.
4414. gbvrt62.seq - Other vertebrate sequence entries, part 62.
4415. gbvrt63.seq - Other vertebrate sequence entries, part 63.
4416. gbvrt64.seq - Other vertebrate sequence entries, part 64.
4417. gbvrt65.seq - Other vertebrate sequence entries, part 65.
4418. gbvrt66.seq - Other vertebrate sequence entries, part 66.
4419. gbvrt67.seq - Other vertebrate sequence entries, part 67.
4420. gbvrt68.seq - Other vertebrate sequence entries, part 68.
4421. gbvrt69.seq - Other vertebrate sequence entries, part 69.
4422. gbvrt7.seq - Other vertebrate sequence entries, part 7.
4423. gbvrt70.seq - Other vertebrate sequence entries, part 70.
4424. gbvrt71.seq - Other vertebrate sequence entries, part 71.
4425. gbvrt72.seq - Other vertebrate sequence entries, part 72.
4426. gbvrt73.seq - Other vertebrate sequence entries, part 73.
4427. gbvrt74.seq - Other vertebrate sequence entries, part 74.
4428. gbvrt75.seq - Other vertebrate sequence entries, part 75.
4429. gbvrt76.seq - Other vertebrate sequence entries, part 76.
4430. gbvrt77.seq - Other vertebrate sequence entries, part 77.
4431. gbvrt78.seq - Other vertebrate sequence entries, part 78.
4432. gbvrt79.seq - Other vertebrate sequence entries, part 79.
4433. gbvrt8.seq - Other vertebrate sequence entries, part 8.
4434. gbvrt80.seq - Other vertebrate sequence entries, part 80.
4435. gbvrt81.seq - Other vertebrate sequence entries, part 81.
4436. gbvrt82.seq - Other vertebrate sequence entries, part 82.
4437. gbvrt83.seq - Other vertebrate sequence entries, part 83.
4438. gbvrt84.seq - Other vertebrate sequence entries, part 84.
4439. gbvrt85.seq - Other vertebrate sequence entries, part 85.
4440. gbvrt86.seq - Other vertebrate sequence entries, part 86.
4441. gbvrt87.seq - Other vertebrate sequence entries, part 87.
4442. gbvrt88.seq - Other vertebrate sequence entries, part 88.
4443. gbvrt89.seq - Other vertebrate sequence entries, part 89.
4444. gbvrt9.seq - Other vertebrate sequence entries, part 9.
4445. gbvrt90.seq - Other vertebrate sequence entries, part 90.
4446. gbvrt91.seq - Other vertebrate sequence entries, part 91.
4447. gbvrt92.seq - Other vertebrate sequence entries, part 92.
4448. gbvrt93.seq - Other vertebrate sequence entries, part 93.
4449. gbvrt94.seq - Other vertebrate sequence entries, part 94.
4450. gbvrt95.seq - Other vertebrate sequence entries, part 95.
4451. gbvrt96.seq - Other vertebrate sequence entries, part 96.
4452. gbvrt97.seq - Other vertebrate sequence entries, part 97.
4453. gbvrt98.seq - Other vertebrate sequence entries, part 98.
4454. gbvrt99.seq - Other vertebrate sequence entries, part 99.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 247.0 flatfiles require roughly 2072 GB,
including the sequence files and the *.txt files.

  The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 499259480     gbbct1.seq
 496612960     gbbct10.seq
 499324167     gbbct100.seq
 499932129     gbbct101.seq
 389028332     gbbct102.seq
 499874269     gbbct103.seq
 498124390     gbbct104.seq
 499292813     gbbct105.seq
 491408395     gbbct106.seq
  13752576     gbbct107.seq
 493589462     gbbct108.seq
 494745656     gbbct109.seq
 498136987     gbbct11.seq
 495417091     gbbct110.seq
 491069767     gbbct111.seq
 195549944     gbbct112.seq
 494137200     gbbct113.seq
 492532604     gbbct114.seq
 493222616     gbbct115.seq
 497237544     gbbct116.seq
  99480457     gbbct117.seq
 499011099     gbbct118.seq
 494100520     gbbct119.seq
 498756045     gbbct12.seq
 498830192     gbbct120.seq
 333298131     gbbct121.seq
 490710901     gbbct122.seq
 498618623     gbbct123.seq
 499996414     gbbct124.seq
 426871894     gbbct125.seq
 491476756     gbbct126.seq
 489083565     gbbct127.seq
 487156164     gbbct128.seq
 498575686     gbbct129.seq
  27848759     gbbct13.seq
 490822708     gbbct130.seq
 488628042     gbbct131.seq
 425698283     gbbct132.seq
 498287600     gbbct133.seq
 489448148     gbbct134.seq
 499734618     gbbct135.seq
 461301978     gbbct136.seq
 495776368     gbbct137.seq
 493829163     gbbct138.seq
 491661079     gbbct139.seq
 499887466     gbbct14.seq
 498685040     gbbct140.seq
 499806039     gbbct141.seq
 147979248     gbbct142.seq
 496896898     gbbct143.seq
 494838871     gbbct144.seq
 493251880     gbbct145.seq
 494975862     gbbct146.seq
 404787526     gbbct147.seq
 489367453     gbbct148.seq
 490447002     gbbct149.seq
 496454456     gbbct15.seq
 498396095     gbbct150.seq
 497204439     gbbct151.seq
 492635401     gbbct152.seq
 341076607     gbbct153.seq
 497655705     gbbct154.seq
 494967400     gbbct155.seq
 496951858     gbbct156.seq
 489042983     gbbct157.seq
 493287316     gbbct158.seq
 496052394     gbbct159.seq
 496649883     gbbct16.seq
 159717876     gbbct160.seq
 494733255     gbbct161.seq
 491514117     gbbct162.seq
 495160140     gbbct163.seq
 475148166     gbbct164.seq
 497456266     gbbct165.seq
 493190416     gbbct166.seq
 492199036     gbbct167.seq
 491123378     gbbct168.seq
 493968202     gbbct169.seq
 492249028     gbbct17.seq
 489220638     gbbct170.seq
 497866775     gbbct171.seq
 493887547     gbbct172.seq
 185980584     gbbct173.seq
 493674830     gbbct174.seq
 491173897     gbbct175.seq
 499375473     gbbct176.seq
 273476308     gbbct177.seq
 495005879     gbbct178.seq
 495932708     gbbct179.seq
  10689912     gbbct18.seq
 489790180     gbbct180.seq
 303707273     gbbct181.seq
 499225752     gbbct182.seq
 489058640     gbbct183.seq
 495424960     gbbct184.seq
 496021735     gbbct185.seq
  67162117     gbbct186.seq
 498036470     gbbct187.seq
 497779458     gbbct188.seq
 496082556     gbbct189.seq
 498898071     gbbct19.seq
 496491420     gbbct190.seq
 499747522     gbbct191.seq
 192261371     gbbct192.seq
 498767524     gbbct193.seq
 497238511     gbbct194.seq
 493962900     gbbct195.seq
 497330771     gbbct196.seq
 275862662     gbbct197.seq
 495095202     gbbct198.seq
 495971863     gbbct199.seq
 497213550     gbbct2.seq
 494174935     gbbct20.seq
 496079271     gbbct200.seq
 493223749     gbbct201.seq
 246412464     gbbct202.seq
 499817107     gbbct203.seq
 497426553     gbbct204.seq
 497029420     gbbct205.seq
 484791693     gbbct206.seq
 440229810     gbbct207.seq
 499900270     gbbct208.seq
 496011603     gbbct209.seq
 499430669     gbbct21.seq
 481293325     gbbct210.seq
 496168589     gbbct211.seq
 495262662     gbbct212.seq
 499946384     gbbct213.seq
 318928688     gbbct214.seq
 497109748     gbbct215.seq
 493797358     gbbct216.seq
 496714951     gbbct217.seq
 378276833     gbbct218.seq
 484833376     gbbct219.seq
 494264055     gbbct22.seq
 495646244     gbbct220.seq
 499615273     gbbct221.seq
 497011341     gbbct222.seq
 228371678     gbbct223.seq
 493989285     gbbct224.seq
 489510996     gbbct225.seq
 488962683     gbbct226.seq
 173357137     gbbct227.seq
 493892623     gbbct228.seq
 492907486     gbbct229.seq
  65823472     gbbct23.seq
 493520883     gbbct230.seq
 496872338     gbbct231.seq
 136681481     gbbct232.seq
 494063240     gbbct233.seq
 488280336     gbbct234.seq
 489824993     gbbct235.seq
 489987006     gbbct236.seq
 145652118     gbbct237.seq
 483161615     gbbct238.seq
 496790685     gbbct239.seq
 492477723     gbbct24.seq
 489571129     gbbct240.seq
 446057099     gbbct241.seq
 492193861     gbbct242.seq
 487559567     gbbct243.seq
 492444359     gbbct244.seq
 457216212     gbbct245.seq
 498159153     gbbct246.seq
 490705855     gbbct247.seq
 496101905     gbbct248.seq
 492720782     gbbct249.seq
 490124422     gbbct25.seq
 495668456     gbbct250.seq
 131796901     gbbct251.seq
 491982944     gbbct252.seq
 488305773     gbbct253.seq
 484960307     gbbct254.seq
 448261511     gbbct255.seq
 496469902     gbbct256.seq
 495798379     gbbct257.seq
 499577661     gbbct258.seq
 448624123     gbbct259.seq
 498214368     gbbct26.seq
 496061094     gbbct260.seq
 499419753     gbbct261.seq
 488828327     gbbct262.seq
 496557702     gbbct263.seq
 496529316     gbbct264.seq
 497207070     gbbct265.seq
 157062365     gbbct266.seq
 491163381     gbbct267.seq
 488410881     gbbct268.seq
 497409217     gbbct269.seq
 497675432     gbbct27.seq
 495127243     gbbct270.seq
  24400806     gbbct271.seq
 497188850     gbbct272.seq
 496648193     gbbct273.seq
 496913586     gbbct274.seq
 458244617     gbbct275.seq
 498862100     gbbct276.seq
 493444482     gbbct277.seq
 499643473     gbbct278.seq
 486051956     gbbct279.seq
 206962983     gbbct28.seq
 492091412     gbbct280.seq
 498417795     gbbct281.seq
 498412550     gbbct282.seq
 481644647     gbbct283.seq
 487661791     gbbct284.seq
 490839877     gbbct285.seq
 497466942     gbbct286.seq
 496515382     gbbct287.seq
 498703086     gbbct288.seq
 491043235     gbbct289.seq
 497340655     gbbct29.seq
 243311482     gbbct290.seq
 492633179     gbbct291.seq
 498721787     gbbct292.seq
 496314451     gbbct293.seq
 495824074     gbbct294.seq
 358381811     gbbct295.seq
 498732025     gbbct296.seq
 495863974     gbbct297.seq
 496227294     gbbct298.seq
 496935580     gbbct299.seq
 301461507     gbbct3.seq
 497861790     gbbct30.seq
 387482713     gbbct300.seq
 494855877     gbbct301.seq
 494741752     gbbct302.seq
 499982911     gbbct303.seq
 489769297     gbbct304.seq
 413163493     gbbct305.seq
 498785469     gbbct306.seq
 497116078     gbbct307.seq
 488501771     gbbct308.seq
 497888982     gbbct309.seq
 492727160     gbbct31.seq
 389355908     gbbct310.seq
 491217074     gbbct311.seq
 497116159     gbbct312.seq
 497052465     gbbct313.seq
 494542416     gbbct314.seq
 433978422     gbbct315.seq
 497529569     gbbct316.seq
 493930050     gbbct317.seq
 499363443     gbbct318.seq
 496245689     gbbct319.seq
 479354454     gbbct32.seq
 232180401     gbbct320.seq
 495594905     gbbct321.seq
 498470636     gbbct322.seq
 492943609     gbbct323.seq
 495557340     gbbct324.seq
 396883322     gbbct325.seq
 490874808     gbbct326.seq
 499740580     gbbct327.seq
 495156285     gbbct328.seq
 496472836     gbbct329.seq
 499615969     gbbct33.seq
 497532835     gbbct330.seq
 497318169     gbbct331.seq
 494052623     gbbct332.seq
 200007003     gbbct333.seq
 488777141     gbbct334.seq
 496209304     gbbct335.seq
 492689061     gbbct336.seq
 495895791     gbbct337.seq
 492154954     gbbct338.seq
 495701158     gbbct339.seq
 496530149     gbbct34.seq
 200905335     gbbct340.seq
 493830573     gbbct341.seq
 499628676     gbbct342.seq
 499949000     gbbct343.seq
 499387139     gbbct344.seq
 346576950     gbbct345.seq
 497565034     gbbct346.seq
 499825673     gbbct347.seq
 490104239     gbbct348.seq
 486817395     gbbct349.seq
 487951351     gbbct35.seq
 496051375     gbbct350.seq
 499501315     gbbct351.seq
 495843948     gbbct352.seq
   6565056     gbbct353.seq
 488618122     gbbct354.seq
 488289848     gbbct355.seq
 497016570     gbbct356.seq
 499548856     gbbct357.seq
 136114841     gbbct358.seq
 495699614     gbbct359.seq
 499261465     gbbct36.seq
 499901696     gbbct360.seq
 493828023     gbbct361.seq
 496877473     gbbct362.seq
 139086569     gbbct363.seq
 492034210     gbbct364.seq
 496396132     gbbct365.seq
 492762556     gbbct366.seq
 498390460     gbbct367.seq
 493564294     gbbct368.seq
 491470762     gbbct369.seq
 412319882     gbbct37.seq
  78679756     gbbct370.seq
 497084397     gbbct371.seq
 496693486     gbbct372.seq
 498025876     gbbct373.seq
 496976675     gbbct374.seq
 492020214     gbbct375.seq
 494507374     gbbct376.seq
 272891762     gbbct377.seq
 490502556     gbbct378.seq
 498185513     gbbct379.seq
  21422275     gbbct38.seq
 493195301     gbbct380.seq
 498843190     gbbct381.seq
 497203253     gbbct382.seq
 175983756     gbbct383.seq
 495693150     gbbct384.seq
 493701177     gbbct385.seq
 497742378     gbbct386.seq
 495114023     gbbct387.seq
 490532237     gbbct388.seq
 400797089     gbbct389.seq
  38670853     gbbct39.seq
 496813684     gbbct390.seq
 491384339     gbbct391.seq
 497873487     gbbct392.seq
 497522835     gbbct393.seq
 493728607     gbbct394.seq
 496204168     gbbct395.seq
 244097822     gbbct396.seq
 491413692     gbbct397.seq
 493169126     gbbct398.seq
 496244710     gbbct399.seq
 394605700     gbbct4.seq
 499518955     gbbct40.seq
 495287815     gbbct400.seq
 142636038     gbbct401.seq
 484011784     gbbct402.seq
 494094195     gbbct403.seq
 498211901     gbbct404.seq
 498467296     gbbct405.seq
 365378913     gbbct406.seq
 497736167     gbbct407.seq
 495588675     gbbct408.seq
 492255322     gbbct409.seq
 495920377     gbbct41.seq
 492578950     gbbct410.seq
 219936688     gbbct411.seq
 493594425     gbbct412.seq
 495578034     gbbct413.seq
 495904326     gbbct414.seq
 493958546     gbbct415.seq
 147493880     gbbct416.seq
 499863872     gbbct417.seq
 493319269     gbbct418.seq
 487924223     gbbct419.seq
 497800129     gbbct42.seq
 497771554     gbbct420.seq
  24099917     gbbct421.seq
 494159595     gbbct422.seq
 498759724     gbbct423.seq
 498971511     gbbct424.seq
 487259151     gbbct425.seq
 493426836     gbbct426.seq
 490784326     gbbct427.seq
 495843655     gbbct428.seq
 497846877     gbbct429.seq
 446397825     gbbct43.seq
 494199224     gbbct430.seq
 216229141     gbbct431.seq
 496382730     gbbct432.seq
 492218238     gbbct433.seq
 493701457     gbbct434.seq
 499598941     gbbct435.seq
 401883704     gbbct436.seq
 492735773     gbbct437.seq
 491656794     gbbct438.seq
 498341617     gbbct439.seq
 497462651     gbbct44.seq
 492422446     gbbct440.seq
 497905612     gbbct441.seq
 495142621     gbbct442.seq
  26230577     gbbct443.seq
 494893698     gbbct444.seq
 494078686     gbbct445.seq
 497060323     gbbct446.seq
 497397465     gbbct447.seq
 495245242     gbbct448.seq
 488504791     gbbct449.seq
 491184025     gbbct45.seq
 104824017     gbbct450.seq
 488324528     gbbct451.seq
 497533793     gbbct452.seq
 493548787     gbbct453.seq
 499403536     gbbct454.seq
 490776009     gbbct455.seq
 457647469     gbbct456.seq
 494298101     gbbct457.seq
 493347926     gbbct458.seq
 495710628     gbbct459.seq
 499082429     gbbct46.seq
 488828204     gbbct460.seq
 115773954     gbbct461.seq
 496594910     gbbct462.seq
 499149912     gbbct463.seq
 499125261     gbbct464.seq
 499944936     gbbct465.seq
 490800718     gbbct466.seq
 494864784     gbbct467.seq
 248271795     gbbct468.seq
 490780784     gbbct469.seq
 495738282     gbbct47.seq
 488637491     gbbct470.seq
 486173029     gbbct471.seq
 499840113     gbbct472.seq
 496320739     gbbct473.seq
 498128900     gbbct474.seq
   7085764     gbbct475.seq
 489159851     gbbct476.seq
 489835660     gbbct477.seq
 497847102     gbbct478.seq
 495450447     gbbct479.seq
 488459731     gbbct48.seq
 497974388     gbbct480.seq
 300531746     gbbct481.seq
 499164493     gbbct482.seq
 487164463     gbbct483.seq
 495032510     gbbct484.seq
 492976639     gbbct485.seq
 495031093     gbbct486.seq
 494983718     gbbct487.seq
 172358845     gbbct488.seq
 495524387     gbbct489.seq
 274679466     gbbct49.seq
 490687905     gbbct490.seq
 499771768     gbbct491.seq
 495829156     gbbct492.seq
 499851351     gbbct493.seq
 335428627     gbbct494.seq
 486521490     gbbct495.seq
 492583395     gbbct496.seq
 497515436     gbbct497.seq
 493698334     gbbct498.seq
 499460732     gbbct499.seq
 459635489     gbbct5.seq
 496358754     gbbct50.seq
 162678193     gbbct500.seq
 495672213     gbbct501.seq
 492539722     gbbct502.seq
 499660823     gbbct503.seq
 499303338     gbbct504.seq
 332085515     gbbct505.seq
 495965397     gbbct506.seq
 489288126     gbbct507.seq
 491026355     gbbct508.seq
 495680320     gbbct509.seq
 499742179     gbbct51.seq
 498487247     gbbct510.seq
 428017441     gbbct511.seq
 491800376     gbbct512.seq
 496310295     gbbct513.seq
 485849974     gbbct514.seq
 493461273     gbbct515.seq
 313040872     gbbct516.seq
 495818347     gbbct517.seq
 494012499     gbbct518.seq
 492318964     gbbct519.seq
 499660484     gbbct52.seq
 497437056     gbbct520.seq
 353456945     gbbct521.seq
 497870951     gbbct522.seq
 497926061     gbbct523.seq
 498555781     gbbct524.seq
 491177451     gbbct525.seq
 439916488     gbbct526.seq
 490256701     gbbct527.seq
 495352494     gbbct528.seq
 490394427     gbbct529.seq
 499517346     gbbct53.seq
 497144021     gbbct530.seq
 495280243     gbbct531.seq
 495434762     gbbct532.seq
 494508342     gbbct533.seq
 497077552     gbbct534.seq
 498042992     gbbct535.seq
 422660336     gbbct536.seq
 493233075     gbbct537.seq
 498383177     gbbct538.seq
 491978104     gbbct539.seq
 491852124     gbbct54.seq
 499381634     gbbct540.seq
 472571076     gbbct541.seq
 492719104     gbbct542.seq
 488680115     gbbct543.seq
 492109864     gbbct544.seq
 499745708     gbbct545.seq
 468205713     gbbct546.seq
 490321550     gbbct547.seq
 494880340     gbbct548.seq
 498767552     gbbct549.seq
 327207257     gbbct55.seq
 491330833     gbbct550.seq
 493222164     gbbct551.seq
 325516981     gbbct552.seq
 492008712     gbbct553.seq
 498724711     gbbct554.seq
 492669894     gbbct555.seq
 496501844     gbbct556.seq
 317469466     gbbct557.seq
 489172787     gbbct558.seq
 495720623     gbbct559.seq
 499974669     gbbct56.seq
 490283945     gbbct560.seq
 496658970     gbbct561.seq
 498307920     gbbct562.seq
 292744921     gbbct563.seq
 488171879     gbbct564.seq
 491599972     gbbct565.seq
 490702609     gbbct566.seq
 493768521     gbbct567.seq
 127994869     gbbct568.seq
 498308197     gbbct569.seq
 492293149     gbbct57.seq
 496917099     gbbct570.seq
 492714293     gbbct571.seq
 495117201     gbbct572.seq
 499547922     gbbct573.seq
 488586301     gbbct574.seq
  69517436     gbbct575.seq
 493502195     gbbct576.seq
 495907098     gbbct577.seq
 489805316     gbbct578.seq
 493999235     gbbct579.seq
 489450337     gbbct58.seq
 130319158     gbbct580.seq
 491930852     gbbct581.seq
 488648691     gbbct582.seq
 494755059     gbbct583.seq
 491068814     gbbct584.seq
 493047324     gbbct585.seq
 100400767     gbbct586.seq
 497863536     gbbct587.seq
 498962216     gbbct588.seq
 499817289     gbbct589.seq
 497371491     gbbct59.seq
 496295481     gbbct590.seq
 108708425     gbbct591.seq
 490580638     gbbct592.seq
 497703337     gbbct593.seq
 491079551     gbbct594.seq
 493503843     gbbct595.seq
  36625246     gbbct596.seq
 495779279     gbbct597.seq
 491327650     gbbct598.seq
 490677322     gbbct599.seq
 102231227     gbbct6.seq
 499930372     gbbct60.seq
 495667068     gbbct600.seq
  63280077     gbbct601.seq
 496199725     gbbct602.seq
 493531855     gbbct603.seq
 494756636     gbbct604.seq
 494106266     gbbct605.seq
 291541528     gbbct606.seq
 491839080     gbbct607.seq
 499990633     gbbct608.seq
 498927443     gbbct609.seq
 495180468     gbbct61.seq
 489118564     gbbct610.seq
 488185233     gbbct611.seq
 348336361     gbbct612.seq
 305795072     gbbct613.seq
   6889743     gbbct614.seq
  14165487     gbbct615.seq
  22795937     gbbct616.seq
  44486451     gbbct617.seq
  86608120     gbbct618.seq
 168532685     gbbct619.seq
 112142395     gbbct62.seq
 499998953     gbbct620.seq
 492658247     gbbct621.seq
 499477361     gbbct622.seq
 499964784     gbbct623.seq
 498194733     gbbct624.seq
 499998552     gbbct625.seq
 131034050     gbbct626.seq
 493357177     gbbct627.seq
 499344297     gbbct628.seq
 484371840     gbbct629.seq
 494607843     gbbct63.seq
 499999529     gbbct630.seq
 218593740     gbbct631.seq
 499999447     gbbct632.seq
 290354752     gbbct633.seq
 500000144     gbbct634.seq
  85322943     gbbct635.seq
 499997375     gbbct636.seq
 125260141     gbbct637.seq
 499998196     gbbct638.seq
  44499956     gbbct639.seq
 499071306     gbbct64.seq
 146513292     gbbct640.seq
 499088688     gbbct641.seq
 499334296     gbbct642.seq
 497110345     gbbct643.seq
 489926396     gbbct644.seq
 493050028     gbbct645.seq
 497933391     gbbct646.seq
 497254622     gbbct647.seq
 488464412     gbbct648.seq
 305471094     gbbct649.seq
 496563653     gbbct65.seq
 495496742     gbbct650.seq
 498011072     gbbct651.seq
 498177095     gbbct652.seq
 168612837     gbbct653.seq
 472461375     gbbct654.seq
 497338619     gbbct655.seq
 497109977     gbbct656.seq
 499753219     gbbct657.seq
 126536669     gbbct658.seq
 488194545     gbbct659.seq
 497567607     gbbct66.seq
 496058636     gbbct660.seq
 495758797     gbbct661.seq
 330366148     gbbct662.seq
 498499361     gbbct663.seq
 497461802     gbbct664.seq
 491671404     gbbct665.seq
 325905521     gbbct666.seq
 496306969     gbbct667.seq
 497541981     gbbct668.seq
 499037514     gbbct669.seq
 499752515     gbbct67.seq
 243471317     gbbct670.seq
 492626672     gbbct671.seq
 496920919     gbbct672.seq
 498726058     gbbct673.seq
 498559022     gbbct674.seq
 105681578     gbbct675.seq
 496393319     gbbct676.seq
 489823041     gbbct677.seq
 498850470     gbbct678.seq
 457162623     gbbct679.seq
 490382212     gbbct68.seq
  51232093     gbbct680.seq
 107838107     gbbct681.seq
 499999156     gbbct682.seq
 499999059     gbbct683.seq
 349482112     gbbct684.seq
 499999049     gbbct685.seq
 496966385     gbbct686.seq
 499993942     gbbct687.seq
  62448765     gbbct688.seq
 257413019     gbbct69.seq
 282435513     gbbct7.seq
 499969319     gbbct70.seq
 495193643     gbbct71.seq
 486287619     gbbct72.seq
 493007117     gbbct73.seq
 475857706     gbbct74.seq
 490138187     gbbct75.seq
 485838566     gbbct76.seq
 497985729     gbbct77.seq
 498936924     gbbct78.seq
 306897163     gbbct79.seq
 493057045     gbbct8.seq
 491474134     gbbct80.seq
 494313903     gbbct81.seq
 495819854     gbbct82.seq
 498720135     gbbct83.seq
 499103525     gbbct84.seq
 261686678     gbbct85.seq
 498131156     gbbct86.seq
 499518120     gbbct87.seq
 498962667     gbbct88.seq
 488108298     gbbct89.seq
 493341951     gbbct9.seq
 397950605     gbbct90.seq
 498261726     gbbct91.seq
 492775588     gbbct92.seq
 495523568     gbbct93.seq
 300972613     gbbct94.seq
 499886298     gbbct95.seq
 495464581     gbbct96.seq
 496856415     gbbct97.seq
  74937857     gbbct98.seq
 489628381     gbbct99.seq
   1197444     gbchg.txt
 499829089     gbcon1.seq
 499996911     gbcon10.seq
 499997716     gbcon100.seq
 499998282     gbcon101.seq
 169085272     gbcon102.seq
 499871153     gbcon103.seq
 498434527     gbcon104.seq
 499996134     gbcon105.seq
 499909892     gbcon106.seq
 295511616     gbcon107.seq
 499997195     gbcon108.seq
 499998885     gbcon109.seq
 498633689     gbcon11.seq
 302127481     gbcon110.seq
 499998740     gbcon111.seq
 499998794     gbcon112.seq
 129719889     gbcon113.seq
 499879850     gbcon114.seq
 499997696     gbcon115.seq
 499544011     gbcon116.seq
 277040672     gbcon117.seq
 499999876     gbcon118.seq
 499999395     gbcon119.seq
 499993720     gbcon12.seq
 222253215     gbcon120.seq
  45836617     gbcon121.seq
 499942457     gbcon122.seq
 499998578     gbcon123.seq
 447238322     gbcon124.seq
 499997943     gbcon125.seq
 499998025     gbcon126.seq
 499991213     gbcon127.seq
 196447274     gbcon128.seq
 499995599     gbcon129.seq
 498148333     gbcon13.seq
 499998307     gbcon130.seq
 238753423     gbcon131.seq
 499998967     gbcon132.seq
 466835842     gbcon133.seq
 499997535     gbcon134.seq
 499997800     gbcon135.seq
 258872277     gbcon136.seq
 499997740     gbcon137.seq
 500000223     gbcon138.seq
 497457444     gbcon139.seq
 496523559     gbcon14.seq
 499999139     gbcon140.seq
 499997145     gbcon141.seq
 179142419     gbcon142.seq
 499998220     gbcon143.seq
 499999267     gbcon144.seq
  22767123     gbcon145.seq
 499889958     gbcon146.seq
 499998779     gbcon147.seq
 410562055     gbcon148.seq
 499942667     gbcon149.seq
 498686185     gbcon15.seq
 499902113     gbcon150.seq
 376962139     gbcon151.seq
 499993470     gbcon152.seq
 499997683     gbcon153.seq
 264124522     gbcon154.seq
 499999522     gbcon155.seq
 499998021     gbcon156.seq
  81972538     gbcon157.seq
 499997754     gbcon158.seq
 499943102     gbcon159.seq
 499917848     gbcon16.seq
 499994720     gbcon160.seq
 141101720     gbcon161.seq
 499830763     gbcon162.seq
 499983832     gbcon163.seq
 499968068     gbcon164.seq
 336326273     gbcon165.seq
 499999379     gbcon166.seq
 499966894     gbcon167.seq
 398621359     gbcon168.seq
 499999531     gbcon169.seq
 496600854     gbcon17.seq
 499999335     gbcon170.seq
 499998743     gbcon171.seq
 271485755     gbcon172.seq
 499999711     gbcon173.seq
 499998667     gbcon174.seq
 499389044     gbcon175.seq
 499999294     gbcon176.seq
 154734611     gbcon177.seq
 500000168     gbcon178.seq
 499996814     gbcon179.seq
 497306457     gbcon18.seq
 137316083     gbcon180.seq
 499992702     gbcon181.seq
 499997814     gbcon182.seq
 499998639     gbcon183.seq
 302177094     gbcon184.seq
 499943286     gbcon185.seq
 499999013     gbcon186.seq
 478528460     gbcon187.seq
 499997013     gbcon188.seq
 499981253     gbcon189.seq
 261542820     gbcon19.seq
 397710774     gbcon190.seq
 499934774     gbcon191.seq
 499994397     gbcon192.seq
 499983792     gbcon193.seq
 156248302     gbcon194.seq
 499998392     gbcon195.seq
 499998372     gbcon196.seq
  37871910     gbcon197.seq
 499997011     gbcon198.seq
 499996786     gbcon199.seq
 499999472     gbcon2.seq
 499997687     gbcon20.seq
 499999881     gbcon200.seq
 499999652     gbcon201.seq
 499994377     gbcon202.seq
 266871190     gbcon203.seq
 499999224     gbcon204.seq
 452407112     gbcon205.seq
 499990515     gbcon206.seq
 499996980     gbcon207.seq
 485368790     gbcon208.seq
 499997937     gbcon209.seq
 499999250     gbcon21.seq
 499998820     gbcon210.seq
 500000009     gbcon211.seq
  16855954     gbcon212.seq
 499996297     gbcon213.seq
 499974143     gbcon214.seq
 499998652     gbcon215.seq
 276851584     gbcon216.seq
 499898455     gbcon217.seq
 499848353     gbcon218.seq
 499989359     gbcon219.seq
 499998925     gbcon22.seq
 499956233     gbcon220.seq
 499999416     gbcon221.seq
 499998536     gbcon222.seq
  83532924     gbcon223.seq
  81416614     gbcon23.seq
 499998430     gbcon24.seq
 499999189     gbcon25.seq
 499549271     gbcon26.seq
 286871419     gbcon27.seq
 499486419     gbcon28.seq
 125749326     gbcon29.seq
 499993648     gbcon3.seq
 126444500     gbcon30.seq
 499925023     gbcon31.seq
 499992465     gbcon32.seq
  26152220     gbcon33.seq
 499999414     gbcon34.seq
 499998297     gbcon35.seq
 443990166     gbcon36.seq
 499999057     gbcon37.seq
 499998568     gbcon38.seq
 499999100     gbcon39.seq
 106310391     gbcon4.seq
  41918782     gbcon40.seq
 500000081     gbcon41.seq
 499998540     gbcon42.seq
 277009775     gbcon43.seq
 499996336     gbcon44.seq
 499998469     gbcon45.seq
 270612827     gbcon46.seq
 499996532     gbcon47.seq
 499996905     gbcon48.seq
 385374935     gbcon49.seq
 499940282     gbcon5.seq
 499997390     gbcon50.seq
 499999185     gbcon51.seq
 176580283     gbcon52.seq
 499999848     gbcon53.seq
 499997718     gbcon54.seq
 238773972     gbcon55.seq
 499997628     gbcon56.seq
 499995125     gbcon57.seq
 335698760     gbcon58.seq
 499996299     gbcon59.seq
 494453997     gbcon6.seq
 499999132     gbcon60.seq
 298461041     gbcon61.seq
 499995314     gbcon62.seq
 499999014     gbcon63.seq
 259899669     gbcon64.seq
 499996880     gbcon65.seq
 499997062     gbcon66.seq
 187377116     gbcon67.seq
 499996720     gbcon68.seq
 499999826     gbcon69.seq
 494750151     gbcon7.seq
 364586197     gbcon70.seq
 499993696     gbcon71.seq
 499999904     gbcon72.seq
 386119955     gbcon73.seq
 499993762     gbcon74.seq
 472811181     gbcon75.seq
 174082386     gbcon76.seq
 499941095     gbcon77.seq
  23944933     gbcon78.seq
 499987096     gbcon79.seq
 499998869     gbcon8.seq
 203666963     gbcon80.seq
 199581356     gbcon81.seq
 499495651     gbcon82.seq
 499985020     gbcon83.seq
 337640522     gbcon84.seq
 499532057     gbcon85.seq
 495874659     gbcon86.seq
 499843567     gbcon87.seq
 337606451     gbcon88.seq
 499974953     gbcon89.seq
  61944908     gbcon9.seq
 499999158     gbcon90.seq
 499929470     gbcon91.seq
 167922702     gbcon92.seq
 499999160     gbcon93.seq
 499999139     gbcon94.seq
 132412701     gbcon95.seq
 499987021     gbcon96.seq
 500000082     gbcon97.seq
 499997622     gbcon98.seq
 266010665     gbcon99.seq
     97817     gbdel.txt
 500000248     gbenv1.seq
 499996419     gbenv10.seq
 149836713     gbenv11.seq
 499997485     gbenv12.seq
 499998230     gbenv13.seq
  53792036     gbenv14.seq
 499998528     gbenv15.seq
 499999141     gbenv16.seq
 500000256     gbenv17.seq
 499996961     gbenv18.seq
   5907179     gbenv19.seq
 499999077     gbenv2.seq
 499999149     gbenv20.seq
 499999644     gbenv21.seq
 173647211     gbenv22.seq
 499962777     gbenv23.seq
 499999731     gbenv24.seq
 499999729     gbenv25.seq
  82913024     gbenv26.seq
 499998492     gbenv27.seq
 499997232     gbenv28.seq
 177807424     gbenv29.seq
 352032590     gbenv3.seq
 499998363     gbenv30.seq
 499998925     gbenv31.seq
 499999554     gbenv32.seq
  46355793     gbenv33.seq
 500000184     gbenv34.seq
 500000087     gbenv35.seq
 192748245     gbenv36.seq
 499996215     gbenv37.seq
 499998246     gbenv38.seq
 334820848     gbenv39.seq
 494542413     gbenv4.seq
 499997731     gbenv40.seq
 499998068     gbenv41.seq
 470562694     gbenv42.seq
 499998449     gbenv43.seq
 499997688     gbenv44.seq
 338452219     gbenv45.seq
 499999850     gbenv46.seq
 499998560     gbenv47.seq
 394387252     gbenv48.seq
 499998348     gbenv49.seq
 496523175     gbenv5.seq
 499999171     gbenv50.seq
 345212973     gbenv51.seq
 499998913     gbenv52.seq
 499998645     gbenv53.seq
 237943091     gbenv54.seq
 499998678     gbenv55.seq
 499999332     gbenv56.seq
 391022918     gbenv57.seq
 499998407     gbenv58.seq
 499995620     gbenv59.seq
 499830461     gbenv6.seq
 499997753     gbenv60.seq
  86193299     gbenv61.seq
 499943171     gbenv62.seq
 499999411     gbenv63.seq
 499788119     gbenv64.seq
 181115250     gbenv65.seq
 499998117     gbenv66.seq
 499999713     gbenv67.seq
 499837509     gbenv68.seq
 499998963     gbenv69.seq
 466426908     gbenv7.seq
 135703487     gbenv70.seq
 497119813     gbenv8.seq
 499931552     gbenv9.seq
 499998581     gbest1.seq
 499999733     gbest10.seq
 499999220     gbest100.seq
 499998662     gbest101.seq
 499997815     gbest102.seq
 499999077     gbest103.seq
  26280962     gbest104.seq
 499997739     gbest105.seq
 499996559     gbest106.seq
 499999711     gbest107.seq
 499996203     gbest108.seq
   9426180     gbest109.seq
 499999011     gbest11.seq
 499999283     gbest110.seq
 499998031     gbest111.seq
 499998955     gbest112.seq
 499998225     gbest113.seq
  19921978     gbest114.seq
 500000014     gbest115.seq
 499998435     gbest116.seq
 499999531     gbest117.seq
   9147880     gbest118.seq
 499997606     gbest119.seq
 474289011     gbest12.seq
 499998781     gbest120.seq
 499999893     gbest121.seq
  69282352     gbest122.seq
 499999961     gbest123.seq
 499998214     gbest124.seq
 223712939     gbest125.seq
 499997461     gbest126.seq
 499998633     gbest127.seq
 195307357     gbest128.seq
 499997173     gbest129.seq
 499999658     gbest13.seq
 499998792     gbest130.seq
 499995025     gbest131.seq
 499996839     gbest132.seq
  85321549     gbest133.seq
 499999011     gbest134.seq
 500000103     gbest135.seq
 499999730     gbest136.seq
 499997714     gbest137.seq
  99246406     gbest138.seq
 500000002     gbest139.seq
 249788691     gbest14.seq
 499997959     gbest140.seq
 499998236     gbest141.seq
 499999192     gbest142.seq
  24946687     gbest143.seq
 499997817     gbest144.seq
 499996032     gbest145.seq
 499999717     gbest146.seq
 499999913     gbest147.seq
  30453490     gbest148.seq
 499998561     gbest149.seq
 499999689     gbest15.seq
 499999358     gbest150.seq
 499998219     gbest151.seq
 322834163     gbest152.seq
 499996387     gbest153.seq
 499998779     gbest154.seq
 499995778     gbest155.seq
 499998742     gbest156.seq
  22334741     gbest157.seq
 500000171     gbest158.seq
 499999919     gbest159.seq
 499998336     gbest16.seq
 499996596     gbest160.seq
 499997385     gbest161.seq
  10491991     gbest162.seq
 500000079     gbest163.seq
 500000003     gbest164.seq
 499998995     gbest165.seq
 499998660     gbest166.seq
  83859383     gbest167.seq
 500000180     gbest168.seq
 499996624     gbest169.seq
 420910306     gbest17.seq
 499997982     gbest170.seq
 499996832     gbest171.seq
 120388331     gbest172.seq
 499998796     gbest173.seq
 499996875     gbest174.seq
 499998096     gbest175.seq
 500000066     gbest176.seq
  66109540     gbest177.seq
 499999609     gbest178.seq
 403619645     gbest179.seq
 499998902     gbest18.seq
 500000063     gbest180.seq
 499999705     gbest181.seq
 499997986     gbest182.seq
 499999873     gbest183.seq
  42448093     gbest184.seq
 499997351     gbest185.seq
 499999049     gbest186.seq
 499998723     gbest187.seq
 499998548     gbest188.seq
  41528079     gbest189.seq
 499999927     gbest19.seq
 499998332     gbest190.seq
 499997812     gbest191.seq
 499998689     gbest192.seq
 499998545     gbest193.seq
  10893500     gbest194.seq
 499997389     gbest195.seq
 499999423     gbest196.seq
 499999923     gbest197.seq
 499998596     gbest198.seq
  27592514     gbest199.seq
 499999372     gbest2.seq
 262214241     gbest20.seq
 499998352     gbest200.seq
 499997309     gbest201.seq
 499998232     gbest202.seq
 499999439     gbest203.seq
  33171889     gbest204.seq
  13610371     gbest205.seq
 500000009     gbest206.seq
 499999342     gbest207.seq
 328430736     gbest208.seq
 499997980     gbest209.seq
 500000121     gbest21.seq
 499999555     gbest210.seq
 317202244     gbest211.seq
 499997711     gbest212.seq
 499998222     gbest213.seq
 265493768     gbest214.seq
 499998282     gbest215.seq
 499999159     gbest216.seq
 269819857     gbest217.seq
 499997149     gbest218.seq
 499999290     gbest219.seq
 499999838     gbest22.seq
 499999631     gbest220.seq
 500000163     gbest221.seq
  49197565     gbest222.seq
 499999284     gbest223.seq
 499999484     gbest224.seq
 499998195     gbest225.seq
 500000115     gbest226.seq
  46767660     gbest227.seq
 499999550     gbest228.seq
 499996344     gbest229.seq
 243720945     gbest23.seq
 175850387     gbest230.seq
 499998729     gbest231.seq
 499999681     gbest232.seq
 499999475     gbest233.seq
 478347570     gbest234.seq
 499997785     gbest235.seq
 499999603     gbest236.seq
 499997429     gbest237.seq
 462328784     gbest238.seq
 499999067     gbest239.seq
 499998098     gbest24.seq
 499999466     gbest240.seq
 499999877     gbest241.seq
 494650973     gbest242.seq
 499998531     gbest243.seq
 499998185     gbest244.seq
 499997957     gbest245.seq
 499998535     gbest246.seq
  24355432     gbest247.seq
 499999109     gbest248.seq
 499999887     gbest249.seq
 499998386     gbest25.seq
 497234565     gbest250.seq
 499999018     gbest251.seq
 499998363     gbest252.seq
 499999589     gbest253.seq
 499998515     gbest254.seq
  21408398     gbest255.seq
 499998685     gbest256.seq
 499995885     gbest257.seq
 499992940     gbest258.seq
 499996960     gbest259.seq
 499994368     gbest26.seq
  75464086     gbest260.seq
 499999815     gbest261.seq
 499997500     gbest262.seq
 499996382     gbest263.seq
 500000186     gbest264.seq
  15070914     gbest265.seq
 499998431     gbest266.seq
 499999555     gbest267.seq
 499996266     gbest268.seq
 499996584     gbest269.seq
 499998227     gbest27.seq
  56608848     gbest270.seq
 499999104     gbest271.seq
 499998969     gbest272.seq
 499998846     gbest273.seq
 119014253     gbest274.seq
 499996151     gbest275.seq
 499997199     gbest276.seq
 499999976     gbest277.seq
 499997336     gbest278.seq
  53765216     gbest279.seq
  48964644     gbest28.seq
 499999317     gbest280.seq
 499997549     gbest281.seq
 499997631     gbest282.seq
 499998870     gbest283.seq
  56086801     gbest284.seq
 499999854     gbest285.seq
 499999427     gbest286.seq
 499998420     gbest287.seq
 499997908     gbest288.seq
  12413340     gbest289.seq
 499999934     gbest29.seq
 499997241     gbest290.seq
 500000143     gbest291.seq
 499997193     gbest292.seq
 499999266     gbest293.seq
  25249973     gbest294.seq
 499999965     gbest295.seq
 499996255     gbest296.seq
 485857148     gbest297.seq
 499996746     gbest298.seq
 499998051     gbest299.seq
 499998416     gbest3.seq
 499996534     gbest30.seq
 499999666     gbest300.seq
 499998500     gbest301.seq
   5577915     gbest302.seq
 499998622     gbest303.seq
 499999578     gbest304.seq
 499997985     gbest305.seq
 499998280     gbest306.seq
   8353862     gbest307.seq
 499999018     gbest308.seq
 500000027     gbest309.seq
 499999323     gbest31.seq
 499998037     gbest310.seq
 421707881     gbest311.seq
 499999046     gbest312.seq
 499998115     gbest313.seq
 500000170     gbest314.seq
 496203399     gbest315.seq
 499997885     gbest316.seq
 499997415     gbest317.seq
 468073576     gbest318.seq
 499999035     gbest319.seq
 486210054     gbest32.seq
 499999387     gbest320.seq
 500000238     gbest321.seq
 499998332     gbest322.seq
  39576631     gbest323.seq
 500000256     gbest324.seq
 499998824     gbest325.seq
 499998042     gbest326.seq
 493136865     gbest327.seq
 499998749     gbest328.seq
 499997759     gbest329.seq
 499995690     gbest33.seq
 499999540     gbest330.seq
 499997029     gbest331.seq
  55168282     gbest332.seq
 499999943     gbest333.seq
 499999960     gbest334.seq
 499999212     gbest335.seq
 469196415     gbest336.seq
 499998299     gbest337.seq
 499999395     gbest338.seq
 500000050     gbest339.seq
 499996732     gbest34.seq
 499996328     gbest340.seq
  18908247     gbest341.seq
 499998731     gbest342.seq
 492456938     gbest343.seq
 499997406     gbest344.seq
 499999596     gbest345.seq
 499997440     gbest346.seq
 499998560     gbest347.seq
   6641936     gbest348.seq
 499996833     gbest349.seq
 499998044     gbest35.seq
 499998863     gbest350.seq
 499999607     gbest351.seq
 445263126     gbest352.seq
 499998629     gbest353.seq
 500000207     gbest354.seq
 499999612     gbest355.seq
 387623893     gbest356.seq
 499999012     gbest357.seq
 499996946     gbest358.seq
 499998298     gbest359.seq
 464806987     gbest36.seq
 499999266     gbest360.seq
  23180139     gbest361.seq
 499999026     gbest362.seq
 499999007     gbest363.seq
 499997572     gbest364.seq
 499998287     gbest365.seq
  57753239     gbest366.seq
 166258344     gbest367.seq
 499997707     gbest368.seq
 499998882     gbest369.seq
 500000138     gbest37.seq
 499998160     gbest370.seq
 499999199     gbest371.seq
  86045134     gbest372.seq
 499997252     gbest373.seq
 499998118     gbest374.seq
 499999892     gbest375.seq
 499998855     gbest376.seq
 166666388     gbest377.seq
 499996810     gbest378.seq
 499996558     gbest379.seq
 499997901     gbest38.seq
 499998375     gbest380.seq
 500000151     gbest381.seq
 151580674     gbest382.seq
 499997221     gbest383.seq
 499999329     gbest384.seq
 499997189     gbest385.seq
 497175622     gbest386.seq
 499997498     gbest387.seq
 499997706     gbest388.seq
 499999595     gbest389.seq
 499995956     gbest39.seq
  64691839     gbest390.seq
 499998385     gbest391.seq
 499999008     gbest392.seq
 499996496     gbest393.seq
 499999329     gbest394.seq
  83725933     gbest395.seq
 499996944     gbest396.seq
 499997015     gbest397.seq
 499998040     gbest398.seq
 499999190     gbest399.seq
 434674744     gbest4.seq
 499997019     gbest40.seq
  85820972     gbest400.seq
 499999952     gbest401.seq
 499998092     gbest402.seq
 499999582     gbest403.seq
 499998501     gbest404.seq
  49032427     gbest405.seq
 499998825     gbest406.seq
 499998991     gbest407.seq
 499997959     gbest408.seq
 499998392     gbest409.seq
 191418194     gbest41.seq
  88071166     gbest410.seq
 499999741     gbest411.seq
 499999816     gbest412.seq
 499997061     gbest413.seq
 499995062     gbest414.seq
 125056149     gbest415.seq
 499999918     gbest416.seq
 327382356     gbest417.seq
 499998194     gbest418.seq
 499997992     gbest419.seq
 499997364     gbest42.seq
 499999615     gbest420.seq
 499998742     gbest421.seq
  53760245     gbest422.seq
 499999058     gbest423.seq
 499999991     gbest424.seq
 499995917     gbest425.seq
 410296162     gbest426.seq
 499997260     gbest427.seq
 499999283     gbest428.seq
 335979604     gbest429.seq
 499997237     gbest43.seq
 499999961     gbest430.seq
 499998603     gbest431.seq
 262236278     gbest432.seq
 499998683     gbest433.seq
 499998481     gbest434.seq
 458939684     gbest435.seq
 499997775     gbest436.seq
 499995081     gbest437.seq
 307806619     gbest438.seq
 499996212     gbest439.seq
 499997245     gbest44.seq
 499998800     gbest440.seq
 333974609     gbest441.seq
 499999541     gbest442.seq
 499997289     gbest443.seq
 186040190     gbest444.seq
 500000126     gbest445.seq
 499999505     gbest446.seq
 119005290     gbest447.seq
 499999520     gbest448.seq
 499998155     gbest449.seq
 499996431     gbest45.seq
 142082049     gbest450.seq
 499999879     gbest451.seq
 499998318     gbest452.seq
 146708639     gbest453.seq
 499998626     gbest454.seq
 499999515     gbest455.seq
 499998334     gbest456.seq
 487245752     gbest457.seq
 499999523     gbest458.seq
 499998370     gbest459.seq
 189558363     gbest46.seq
 499998338     gbest460.seq
 499999241     gbest461.seq
  20712668     gbest462.seq
 170019681     gbest463.seq
 499998234     gbest464.seq
 499997948     gbest465.seq
 499996964     gbest466.seq
 499998273     gbest467.seq
  23774165     gbest468.seq
 499999458     gbest469.seq
 499998696     gbest47.seq
 499999208     gbest470.seq
 499999217     gbest471.seq
 499996748     gbest472.seq
  60329890     gbest473.seq
 499997586     gbest474.seq
 499998545     gbest475.seq
 499998359     gbest476.seq
 499999709     gbest477.seq
  58034918     gbest478.seq
 499997930     gbest479.seq
 499999592     gbest48.seq
 499998576     gbest480.seq
 499997495     gbest481.seq
 499999860     gbest482.seq
  38044052     gbest483.seq
 499997371     gbest484.seq
 499997842     gbest485.seq
 499998306     gbest486.seq
 499999718     gbest487.seq
  74307962     gbest488.seq
 499997662     gbest489.seq
 499999914     gbest49.seq
 499998634     gbest490.seq
 499999034     gbest491.seq
 206735348     gbest492.seq
 499996334     gbest493.seq
 499999901     gbest494.seq
 499998543     gbest495.seq
 500000245     gbest496.seq
  89609207     gbest497.seq
 499998125     gbest498.seq
 499998648     gbest499.seq
 499998260     gbest5.seq
 475101060     gbest50.seq
 499997764     gbest500.seq
 499999172     gbest501.seq
  55922028     gbest502.seq
 499994065     gbest503.seq
 499997608     gbest504.seq
 499995938     gbest505.seq
 499998022     gbest506.seq
 143263908     gbest507.seq
 500000142     gbest508.seq
 499998212     gbest509.seq
 499999938     gbest51.seq
 499997968     gbest510.seq
 500000141     gbest511.seq
 142293750     gbest512.seq
 499997833     gbest513.seq
 499999118     gbest514.seq
 499998948     gbest515.seq
 499997283     gbest516.seq
  19853839     gbest517.seq
 174267014     gbest518.seq
 499998386     gbest519.seq
 355996874     gbest52.seq
 499998463     gbest520.seq
  84205820     gbest521.seq
 499997944     gbest522.seq
 499998345     gbest523.seq
  75364218     gbest524.seq
 499999451     gbest525.seq
 499999095     gbest526.seq
 499997474     gbest527.seq
 500000060     gbest528.seq
  99294633     gbest529.seq
 499998564     gbest53.seq
 499999697     gbest530.seq
 499998448     gbest531.seq
 499998269     gbest532.seq
 499999168     gbest533.seq
   8987898     gbest534.seq
 499999430     gbest535.seq
 499999910     gbest536.seq
 499998159     gbest537.seq
 477178951     gbest538.seq
 499998569     gbest539.seq
 499999813     gbest54.seq
 499998537     gbest540.seq
 499998989     gbest541.seq
 413105832     gbest542.seq
 499998900     gbest543.seq
 499999161     gbest544.seq
 499999901     gbest545.seq
 500000090     gbest546.seq
  82655201     gbest547.seq
 499998143     gbest548.seq
 500000169     gbest549.seq
 499997327     gbest55.seq
 499996922     gbest550.seq
 499999225     gbest551.seq
  33923316     gbest552.seq
 499998664     gbest553.seq
 499997885     gbest554.seq
 499997388     gbest555.seq
 500000144     gbest556.seq
  44487956     gbest557.seq
 499998480     gbest558.seq
 499999472     gbest559.seq
 483441547     gbest56.seq
 500000196     gbest560.seq
 500000059     gbest561.seq
   9510056     gbest562.seq
 499998866     gbest563.seq
 499999739     gbest564.seq
 392807354     gbest565.seq
 500000181     gbest566.seq
 499998059     gbest567.seq
 100753733     gbest568.seq
 499998740     gbest569.seq
 499999294     gbest57.seq
 499998391     gbest570.seq
  50311057     gbest571.seq
 499999914     gbest572.seq
 499997175     gbest573.seq
 499998760     gbest574.seq
 254450647     gbest575.seq
 499998367     gbest58.seq
 499998865     gbest59.seq
 499999274     gbest6.seq
 464160111     gbest60.seq
 499999088     gbest61.seq
 499999805     gbest62.seq
 499998802     gbest63.seq
 499998178     gbest64.seq
   6890346     gbest65.seq
 499998120     gbest66.seq
 499997844     gbest67.seq
 499997936     gbest68.seq
 483732096     gbest69.seq
 499996729     gbest7.seq
 500000091     gbest70.seq
 499999026     gbest71.seq
 499997394     gbest72.seq
 499999264     gbest73.seq
   8376991     gbest74.seq
 123216343     gbest75.seq
 499998883     gbest76.seq
 499999229     gbest77.seq
 500000011     gbest78.seq
 499998569     gbest79.seq
 469361585     gbest8.seq
   5383905     gbest80.seq
 499998041     gbest81.seq
 499997417     gbest82.seq
 499996298     gbest83.seq
 499999450     gbest84.seq
  46148169     gbest85.seq
 499997743     gbest86.seq
 499998399     gbest87.seq
 499999378     gbest88.seq
 500000102     gbest89.seq
 499998998     gbest9.seq
  53088986     gbest90.seq
 500000263     gbest91.seq
 499998445     gbest92.seq
 499997919     gbest93.seq
 472062054     gbest94.seq
 500000196     gbest95.seq
 499998270     gbest96.seq
 499998231     gbest97.seq
 498695800     gbest98.seq
  35234983     gbest99.seq
 499998228     gbgss1.seq
  55431063     gbgss10.seq
 499999207     gbgss100.seq
 500000257     gbgss101.seq
 500000134     gbgss102.seq
 468268660     gbgss103.seq
 499996751     gbgss104.seq
 499999692     gbgss105.seq
 499997757     gbgss106.seq
 499998352     gbgss107.seq
  40402012     gbgss108.seq
 499999314     gbgss109.seq
 499999328     gbgss11.seq
 499999661     gbgss110.seq
 499997830     gbgss111.seq
 316916938     gbgss112.seq
 499998412     gbgss113.seq
 499997321     gbgss114.seq
 499999598     gbgss115.seq
 499998006     gbgss116.seq
 104211862     gbgss117.seq
 499998179     gbgss118.seq
 499999367     gbgss119.seq
 499998298     gbgss12.seq
 499997853     gbgss120.seq
 499999736     gbgss121.seq
   6537142     gbgss122.seq
 499998633     gbgss123.seq
 499999968     gbgss124.seq
 499998799     gbgss125.seq
 449734063     gbgss126.seq
 499998381     gbgss127.seq
 499999211     gbgss128.seq
 499997711     gbgss129.seq
 499999246     gbgss13.seq
 499998622     gbgss130.seq
  29785783     gbgss131.seq
 499997877     gbgss132.seq
 209679641     gbgss133.seq
 500000110     gbgss134.seq
 499999602     gbgss135.seq
 499997969     gbgss136.seq
 500000125     gbgss137.seq
  14831686     gbgss138.seq
 499996726     gbgss139.seq
 498664595     gbgss14.seq
 499997951     gbgss140.seq
 499999528     gbgss141.seq
 499997001     gbgss142.seq
  16786266     gbgss143.seq
 499997786     gbgss144.seq
 499996974     gbgss145.seq
 499999546     gbgss146.seq
 499996547     gbgss147.seq
   2045398     gbgss148.seq
 499997382     gbgss149.seq
 499997425     gbgss15.seq
 499998165     gbgss150.seq
 499998480     gbgss151.seq
 499997367     gbgss152.seq
   6835799     gbgss153.seq
 373479550     gbgss154.seq
 499998497     gbgss155.seq
 500000110     gbgss156.seq
 499997282     gbgss157.seq
 452208161     gbgss158.seq
 499999674     gbgss159.seq
 499997738     gbgss16.seq
 499998566     gbgss160.seq
 499998516     gbgss161.seq
 454413234     gbgss162.seq
 499997998     gbgss163.seq
 499999955     gbgss164.seq
 499997965     gbgss165.seq
 456856217     gbgss166.seq
 499997805     gbgss167.seq
 499999559     gbgss168.seq
 499999924     gbgss169.seq
 499999295     gbgss17.seq
 362956480     gbgss170.seq
 499999614     gbgss171.seq
 499997471     gbgss172.seq
 215502537     gbgss173.seq
 499998436     gbgss174.seq
 499998134     gbgss175.seq
  67002892     gbgss176.seq
 499999079     gbgss177.seq
 499999336     gbgss178.seq
 499998518     gbgss179.seq
 480471778     gbgss18.seq
 499999975     gbgss180.seq
  49671428     gbgss181.seq
 500000196     gbgss182.seq
 499999211     gbgss183.seq
 500000209     gbgss184.seq
 499999501     gbgss185.seq
  39656212     gbgss186.seq
 499999015     gbgss187.seq
 499999023     gbgss188.seq
  23241200     gbgss189.seq
 499998975     gbgss19.seq
 499998791     gbgss190.seq
 499996639     gbgss191.seq
 499998774     gbgss192.seq
 495024971     gbgss193.seq
 499999000     gbgss194.seq
 499999717     gbgss195.seq
 499999860     gbgss196.seq
 499999901     gbgss197.seq
  53998378     gbgss198.seq
 499998820     gbgss199.seq
 499999269     gbgss2.seq
 325856321     gbgss20.seq
 499999274     gbgss200.seq
 499997966     gbgss201.seq
 479854442     gbgss202.seq
 499997737     gbgss203.seq
 499997752     gbgss204.seq
  56421213     gbgss205.seq
 499997703     gbgss206.seq
 500000150     gbgss207.seq
 499999163     gbgss208.seq
 481466169     gbgss209.seq
 499999364     gbgss21.seq
 499996771     gbgss210.seq
 499999594     gbgss211.seq
 499999856     gbgss212.seq
 488428954     gbgss213.seq
 499999175     gbgss214.seq
 499999239     gbgss215.seq
 499999176     gbgss216.seq
 467990953     gbgss217.seq
 499999749     gbgss218.seq
 499999749     gbgss219.seq
 499997676     gbgss22.seq
 499997938     gbgss220.seq
   6989681     gbgss221.seq
 499999723     gbgss222.seq
 499999684     gbgss223.seq
 499998774     gbgss224.seq
 264582471     gbgss225.seq
 499998308     gbgss226.seq
 499997919     gbgss227.seq
 499999547     gbgss228.seq
 429737750     gbgss229.seq
 499997001     gbgss23.seq
 499998680     gbgss230.seq
 499997412     gbgss231.seq
 499999464     gbgss232.seq
 468539336     gbgss233.seq
 499999119     gbgss234.seq
 500000083     gbgss235.seq
 499999330     gbgss236.seq
 418145094     gbgss237.seq
 499998654     gbgss238.seq
 499999983     gbgss239.seq
 499999146     gbgss24.seq
 499998793     gbgss240.seq
 499998625     gbgss241.seq
  16537478     gbgss242.seq
 315572447     gbgss243.seq
 499997744     gbgss244.seq
 499999895     gbgss245.seq
 499998432     gbgss246.seq
 467293763     gbgss247.seq
 499998755     gbgss248.seq
 499999780     gbgss249.seq
  47915040     gbgss25.seq
 499999818     gbgss250.seq
 499997858     gbgss251.seq
  36102519     gbgss252.seq
 499998608     gbgss253.seq
 499997686     gbgss254.seq
 499998198     gbgss255.seq
 499999134     gbgss256.seq
  19020583     gbgss257.seq
 499998709     gbgss258.seq
 499997285     gbgss259.seq
 499998203     gbgss26.seq
 499998938     gbgss260.seq
   1409124     gbgss261.seq
 500000216     gbgss262.seq
 499999092     gbgss263.seq
 499998857     gbgss264.seq
 480468608     gbgss265.seq
 499999638     gbgss266.seq
 499998584     gbgss267.seq
 472073119     gbgss268.seq
 499999289     gbgss27.seq
 499999997     gbgss28.seq
 499997737     gbgss29.seq
 499999955     gbgss3.seq
  28368223     gbgss30.seq
 499999620     gbgss31.seq
 499999369     gbgss32.seq
 499997926     gbgss33.seq
 474354474     gbgss34.seq
 499997672     gbgss35.seq
 499999711     gbgss36.seq
 499998458     gbgss37.seq
 499998787     gbgss38.seq
  10244239     gbgss39.seq
 499997976     gbgss4.seq
 499998628     gbgss40.seq
 500000104     gbgss41.seq
 168816398     gbgss42.seq
 499998707     gbgss43.seq
 499999529     gbgss44.seq
 500000062     gbgss45.seq
 487188150     gbgss46.seq
 499997156     gbgss47.seq
 499998418     gbgss48.seq
 500000076     gbgss49.seq
  37756294     gbgss5.seq
 444027250     gbgss50.seq
 499998446     gbgss51.seq
 500000163     gbgss52.seq
 499998853     gbgss53.seq
 420972611     gbgss54.seq
 499998235     gbgss55.seq
 500000088     gbgss56.seq
 500000162     gbgss57.seq
 427769194     gbgss58.seq
  67685650     gbgss59.seq
 499999011     gbgss6.seq
 500000215     gbgss60.seq
 499997984     gbgss61.seq
 500000021     gbgss62.seq
 492676767     gbgss63.seq
 499997513     gbgss64.seq
 500000022     gbgss65.seq
 499999623     gbgss66.seq
 495013992     gbgss67.seq
 499998492     gbgss68.seq
 499999132     gbgss69.seq
 499998063     gbgss7.seq
 499999264     gbgss70.seq
 419358340     gbgss71.seq
 499999747     gbgss72.seq
 499998402     gbgss73.seq
 499998080     gbgss74.seq
  33896316     gbgss75.seq
 499997046     gbgss76.seq
 499999706     gbgss77.seq
 499999836     gbgss78.seq
 490829495     gbgss79.seq
 499998114     gbgss8.seq
 499999758     gbgss80.seq
 499998791     gbgss81.seq
 499998121     gbgss82.seq
 499997910     gbgss83.seq
   6352079     gbgss84.seq
 499998294     gbgss85.seq
 500000122     gbgss86.seq
 499997510     gbgss87.seq
 499999970     gbgss88.seq
  28361625     gbgss89.seq
 499999620     gbgss9.seq
 499998289     gbgss90.seq
 500000231     gbgss91.seq
 499998914     gbgss92.seq
 463167513     gbgss93.seq
 244248654     gbgss94.seq
 499999492     gbgss95.seq
 499998457     gbgss96.seq
 500000176     gbgss97.seq
 499997669     gbgss98.seq
  45242083     gbgss99.seq
 499991077     gbhtc1.seq
 499994049     gbhtc2.seq
 499986002     gbhtc3.seq
 330777725     gbhtc4.seq
 499998312     gbhtc5.seq
 438285059     gbhtc6.seq
 499999221     gbhtc7.seq
 212349974     gbhtc8.seq
 499944811     gbhtg1.seq
 499980257     gbhtg10.seq
 485099546     gbhtg11.seq
 499977093     gbhtg12.seq
 499847932     gbhtg13.seq
 499963690     gbhtg14.seq
 499701367     gbhtg15.seq
 474637756     gbhtg16.seq
 499709316     gbhtg17.seq
 499810399     gbhtg18.seq
 499965464     gbhtg19.seq
 499847283     gbhtg2.seq
 499990521     gbhtg20.seq
 473197896     gbhtg21.seq
 499917570     gbhtg22.seq
 499967580     gbhtg23.seq
 499096826     gbhtg24.seq
 499960078     gbhtg25.seq
 484456052     gbhtg26.seq
 499961890     gbhtg27.seq
 499870377     gbhtg28.seq
 268060905     gbhtg29.seq
 499869170     gbhtg3.seq
 499926304     gbhtg30.seq
 499809717     gbhtg31.seq
 224936220     gbhtg32.seq
 499949654     gbhtg33.seq
 499926474     gbhtg34.seq
 265477168     gbhtg35.seq
 499867371     gbhtg36.seq
 499973632     gbhtg37.seq
 223152909     gbhtg38.seq
 499807323     gbhtg39.seq
 499846457     gbhtg4.seq
 499973486     gbhtg40.seq
 234952784     gbhtg41.seq
 499825428     gbhtg42.seq
 499886028     gbhtg43.seq
 202125596     gbhtg44.seq
 499794710     gbhtg45.seq
 499925955     gbhtg46.seq
 205797151     gbhtg47.seq
 499976374     gbhtg48.seq
 499930130     gbhtg49.seq
 499934498     gbhtg5.seq
 193865027     gbhtg50.seq
 499926863     gbhtg51.seq
 499937126     gbhtg52.seq
 161358165     gbhtg53.seq
 499996939     gbhtg54.seq
 499996869     gbhtg55.seq
 252726190     gbhtg56.seq
 499940545     gbhtg57.seq
 499966721     gbhtg58.seq
 499998091     gbhtg59.seq
    507366     gbhtg6.seq
 167066142     gbhtg60.seq
 499929757     gbhtg61.seq
 499926029     gbhtg62.seq
 499877376     gbhtg63.seq
 468570824     gbhtg64.seq
 499882387     gbhtg65.seq
 499975194     gbhtg66.seq
 499952380     gbhtg67.seq
 499930799     gbhtg68.seq
 499789101     gbhtg69.seq
 499821242     gbhtg7.seq
 417841922     gbhtg70.seq
 499651433     gbhtg71.seq
 499807557     gbhtg72.seq
 385409482     gbhtg73.seq
 499951671     gbhtg74.seq
 499970875     gbhtg75.seq
 383567862     gbhtg76.seq
 499964642     gbhtg77.seq
 499988333     gbhtg78.seq
 499994565     gbhtg79.seq
 499933798     gbhtg8.seq
 499991192     gbhtg80.seq
 499928628     gbhtg81.seq
 274850521     gbhtg82.seq
 499899409     gbhtg9.seq
 499880707     gbinv1.seq
 490451253     gbinv10.seq
 115145969     gbinv100.seq
 499999206     gbinv101.seq
 499999803     gbinv102.seq
 404239341     gbinv103.seq
 499999958     gbinv104.seq
 499997812     gbinv105.seq
 178050011     gbinv106.seq
 499998551     gbinv107.seq
 499997023     gbinv108.seq
 117744879     gbinv109.seq
 491062219     gbinv11.seq
 499997654     gbinv110.seq
 499999777     gbinv111.seq
 148302462     gbinv112.seq
 499997600     gbinv113.seq
 499997696     gbinv114.seq
 156836362     gbinv115.seq
 499997251     gbinv116.seq
 499996972     gbinv117.seq
 193688655     gbinv118.seq
 499997574     gbinv119.seq
 469686844     gbinv12.seq
 499997810     gbinv120.seq
 247191599     gbinv121.seq
 499998414     gbinv122.seq
 499997912     gbinv123.seq
 499999137     gbinv124.seq
 499999146     gbinv125.seq
  25763190     gbinv126.seq
 499998875     gbinv127.seq
 445991559     gbinv128.seq
 288065217     gbinv129.seq
 485523455     gbinv13.seq
  54947887     gbinv130.seq
  52917687     gbinv131.seq
 156817630     gbinv132.seq
 499990822     gbinv133.seq
 266436256     gbinv134.seq
 499998557     gbinv135.seq
 499997694     gbinv136.seq
 172341792     gbinv137.seq
 499362318     gbinv138.seq
 498178006     gbinv139.seq
 174157884     gbinv14.seq
 499656507     gbinv140.seq
 128976204     gbinv141.seq
 496677517     gbinv142.seq
  51960557     gbinv143.seq
 466558064     gbinv144.seq
 479577598     gbinv145.seq
 450564845     gbinv146.seq
 482003105     gbinv147.seq
 121049467     gbinv148.seq
 494590358     gbinv149.seq
 486730694     gbinv15.seq
 499153426     gbinv150.seq
 498623791     gbinv151.seq
  70591482     gbinv152.seq
 872662073     gbinv153.seq
 815663159     gbinv154.seq
 813528097     gbinv155.seq
 780491774     gbinv156.seq
 734904723     gbinv157.seq
 816941878     gbinv158.seq
 452891562     gbinv159.seq
 481403838     gbinv16.seq
 480839037     gbinv160.seq
 375796220     gbinv161.seq
 499932212     gbinv162.seq
 485386314     gbinv163.seq
 485283938     gbinv164.seq
 498294953     gbinv165.seq
 414580638     gbinv166.seq
 498679440     gbinv167.seq
 494998502     gbinv168.seq
 486081098     gbinv169.seq
 492664237     gbinv17.seq
 483986740     gbinv170.seq
 479014607     gbinv171.seq
 377175188     gbinv172.seq
 491311809     gbinv173.seq
 482991950     gbinv174.seq
 495169229     gbinv175.seq
 493741890     gbinv176.seq
 495500028     gbinv177.seq
 371035005     gbinv178.seq
 470288952     gbinv179.seq
 478211801     gbinv18.seq
 496245676     gbinv180.seq
 496281402     gbinv181.seq
 472368883     gbinv182.seq
 493439367     gbinv183.seq
 418565417     gbinv184.seq
 493154076     gbinv185.seq
 491119641     gbinv186.seq
 465656312     gbinv187.seq
 490891118     gbinv188.seq
 459581775     gbinv189.seq
 305989097     gbinv19.seq
 406078142     gbinv190.seq
 476900813     gbinv191.seq
 481842193     gbinv192.seq
 496741571     gbinv193.seq
 492742184     gbinv194.seq
 496271174     gbinv195.seq
 392139815     gbinv196.seq
 496951694     gbinv197.seq
 492317100     gbinv198.seq
 475955596     gbinv199.seq
 455878756     gbinv2.seq
 499447601     gbinv20.seq
 498243704     gbinv200.seq
 496662010     gbinv201.seq
 351267284     gbinv202.seq
 454436392     gbinv203.seq
 490104712     gbinv204.seq
 477768949     gbinv205.seq
 497117087     gbinv206.seq
 273421111     gbinv207.seq
 484546259     gbinv208.seq
 486200140     gbinv209.seq
 331575178     gbinv21.seq
 489013669     gbinv210.seq
 499882158     gbinv211.seq
 389958867     gbinv212.seq
 230763287     gbinv213.seq
 433765668     gbinv214.seq
 341801067     gbinv215.seq
 488708469     gbinv216.seq
 442221959     gbinv217.seq
 499288600     gbinv218.seq
 498804465     gbinv219.seq
 409329256     gbinv22.seq
 192257453     gbinv220.seq
 499997309     gbinv221.seq
 499998394     gbinv222.seq
 273579657     gbinv223.seq
 499999674     gbinv224.seq
 499997840     gbinv225.seq
 201564591     gbinv226.seq
 499999683     gbinv227.seq
 499998555     gbinv228.seq
 260583147     gbinv229.seq
 337324220     gbinv23.seq
 499998424     gbinv230.seq
 499997865     gbinv231.seq
 304255466     gbinv232.seq
 499998594     gbinv233.seq
 499561275     gbinv234.seq
 499882610     gbinv235.seq
 347600469     gbinv236.seq
 499999353     gbinv237.seq
 499954513     gbinv238.seq
 394313230     gbinv239.seq
 416902989     gbinv24.seq
 499999746     gbinv240.seq
 499862404     gbinv241.seq
 499942773     gbinv242.seq
 261894712     gbinv243.seq
 499489044     gbinv244.seq
 499984461     gbinv245.seq
 499999178     gbinv246.seq
 219010924     gbinv247.seq
 499665286     gbinv248.seq
 499954794     gbinv249.seq
 480340526     gbinv25.seq
 499986274     gbinv250.seq
 349517342     gbinv251.seq
 500000137     gbinv252.seq
 499979428     gbinv253.seq
 499915813     gbinv254.seq
 499990759     gbinv255.seq
 499998437     gbinv256.seq
   7826534     gbinv257.seq
 499999636     gbinv258.seq
 499704487     gbinv259.seq
 470719972     gbinv26.seq
 499897338     gbinv260.seq
 499999895     gbinv261.seq
  68002970     gbinv262.seq
 499977802     gbinv263.seq
 499904157     gbinv264.seq
 499970007     gbinv265.seq
 499999529     gbinv266.seq
 499940074     gbinv267.seq
 122380920     gbinv268.seq
 500000224     gbinv269.seq
 478012779     gbinv27.seq
 499999552     gbinv270.seq
 468683478     gbinv271.seq
 499670167     gbinv272.seq
 499934229     gbinv273.seq
 499999149     gbinv274.seq
 480298194     gbinv275.seq
 214609255     gbinv276.seq
 481046566     gbinv277.seq
 450037909     gbinv278.seq
 303709221     gbinv279.seq
 372274412     gbinv28.seq
 293452060     gbinv280.seq
 280090041     gbinv281.seq
 279807726     gbinv282.seq
 274554532     gbinv283.seq
 266890122     gbinv284.seq
 491295946     gbinv285.seq
 418047779     gbinv286.seq
 383074444     gbinv287.seq
 489267373     gbinv288.seq
 393039367     gbinv289.seq
 473605830     gbinv29.seq
 484538369     gbinv290.seq
 482310364     gbinv291.seq
 491415359     gbinv292.seq
 495004950     gbinv293.seq
 483971663     gbinv294.seq
 495670320     gbinv295.seq
  40846857     gbinv296.seq
 492571202     gbinv297.seq
 490206006     gbinv298.seq
 445709424     gbinv299.seq
 499998415     gbinv3.seq
 493702810     gbinv30.seq
 207302902     gbinv300.seq
 370283947     gbinv301.seq
 207800719     gbinv302.seq
 403111025     gbinv303.seq
 496918509     gbinv304.seq
 495981016     gbinv305.seq
 486335901     gbinv306.seq
 491884209     gbinv307.seq
  62681775     gbinv308.seq
 487678296     gbinv309.seq
 499999717     gbinv31.seq
 495933337     gbinv310.seq
 497117994     gbinv311.seq
 485878834     gbinv312.seq
 336958408     gbinv313.seq
 470338855     gbinv314.seq
 473857916     gbinv315.seq
 488417194     gbinv316.seq
 472993064     gbinv317.seq
 444598250     gbinv318.seq
 489105559     gbinv319.seq
 405915277     gbinv32.seq
 489050792     gbinv320.seq
 492903374     gbinv321.seq
 464570821     gbinv322.seq
 389647411     gbinv323.seq
 499023581     gbinv324.seq
 459750793     gbinv325.seq
 457336109     gbinv326.seq
 468059342     gbinv327.seq
 487547225     gbinv328.seq
 494627522     gbinv329.seq
 499996233     gbinv33.seq
 499360640     gbinv330.seq
 425862368     gbinv331.seq
 447701977     gbinv332.seq
 471356977     gbinv333.seq
 106487756     gbinv334.seq
 494431929     gbinv335.seq
 499089492     gbinv336.seq
 174713884     gbinv337.seq
 439432672     gbinv338.seq
 315017082     gbinv339.seq
 405541828     gbinv34.seq
 247279447     gbinv340.seq
 493106968     gbinv341.seq
 482399453     gbinv342.seq
 487563600     gbinv343.seq
 495044965     gbinv344.seq
 345414487     gbinv345.seq
 499129683     gbinv346.seq
 496482189     gbinv347.seq
 369581275     gbinv348.seq
 456144815     gbinv349.seq
 497340659     gbinv35.seq
 200284825     gbinv350.seq
 495152558     gbinv351.seq
 341654330     gbinv352.seq
 336683654     gbinv353.seq
 493060580     gbinv354.seq
 107491235     gbinv355.seq
 487968866     gbinv356.seq
 495757046     gbinv357.seq
 481723089     gbinv358.seq
 326169629     gbinv359.seq
 491593012     gbinv36.seq
 485886250     gbinv360.seq
 492815904     gbinv361.seq
 471307712     gbinv362.seq
 311911756     gbinv363.seq
 499380148     gbinv364.seq
 482083381     gbinv365.seq
 479658829     gbinv366.seq
 363341552     gbinv367.seq
 489703355     gbinv368.seq
 499514774     gbinv369.seq
 468886272     gbinv37.seq
 496438512     gbinv370.seq
 492572846     gbinv371.seq
 486825768     gbinv372.seq
 496096827     gbinv373.seq
 476044151     gbinv374.seq
 496125908     gbinv375.seq
 481981378     gbinv376.seq
 343407139     gbinv377.seq
 493089306     gbinv378.seq
 490891004     gbinv379.seq
 480484367     gbinv38.seq
 498098866     gbinv380.seq
 498384023     gbinv381.seq
 493309215     gbinv382.seq
 324291471     gbinv383.seq
 484493924     gbinv384.seq
 491069771     gbinv385.seq
 494055574     gbinv386.seq
 235593723     gbinv387.seq
 319983008     gbinv388.seq
 484241023     gbinv389.seq
  96954549     gbinv39.seq
 216170369     gbinv390.seq
 218804026     gbinv391.seq
 336455655     gbinv392.seq
 297857601     gbinv393.seq
 477593708     gbinv394.seq
 493171167     gbinv395.seq
  96653657     gbinv396.seq
 401450903     gbinv397.seq
 471214414     gbinv398.seq
 478230772     gbinv399.seq
 499626788     gbinv4.seq
 495716316     gbinv40.seq
 481551037     gbinv400.seq
 119372855     gbinv401.seq
 489114034     gbinv402.seq
 418973715     gbinv403.seq
 492116480     gbinv404.seq
 488062801     gbinv405.seq
  86400276     gbinv406.seq
 475977144     gbinv407.seq
 479023212     gbinv408.seq
  91925882     gbinv409.seq
 459725126     gbinv41.seq
 498866242     gbinv410.seq
 475446584     gbinv411.seq
 492109157     gbinv412.seq
 493644048     gbinv413.seq
 450867996     gbinv414.seq
 491756525     gbinv415.seq
  84743944     gbinv416.seq
 423731956     gbinv417.seq
 344359358     gbinv418.seq
 487661322     gbinv419.seq
 481987024     gbinv42.seq
 481796231     gbinv420.seq
 419437489     gbinv421.seq
 447480354     gbinv422.seq
 458542150     gbinv423.seq
  84187054     gbinv424.seq
 476248749     gbinv425.seq
 482272438     gbinv426.seq
 498234741     gbinv427.seq
 471043224     gbinv428.seq
 136592520     gbinv429.seq
 494130818     gbinv43.seq
 495120952     gbinv430.seq
 498047113     gbinv431.seq
 493290837     gbinv432.seq
 467611623     gbinv433.seq
 464868282     gbinv434.seq
 485103437     gbinv435.seq
  70626150     gbinv436.seq
 444903948     gbinv437.seq
 457689916     gbinv438.seq
 485060215     gbinv439.seq
 170883604     gbinv44.seq
 496105931     gbinv440.seq
 398887277     gbinv441.seq
 496315211     gbinv442.seq
 400751741     gbinv443.seq
 420887834     gbinv444.seq
 466152865     gbinv445.seq
 492916768     gbinv446.seq
 342221593     gbinv447.seq
 352563736     gbinv448.seq
 348693377     gbinv449.seq
 473738127     gbinv45.seq
 456059312     gbinv450.seq
 497847487     gbinv451.seq
 449319091     gbinv452.seq
 468637853     gbinv453.seq
 432080041     gbinv454.seq
 138509644     gbinv455.seq
 496695255     gbinv456.seq
 499723939     gbinv457.seq
 479047519     gbinv458.seq
 257796371     gbinv459.seq
 489724528     gbinv46.seq
 471704294     gbinv460.seq
 487451682     gbinv461.seq
 493364736     gbinv462.seq
 493281122     gbinv463.seq
  53047956     gbinv464.seq
 463724029     gbinv465.seq
 481227277     gbinv466.seq
 489522151     gbinv467.seq
 482555865     gbinv468.seq
 489387386     gbinv469.seq
 481853019     gbinv47.seq
  27439657     gbinv470.seq
 147311081     gbinv471.seq
 520668510     gbinv472.seq
 439679373     gbinv473.seq
  76608705     gbinv474.seq
 544459462     gbinv475.seq
 291577871     gbinv476.seq
 499183575     gbinv477.seq
 449457164     gbinv478.seq
 403099826     gbinv479.seq
 480574803     gbinv48.seq
 271693871     gbinv480.seq
 483667272     gbinv481.seq
 455324853     gbinv482.seq
 403535389     gbinv483.seq
 351018811     gbinv484.seq
 490437627     gbinv485.seq
 445804754     gbinv486.seq
 462949261     gbinv487.seq
 398542703     gbinv488.seq
 175801402     gbinv49.seq
 185159259     gbinv5.seq
 495890984     gbinv50.seq
 496714825     gbinv51.seq
 484081852     gbinv52.seq
 472135201     gbinv53.seq
 487970520     gbinv54.seq
 473212643     gbinv55.seq
 119585423     gbinv56.seq
 483414567     gbinv57.seq
 490353662     gbinv58.seq
 487639364     gbinv59.seq
 496832638     gbinv6.seq
 482729413     gbinv60.seq
 499999387     gbinv61.seq
 420556238     gbinv62.seq
 485074020     gbinv63.seq
 497628765     gbinv64.seq
 492273364     gbinv65.seq
 493650304     gbinv66.seq
 319407791     gbinv67.seq
 495477837     gbinv68.seq
 496723738     gbinv69.seq
 476450800     gbinv7.seq
 492757167     gbinv70.seq
 483897094     gbinv71.seq
 478248908     gbinv72.seq
 492778641     gbinv73.seq
 499970626     gbinv74.seq
 498315478     gbinv75.seq
 483551082     gbinv76.seq
 444438685     gbinv77.seq
 483768717     gbinv78.seq
 493574813     gbinv79.seq
 422530821     gbinv8.seq
 498159916     gbinv80.seq
 461241054     gbinv81.seq
 429126368     gbinv82.seq
 472254386     gbinv83.seq
 487381580     gbinv84.seq
 488615859     gbinv85.seq
 492386441     gbinv86.seq
 410012641     gbinv87.seq
 489753781     gbinv88.seq
 486903937     gbinv89.seq
 173964300     gbinv9.seq
 475269344     gbinv90.seq
 499301158     gbinv91.seq
 356776193     gbinv92.seq
 461767421     gbinv93.seq
 479421334     gbinv94.seq
 494639844     gbinv95.seq
 328489972     gbinv96.seq
 484117250     gbinv97.seq
 500000264     gbinv98.seq
 499999605     gbinv99.seq
 499998322     gbmam1.seq
  82812908     gbmam10.seq
 483844712     gbmam100.seq
 437064425     gbmam101.seq
 223540742     gbmam102.seq
 451994163     gbmam103.seq
 449442494     gbmam104.seq
 428335431     gbmam105.seq
 499998224     gbmam106.seq
 293855685     gbmam107.seq
 227944315     gbmam108.seq
 348089742     gbmam109.seq
  71296609     gbmam11.seq
 373183698     gbmam110.seq
 467160879     gbmam111.seq
 457054238     gbmam112.seq
 483676806     gbmam113.seq
 409916232     gbmam114.seq
 398303012     gbmam115.seq
 372869811     gbmam116.seq
  22570876     gbmam12.seq
   1268606     gbmam13.seq
 378312073     gbmam14.seq
 338653931     gbmam15.seq
 477859990     gbmam16.seq
 445458574     gbmam17.seq
 122412955     gbmam18.seq
 451114203     gbmam19.seq
 399237917     gbmam2.seq
 418062948     gbmam20.seq
 499818197     gbmam21.seq
 462376363     gbmam22.seq
 370510653     gbmam23.seq
 446296425     gbmam24.seq
 431104447     gbmam25.seq
 480602957     gbmam26.seq
 479109873     gbmam27.seq
 483903297     gbmam28.seq
 483307008     gbmam29.seq
 400559326     gbmam3.seq
  48405032     gbmam30.seq
 363174382     gbmam31.seq
 437246747     gbmam32.seq
 470828962     gbmam33.seq
 402408906     gbmam34.seq
 304109928     gbmam35.seq
 452443739     gbmam36.seq
 451303958     gbmam37.seq
 495648598     gbmam38.seq
 405636626     gbmam39.seq
 477148353     gbmam4.seq
 410457734     gbmam40.seq
 441553748     gbmam41.seq
 367146984     gbmam42.seq
 478421809     gbmam43.seq
 316388332     gbmam44.seq
 352226884     gbmam45.seq
 195247700     gbmam46.seq
 474022452     gbmam47.seq
 378020853     gbmam48.seq
 450136561     gbmam49.seq
 374653134     gbmam5.seq
 450750944     gbmam50.seq
 468132660     gbmam51.seq
 374896622     gbmam52.seq
   9943517     gbmam53.seq
  43989127     gbmam54.seq
  91322474     gbmam55.seq
  88811458     gbmam56.seq
   6364730     gbmam57.seq
  20918116     gbmam58.seq
 449535581     gbmam59.seq
 487713568     gbmam6.seq
 423431384     gbmam60.seq
 453840584     gbmam61.seq
 491149506     gbmam62.seq
 425479852     gbmam63.seq
 461110029     gbmam64.seq
 385606603     gbmam65.seq
 489901313     gbmam66.seq
 500000153     gbmam67.seq
 499998574     gbmam68.seq
  18110602     gbmam69.seq
 401181424     gbmam7.seq
 907465328     gbmam70.seq
 839494897     gbmam71.seq
 774395849     gbmam72.seq
 588873740     gbmam73.seq
 364960392     gbmam74.seq
 428298067     gbmam75.seq
 283039896     gbmam76.seq
 266822121     gbmam77.seq
 255007049     gbmam78.seq
 250435254     gbmam79.seq
 435129139     gbmam8.seq
 405637142     gbmam80.seq
 372091504     gbmam81.seq
 465555603     gbmam82.seq
 444923782     gbmam83.seq
 341578443     gbmam84.seq
 257946240     gbmam85.seq
 485829704     gbmam86.seq
 486026993     gbmam87.seq
 483298905     gbmam88.seq
 494677523     gbmam89.seq
 275778915     gbmam9.seq
 335874920     gbmam90.seq
 464872853     gbmam91.seq
 468294587     gbmam92.seq
 497569809     gbmam93.seq
 377746247     gbmam94.seq
 460747191     gbmam95.seq
 150130543     gbmam96.seq
 416665240     gbmam97.seq
 456214449     gbmam98.seq
 486132452     gbmam99.seq
  14827412     gbnew.txt
 499998732     gbpat1.seq
 499999978     gbpat10.seq
 499999036     gbpat100.seq
 499999497     gbpat101.seq
 499997525     gbpat102.seq
 228719622     gbpat103.seq
 500000251     gbpat104.seq
 500000174     gbpat105.seq
 499999692     gbpat106.seq
 335264573     gbpat107.seq
 499999820     gbpat108.seq
 499999072     gbpat109.seq
 499997609     gbpat11.seq
 208457456     gbpat110.seq
 499900254     gbpat111.seq
 499999229     gbpat112.seq
 174097043     gbpat113.seq
 499998627     gbpat114.seq
 499999833     gbpat115.seq
 499997514     gbpat116.seq
   8676660     gbpat117.seq
 499714821     gbpat118.seq
 382785466     gbpat119.seq
 179179865     gbpat12.seq
 499997546     gbpat120.seq
 499993593     gbpat121.seq
 499992686     gbpat122.seq
 499998948     gbpat123.seq
  56313272     gbpat124.seq
 499968107     gbpat125.seq
 499999013     gbpat126.seq
 208432510     gbpat127.seq
 499999682     gbpat128.seq
 499999422     gbpat129.seq
 499890454     gbpat13.seq
  57407725     gbpat130.seq
 499995995     gbpat131.seq
 499998350     gbpat132.seq
 487411977     gbpat133.seq
 499998022     gbpat134.seq
 499999903     gbpat135.seq
  26312251     gbpat136.seq
 499991578     gbpat137.seq
 385133713     gbpat138.seq
 499999560     gbpat139.seq
 499999507     gbpat14.seq
 500000185     gbpat140.seq
 148486212     gbpat141.seq
 499997120     gbpat142.seq
 314466624     gbpat143.seq
 499988381     gbpat144.seq
 499980283     gbpat145.seq
 409538104     gbpat146.seq
 500000154     gbpat147.seq
 499998659     gbpat148.seq
 125951906     gbpat149.seq
  62654372     gbpat15.seq
 499989559     gbpat150.seq
 499997429     gbpat151.seq
 499998857     gbpat152.seq
 499997730     gbpat153.seq
 169831142     gbpat154.seq
 499999814     gbpat155.seq
 425323705     gbpat156.seq
 500000181     gbpat157.seq
 499999447     gbpat158.seq
 499887403     gbpat159.seq
 499998478     gbpat16.seq
 353520266     gbpat160.seq
 499998082     gbpat161.seq
 499999221     gbpat162.seq
 289629964     gbpat163.seq
 500000122     gbpat164.seq
 499999577     gbpat165.seq
 499999216     gbpat166.seq
 101539058     gbpat167.seq
 499995055     gbpat168.seq
 499997500     gbpat169.seq
 499996492     gbpat17.seq
 499998487     gbpat170.seq
 499998725     gbpat171.seq
 301680889     gbpat172.seq
 499979742     gbpat173.seq
 499998096     gbpat174.seq
 499999222     gbpat175.seq
 318462021     gbpat176.seq
 499602355     gbpat177.seq
 499999188     gbpat178.seq
 499999721     gbpat179.seq
 421939701     gbpat18.seq
  13196841     gbpat180.seq
 497266589     gbpat181.seq
 499998196     gbpat182.seq
 499999181     gbpat183.seq
  86829619     gbpat184.seq
 499924221     gbpat185.seq
 499999973     gbpat186.seq
 499996803     gbpat187.seq
  39745949     gbpat188.seq
 499255855     gbpat189.seq
 499854754     gbpat19.seq
 499999098     gbpat190.seq
 499998936     gbpat191.seq
 499999609     gbpat192.seq
  96568026     gbpat193.seq
 499880815     gbpat194.seq
 499997596     gbpat195.seq
 499999338     gbpat196.seq
 499999435     gbpat197.seq
  90172354     gbpat198.seq
 499993364     gbpat199.seq
 499999508     gbpat2.seq
 499999355     gbpat20.seq
 499994277     gbpat200.seq
 499998512     gbpat201.seq
 499999457     gbpat202.seq
   4092526     gbpat203.seq
 499999756     gbpat204.seq
 499999459     gbpat205.seq
 500000244     gbpat206.seq
 478202129     gbpat207.seq
 500000054     gbpat208.seq
 499999577     gbpat209.seq
 499993518     gbpat21.seq
 321705067     gbpat210.seq
 499991396     gbpat211.seq
 499963719     gbpat212.seq
 350635988     gbpat213.seq
 497506292     gbpat214.seq
 499869540     gbpat215.seq
 421452571     gbpat216.seq
 499425936     gbpat217.seq
 499999361     gbpat218.seq
 336263474     gbpat219.seq
 347594114     gbpat22.seq
 499998549     gbpat220.seq
 500000252     gbpat221.seq
 499999872     gbpat222.seq
 361399369     gbpat223.seq
 499999662     gbpat224.seq
 494515367     gbpat225.seq
 341868206     gbpat226.seq
 499999744     gbpat227.seq
 500000159     gbpat228.seq
 366896749     gbpat229.seq
 499885517     gbpat23.seq
 499999946     gbpat230.seq
 499335751     gbpat231.seq
 500000109     gbpat232.seq
 499999394     gbpat233.seq
 431464810     gbpat234.seq
 499998936     gbpat235.seq
 499999784     gbpat236.seq
 500000182     gbpat237.seq
 202199010     gbpat238.seq
 499999639     gbpat239.seq
 499998943     gbpat24.seq
 499997091     gbpat240.seq
 499999375     gbpat241.seq
 187729792     gbpat242.seq
 500000259     gbpat243.seq
 499999167     gbpat244.seq
 499999565     gbpat245.seq
 230892338     gbpat246.seq
 499937872     gbpat25.seq
 499998992     gbpat26.seq
 165910801     gbpat27.seq
 499998849     gbpat28.seq
 500000116     gbpat29.seq
  61226468     gbpat3.seq
 213213665     gbpat30.seq
 499999775     gbpat31.seq
 406025343     gbpat32.seq
 499999254     gbpat33.seq
 499999573     gbpat34.seq
 125459610     gbpat35.seq
 499999299     gbpat36.seq
 499999218     gbpat37.seq
 499999820     gbpat38.seq
 140143821     gbpat39.seq
 499999168     gbpat4.seq
 499998922     gbpat40.seq
 493972390     gbpat41.seq
 494767350     gbpat42.seq
 499999240     gbpat43.seq
 149226143     gbpat44.seq
 499999126     gbpat45.seq
 499999712     gbpat46.seq
 499999392     gbpat47.seq
  87832912     gbpat48.seq
 500000091     gbpat49.seq
 499999485     gbpat5.seq
 499999407     gbpat50.seq
 499999448     gbpat51.seq
 130944871     gbpat52.seq
 499999366     gbpat53.seq
 499999084     gbpat54.seq
 184982482     gbpat55.seq
 499999726     gbpat56.seq
 499999154     gbpat57.seq
 137265710     gbpat58.seq
 499998902     gbpat59.seq
 418811190     gbpat6.seq
 499638184     gbpat60.seq
 429853201     gbpat61.seq
 500000010     gbpat62.seq
 320987218     gbpat63.seq
 499999504     gbpat64.seq
 499999404     gbpat65.seq
 306086270     gbpat66.seq
 499999595     gbpat67.seq
 499997159     gbpat68.seq
 144919043     gbpat69.seq
 499999792     gbpat7.seq
 499999495     gbpat70.seq
 226235202     gbpat71.seq
 499942763     gbpat72.seq
 500000257     gbpat73.seq
 309555677     gbpat74.seq
 499990988     gbpat75.seq
 499996904     gbpat76.seq
 259606120     gbpat77.seq
 499998418     gbpat78.seq
 499997914     gbpat79.seq
 499997736     gbpat8.seq
  36785301     gbpat80.seq
 500000256     gbpat81.seq
 474123180     gbpat82.seq
 499999640     gbpat83.seq
 331587271     gbpat84.seq
 499998563     gbpat85.seq
 312117887     gbpat86.seq
 499997179     gbpat87.seq
 500000026     gbpat88.seq
 499999148     gbpat89.seq
 317219149     gbpat9.seq
 203786211     gbpat90.seq
 499999444     gbpat91.seq
 455869832     gbpat92.seq
 499991359     gbpat93.seq
 252194068     gbpat94.seq
 499999504     gbpat95.seq
 499997795     gbpat96.seq
  82098506     gbpat97.seq
 499999689     gbpat98.seq
 498236426     gbpat99.seq
 499894748     gbphg1.seq
 499942690     gbphg2.seq
 499860692     gbphg3.seq
 499880587     gbphg4.seq
 339821194     gbphg5.seq
 499998607     gbpln1.seq
 268695070     gbpln10.seq
 498973363     gbpln100.seq
 472540038     gbpln101.seq
 453105795     gbpln102.seq
 445429529     gbpln103.seq
 387853287     gbpln104.seq
 496158394     gbpln105.seq
 499810291     gbpln106.seq
 499842026     gbpln107.seq
 278684203     gbpln108.seq
 489314534     gbpln109.seq
 499952364     gbpln11.seq
 493772547     gbpln110.seq
 474363642     gbpln111.seq
 394943731     gbpln112.seq
 497796041     gbpln113.seq
 494269245     gbpln114.seq
 496116243     gbpln115.seq
 493550841     gbpln116.seq
 473105851     gbpln117.seq
     86418     gbpln118.seq
    361751     gbpln119.seq
 498196679     gbpln12.seq
 164966386     gbpln120.seq
  40081561     gbpln121.seq
  74904960     gbpln122.seq
 499998623     gbpln123.seq
 357347552     gbpln124.seq
 499998596     gbpln125.seq
 499997982     gbpln126.seq
 141165331     gbpln127.seq
 499807404     gbpln128.seq
 499315505     gbpln129.seq
 469955571     gbpln13.seq
 499989783     gbpln130.seq
 287432314     gbpln131.seq
 298429060     gbpln132.seq
 211261295     gbpln133.seq
 248512222     gbpln134.seq
 185645629     gbpln135.seq
 997331398     gbpln136.seq
  56506409     gbpln137.seq
 487346953     gbpln138.seq
 473525516     gbpln139.seq
 170594776     gbpln14.seq
 473209377     gbpln140.seq
 467870557     gbpln141.seq
 168324921     gbpln142.seq
 441980926     gbpln143.seq
 460425795     gbpln144.seq
 479222672     gbpln145.seq
  92564056     gbpln146.seq
 609356119     gbpln147.seq
 786074578     gbpln148.seq
 733167229     gbpln149.seq
 496172088     gbpln15.seq
 736239733     gbpln150.seq
 691575746     gbpln151.seq
 660133963     gbpln152.seq
 739031764     gbpln153.seq
 457967090     gbpln154.seq
 424903730     gbpln155.seq
 500000104     gbpln156.seq
  63765091     gbpln157.seq
 499999738     gbpln158.seq
 499997703     gbpln159.seq
 478225377     gbpln16.seq
 269616400     gbpln160.seq
 499998927     gbpln161.seq
 499998158     gbpln162.seq
  90514321     gbpln163.seq
 499999729     gbpln164.seq
 479226040     gbpln165.seq
 499998298     gbpln166.seq
 419086673     gbpln167.seq
 499996747     gbpln168.seq
 388260322     gbpln169.seq
 335223965     gbpln17.seq
 499998202     gbpln170.seq
 499999470     gbpln171.seq
 499997273     gbpln172.seq
  67203680     gbpln173.seq
 499997589     gbpln174.seq
 500000027     gbpln175.seq
 420992329     gbpln176.seq
 499823936     gbpln177.seq
 499591755     gbpln178.seq
 499542824     gbpln179.seq
 418823303     gbpln18.seq
 280581486     gbpln180.seq
 499803964     gbpln181.seq
 491537745     gbpln182.seq
 402785639     gbpln183.seq
 445924319     gbpln184.seq
 499804565     gbpln185.seq
   5557296     gbpln186.seq
 492236492     gbpln187.seq
 226945063     gbpln188.seq
 315788495     gbpln189.seq
 499938071     gbpln19.seq
 665291577     gbpln190.seq
 860028189     gbpln191.seq
 800605872     gbpln192.seq
 794469115     gbpln193.seq
 762933697     gbpln194.seq
 729969959     gbpln195.seq
 808217924     gbpln196.seq
 209362038     gbpln197.seq
 924325157     gbpln198.seq
1201978654     gbpln199.seq
 499855105     gbpln2.seq
 175833299     gbpln20.seq
1227268207     gbpln200.seq
1152253241     gbpln201.seq
1115248374     gbpln202.seq
1125506105     gbpln203.seq
1145303472     gbpln204.seq
 695608615     gbpln205.seq
 494723065     gbpln206.seq
 460644363     gbpln207.seq
 152680390     gbpln208.seq
 463010270     gbpln209.seq
 345816360     gbpln21.seq
 480459234     gbpln210.seq
 494737040     gbpln211.seq
 446440740     gbpln212.seq
 417743779     gbpln213.seq
 250838119     gbpln214.seq
 364689197     gbpln215.seq
 339196729     gbpln216.seq
 386320509     gbpln217.seq
 311828079     gbpln218.seq
 213907446     gbpln219.seq
 384509785     gbpln22.seq
 547058897     gbpln220.seq
 117077133     gbpln221.seq
 485280656     gbpln222.seq
 153216335     gbpln223.seq
 689933987     gbpln224.seq
 887561680     gbpln225.seq
 834970472     gbpln226.seq
 826391913     gbpln227.seq
 792513917     gbpln228.seq
 743209872     gbpln229.seq
 204428670     gbpln23.seq
 833073712     gbpln230.seq
    564051     gbpln231.seq
 665291577     gbpln232.seq
 860028189     gbpln233.seq
 800605872     gbpln234.seq
 794469115     gbpln235.seq
 762933697     gbpln236.seq
 729969959     gbpln237.seq
 808217924     gbpln238.seq
 189117573     gbpln239.seq
  84883532     gbpln24.seq
 663098252     gbpln240.seq
 855592604     gbpln241.seq
 807031053     gbpln242.seq
 793905039     gbpln243.seq
 773303164     gbpln244.seq
 718153248     gbpln245.seq
 804870210     gbpln246.seq
 661762125     gbpln247.seq
 840180304     gbpln248.seq
 796430245     gbpln249.seq
 477735094     gbpln25.seq
 779180715     gbpln250.seq
 761224530     gbpln251.seq
 725380245     gbpln252.seq
 792983451     gbpln253.seq
 652402241     gbpln254.seq
 831209396     gbpln255.seq
 783682955     gbpln256.seq
 775938782     gbpln257.seq
 741958804     gbpln258.seq
 700440901     gbpln259.seq
 499901688     gbpln26.seq
 788705159     gbpln260.seq
 683172189     gbpln261.seq
 854365289     gbpln262.seq
 802776370     gbpln263.seq
 793295936     gbpln264.seq
 769246264     gbpln265.seq
 710912943     gbpln266.seq
 799876839     gbpln267.seq
 635039454     gbpln268.seq
 824184474     gbpln269.seq
 498817745     gbpln27.seq
 768070182     gbpln270.seq
 758956882     gbpln271.seq
 732189331     gbpln272.seq
 706311232     gbpln273.seq
 766293442     gbpln274.seq
 651415133     gbpln275.seq
 830082304     gbpln276.seq
 783385752     gbpln277.seq
 770520351     gbpln278.seq
 753421970     gbpln279.seq
 323729344     gbpln28.seq
 699441547     gbpln280.seq
 784443196     gbpln281.seq
 702337808     gbpln282.seq
 906907390     gbpln283.seq
 844110716     gbpln284.seq
 841780855     gbpln285.seq
 805270043     gbpln286.seq
 764396863     gbpln287.seq
 841492595     gbpln288.seq
 714482811     gbpln289.seq
 499081327     gbpln29.seq
 916127997     gbpln290.seq
 858459407     gbpln291.seq
 848936990     gbpln292.seq
 813129213     gbpln293.seq
 765593150     gbpln294.seq
 862731158     gbpln295.seq
 665885340     gbpln296.seq
 629668050     gbpln297.seq
 814320946     gbpln298.seq
 759349720     gbpln299.seq
 499871755     gbpln3.seq
 497391978     gbpln30.seq
 762512207     gbpln300.seq
 724647884     gbpln301.seq
 679679449     gbpln302.seq
 784312844     gbpln303.seq
 684180819     gbpln304.seq
 873292213     gbpln305.seq
 827422505     gbpln306.seq
 815925825     gbpln307.seq
 779009585     gbpln308.seq
 739747654     gbpln309.seq
 499424594     gbpln31.seq
 834950434     gbpln310.seq
 663096073     gbpln311.seq
 849628701     gbpln312.seq
 803882830     gbpln313.seq
 794420470     gbpln314.seq
 760127459     gbpln315.seq
 714663802     gbpln316.seq
 801095950     gbpln317.seq
 668869887     gbpln318.seq
 854770002     gbpln319.seq
 103293547     gbpln32.seq
 805931576     gbpln320.seq
 798923954     gbpln321.seq
 766411223     gbpln322.seq
 723133936     gbpln323.seq
 803351408     gbpln324.seq
 664176987     gbpln325.seq
 854339916     gbpln326.seq
 803900400     gbpln327.seq
 791449620     gbpln328.seq
 761145205     gbpln329.seq
 496565850     gbpln33.seq
 715062603     gbpln330.seq
 806379176     gbpln331.seq
 668964953     gbpln332.seq
 870939392     gbpln333.seq
 809408813     gbpln334.seq
 801514137     gbpln335.seq
 768794024     gbpln336.seq
 723644689     gbpln337.seq
 815153418     gbpln338.seq
 661177159     gbpln339.seq
 498203430     gbpln34.seq
 846934671     gbpln340.seq
 794708793     gbpln341.seq
 789781753     gbpln342.seq
 764576068     gbpln343.seq
 711115451     gbpln344.seq
 797517245     gbpln345.seq
 691953899     gbpln346.seq
 888406351     gbpln347.seq
 835271741     gbpln348.seq
 823533989     gbpln349.seq
 349198346     gbpln35.seq
 787819193     gbpln350.seq
 748786657     gbpln351.seq
 838184652     gbpln352.seq
 488783635     gbpln353.seq
 439661491     gbpln354.seq
 155752105     gbpln355.seq
 758806100     gbpln356.seq
 898446949     gbpln357.seq
 628489896     gbpln358.seq
1024113089     gbpln359.seq
 454048044     gbpln36.seq
1032878661     gbpln360.seq
 858694781     gbpln361.seq
 960391204     gbpln362.seq
1090094606     gbpln363.seq
 781959143     gbpln364.seq
 946995961     gbpln365.seq
 857542781     gbpln366.seq
 656405285     gbpln367.seq
 907889097     gbpln368.seq
 896386890     gbpln369.seq
 495221716     gbpln37.seq
 726432335     gbpln370.seq
 798296822     gbpln371.seq
 918393750     gbpln372.seq
 584961784     gbpln373.seq
 948865971     gbpln374.seq
 954536271     gbpln375.seq
 819735731     gbpln376.seq
 756588093     gbpln377.seq
 876067119     gbpln378.seq
 625446321     gbpln379.seq
 382012980     gbpln38.seq
 977801494     gbpln380.seq
 854357980     gbpln381.seq
 807732556     gbpln382.seq
 947696453     gbpln383.seq
1067629605     gbpln384.seq
 822222048     gbpln385.seq
 950272996     gbpln386.seq
 845138843     gbpln387.seq
 643846993     gbpln388.seq
 894745096     gbpln389.seq
 498975616     gbpln39.seq
 893352134     gbpln390.seq
 722578984     gbpln391.seq
 776227316     gbpln392.seq
 899750467     gbpln393.seq
 592059964     gbpln394.seq
 933986451     gbpln395.seq
 939527664     gbpln396.seq
 810117922     gbpln397.seq
 765938558     gbpln398.seq
 886537018     gbpln399.seq
 499996171     gbpln4.seq
 472855786     gbpln40.seq
 623519964     gbpln400.seq
 996940649     gbpln401.seq
1030190034     gbpln402.seq
 832828033     gbpln403.seq
 956342979     gbpln404.seq
1134286144     gbpln405.seq
 790513299     gbpln406.seq
 944161893     gbpln407.seq
 860035788     gbpln408.seq
 647268685     gbpln409.seq
 496785962     gbpln41.seq
 902239623     gbpln410.seq
 611029440     gbpln411.seq
 734907577     gbpln412.seq
 787834228     gbpln413.seq
 910724363     gbpln414.seq
 606016896     gbpln415.seq
 961485234     gbpln416.seq
1242775191     gbpln417.seq
 816670128     gbpln418.seq
 636658925     gbpln419.seq
 429867937     gbpln42.seq
 818591771     gbpln420.seq
 766580884     gbpln421.seq
 752100829     gbpln422.seq
 724519993     gbpln423.seq
 690955648     gbpln424.seq
 769738288     gbpln425.seq
 750738544     gbpln426.seq
 872184389     gbpln427.seq
 624480879     gbpln428.seq
 995069022     gbpln429.seq
 478648725     gbpln43.seq
1012956234     gbpln430.seq
 827074347     gbpln431.seq
 940621783     gbpln432.seq
1079418810     gbpln433.seq
 776922106     gbpln434.seq
 938380968     gbpln435.seq
 848757671     gbpln436.seq
 643572913     gbpln437.seq
 891714442     gbpln438.seq
 878638403     gbpln439.seq
  83738349     gbpln44.seq
 721632671     gbpln440.seq
 779156122     gbpln441.seq
 895553446     gbpln442.seq
 604678568     gbpln443.seq
 931006295     gbpln444.seq
 933660027     gbpln445.seq
 810459540     gbpln446.seq
 761872100     gbpln447.seq
 878702815     gbpln448.seq
 627081460     gbpln449.seq
 494333229     gbpln45.seq
 994320235     gbpln450.seq
 999434327     gbpln451.seq
 823789349     gbpln452.seq
 945629782     gbpln453.seq
1062113821     gbpln454.seq
 792298939     gbpln455.seq
 941851700     gbpln456.seq
 850142413     gbpln457.seq
 656955691     gbpln458.seq
 904094753     gbpln459.seq
 475215142     gbpln46.seq
 900193903     gbpln460.seq
 728906821     gbpln461.seq
 741172650     gbpln462.seq
 898719079     gbpln463.seq
 599002526     gbpln464.seq
 937117048     gbpln465.seq
 936021119     gbpln466.seq
 812696702     gbpln467.seq
 746628212     gbpln468.seq
 897168807     gbpln469.seq
 468208544     gbpln47.seq
 626698501     gbpln470.seq
1007072101     gbpln471.seq
1000831797     gbpln472.seq
 841918855     gbpln473.seq
 963426816     gbpln474.seq
1093654114     gbpln475.seq
 791118382     gbpln476.seq
 959940756     gbpln477.seq
 853263842     gbpln478.seq
 648051398     gbpln479.seq
 486857567     gbpln48.seq
 901282075     gbpln480.seq
 923491092     gbpln481.seq
 732477869     gbpln482.seq
 789987733     gbpln483.seq
 926022053     gbpln484.seq
 610840579     gbpln485.seq
 949759032     gbpln486.seq
 955444559     gbpln487.seq
 818480442     gbpln488.seq
 752251380     gbpln489.seq
 272302955     gbpln49.seq
 897893149     gbpln490.seq
 631111272     gbpln491.seq
1022032953     gbpln492.seq
1006306956     gbpln493.seq
 837035085     gbpln494.seq
 966140819     gbpln495.seq
1090560006     gbpln496.seq
 800164754     gbpln497.seq
 959884028     gbpln498.seq
 886916735     gbpln499.seq
 465932320     gbpln5.seq
 172902191     gbpln50.seq
 641540050     gbpln500.seq
 910168783     gbpln501.seq
 908785549     gbpln502.seq
 729527181     gbpln503.seq
 797552105     gbpln504.seq
 910975470     gbpln505.seq
 616026199     gbpln506.seq
 945685366     gbpln507.seq
 953145956     gbpln508.seq
 820081609     gbpln509.seq
 471233536     gbpln51.seq
 763165947     gbpln510.seq
 870898266     gbpln511.seq
 618200825     gbpln512.seq
1009123187     gbpln513.seq
1016689515     gbpln514.seq
 832912303     gbpln515.seq
 952656374     gbpln516.seq
1065835283     gbpln517.seq
 776075044     gbpln518.seq
 935940025     gbpln519.seq
 455042321     gbpln52.seq
 846831932     gbpln520.seq
 641399988     gbpln521.seq
 892709705     gbpln522.seq
 594848385     gbpln523.seq
 720169483     gbpln524.seq
 780564861     gbpln525.seq
 888344689     gbpln526.seq
 610800072     gbpln527.seq
 934713391     gbpln528.seq
1233388213     gbpln529.seq
 488809223     gbpln53.seq
 807523234     gbpln530.seq
     19542     gbpln531.seq
 757881986     gbpln532.seq
 889760627     gbpln533.seq
 635890046     gbpln534.seq
1007873898     gbpln535.seq
1015524558     gbpln536.seq
 836625022     gbpln537.seq
 959076059     gbpln538.seq
1077416379     gbpln539.seq
 355272263     gbpln54.seq
 789416089     gbpln540.seq
 958430056     gbpln541.seq
 877922843     gbpln542.seq
 648665455     gbpln543.seq
 907513209     gbpln544.seq
 904978028     gbpln545.seq
 727024880     gbpln546.seq
 789120540     gbpln547.seq
 898507915     gbpln548.seq
 617229811     gbpln549.seq
 200538454     gbpln55.seq
 942711764     gbpln550.seq
 964780021     gbpln551.seq
 818917331     gbpln552.seq
 755294557     gbpln553.seq
 882064051     gbpln554.seq
 627203691     gbpln555.seq
 993595919     gbpln556.seq
1021497440     gbpln557.seq
 827286497     gbpln558.seq
 962451301     gbpln559.seq
 377219536     gbpln56.seq
1082256067     gbpln560.seq
 781463827     gbpln561.seq
 919665368     gbpln562.seq
 852133929     gbpln563.seq
 645388382     gbpln564.seq
 905574854     gbpln565.seq
 906714977     gbpln566.seq
 718743537     gbpln567.seq
 787529633     gbpln568.seq
 910251919     gbpln569.seq
 375192640     gbpln57.seq
 608518276     gbpln570.seq
 934541265     gbpln571.seq
 954054955     gbpln572.seq
 806443717     gbpln573.seq
 253200691     gbpln574.seq
 654245898     gbpln575.seq
 843080362     gbpln576.seq
 787261705     gbpln577.seq
 773098599     gbpln578.seq
 745082094     gbpln579.seq
 386441749     gbpln58.seq
 711612756     gbpln580.seq
 801222610     gbpln581.seq
    271464     gbpln582.seq
 398651709     gbpln583.seq
 315170317     gbpln584.seq
 306732013     gbpln585.seq
 319872292     gbpln586.seq
 286450423     gbpln587.seq
 220883441     gbpln588.seq
 470283415     gbpln589.seq
 482478614     gbpln59.seq
 475850186     gbpln590.seq
 499124918     gbpln591.seq
 460644363     gbpln592.seq
 359155255     gbpln593.seq
 399402445     gbpln594.seq
 501115666     gbpln595.seq
 413826113     gbpln596.seq
 367000227     gbpln597.seq
 238050627     gbpln598.seq
 352241749     gbpln599.seq
 499999034     gbpln6.seq
 473293925     gbpln60.seq
 298781185     gbpln600.seq
 490716477     gbpln601.seq
  86105216     gbpln602.seq
   9838016     gbpln603.seq
  10182293     gbpln604.seq
 766528189     gbpln605.seq
 422677536     gbpln606.seq
 133574530     gbpln607.seq
 756143249     gbpln608.seq
 878426054     gbpln609.seq
 476593700     gbpln61.seq
 631056251     gbpln610.seq
 993852367     gbpln611.seq
1020132695     gbpln612.seq
 830166807     gbpln613.seq
 955723315     gbpln614.seq
1057964328     gbpln615.seq
 784007552     gbpln616.seq
 947940191     gbpln617.seq
 857511193     gbpln618.seq
 649137171     gbpln619.seq
 434249982     gbpln62.seq
 903393879     gbpln620.seq
 908180396     gbpln621.seq
 721135945     gbpln622.seq
 786739709     gbpln623.seq
 918070756     gbpln624.seq
 603192844     gbpln625.seq
 938102555     gbpln626.seq
 955978436     gbpln627.seq
 813787878     gbpln628.seq
 639701128     gbpln629.seq
 440487400     gbpln63.seq
 468519430     gbpln630.seq
 499445109     gbpln631.seq
 498567457     gbpln632.seq
  20791137     gbpln633.seq
 768129678     gbpln634.seq
 891209633     gbpln635.seq
1017177961     gbpln636.seq
1036708108     gbpln637.seq
 980496603     gbpln638.seq
1096870510     gbpln639.seq
 444203819     gbpln64.seq
 964601805     gbpln640.seq
 883690282     gbpln641.seq
 879367269     gbpln642.seq
 922136688     gbpln643.seq
 805432021     gbpln644.seq
 912345991     gbpln645.seq
 954500353     gbpln646.seq
 944560088     gbpln647.seq
  29543150     gbpln648.seq
 401384300     gbpln649.seq
 189178941     gbpln65.seq
 499997720     gbpln650.seq
 499778047     gbpln651.seq
 475785137     gbpln652.seq
 499998880     gbpln653.seq
 499743157     gbpln654.seq
 499998762     gbpln655.seq
  53803864     gbpln656.seq
 499732011     gbpln657.seq
 499998487     gbpln658.seq
 499998081     gbpln659.seq
 460468033     gbpln66.seq
 193993265     gbpln660.seq
 499996871     gbpln661.seq
 499748414     gbpln662.seq
 499999144     gbpln663.seq
 499849755     gbpln664.seq
 499887541     gbpln665.seq
 106404151     gbpln666.seq
 499750469     gbpln667.seq
 499999448     gbpln668.seq
 499874391     gbpln669.seq
 440542307     gbpln67.seq
 153494293     gbpln670.seq
 357423522     gbpln671.seq
 453535590     gbpln672.seq
 315191996     gbpln673.seq
 679344023     gbpln674.seq
 873797632     gbpln675.seq
 820367220     gbpln676.seq
 806296382     gbpln677.seq
 775209384     gbpln678.seq
 744231520     gbpln679.seq
 452992006     gbpln68.seq
 817156402     gbpln680.seq
 771380170     gbpln681.seq
 913253142     gbpln682.seq
 634934982     gbpln683.seq
1019175188     gbpln684.seq
1023638564     gbpln685.seq
 822225605     gbpln686.seq
 961290952     gbpln687.seq
1090804562     gbpln688.seq
 813694518     gbpln689.seq
 497916786     gbpln69.seq
 962545328     gbpln690.seq
 873725319     gbpln691.seq
 673190932     gbpln692.seq
 905064826     gbpln693.seq
 908590682     gbpln694.seq
 742712720     gbpln695.seq
 793279946     gbpln696.seq
 934932909     gbpln697.seq
 640700840     gbpln698.seq
 961568346     gbpln699.seq
 499856130     gbpln7.seq
 480376128     gbpln70.seq
 952066709     gbpln700.seq
 827214105     gbpln701.seq
 455119462     gbpln702.seq
 483800372     gbpln703.seq
 408962039     gbpln704.seq
 329779393     gbpln705.seq
 332794404     gbpln706.seq
 418495189     gbpln707.seq
 443558619     gbpln708.seq
 449429603     gbpln709.seq
  71745252     gbpln71.seq
 403262216     gbpln710.seq
 477398793     gbpln711.seq
 434139529     gbpln712.seq
 488358692     gbpln713.seq
 482840837     gbpln714.seq
 469665157     gbpln715.seq
 228132202     gbpln716.seq
 434627789     gbpln717.seq
 412605137     gbpln718.seq
 486452574     gbpln719.seq
 470915914     gbpln72.seq
 475648613     gbpln720.seq
 480187598     gbpln721.seq
 445114184     gbpln722.seq
 461854061     gbpln723.seq
 499646071     gbpln724.seq
 476206835     gbpln725.seq
 473737289     gbpln726.seq
 467895412     gbpln727.seq
 429748374     gbpln728.seq
 472129613     gbpln73.seq
 477884160     gbpln74.seq
 460004048     gbpln75.seq
 430418757     gbpln76.seq
 441540696     gbpln77.seq
 433637010     gbpln78.seq
 498225038     gbpln79.seq
 225561812     gbpln8.seq
 107501131     gbpln80.seq
 449964742     gbpln81.seq
 422837725     gbpln82.seq
 383453843     gbpln83.seq
 376172115     gbpln84.seq
 326317072     gbpln85.seq
 320571252     gbpln86.seq
 286199716     gbpln87.seq
 277716231     gbpln88.seq
 499733063     gbpln89.seq
 499990067     gbpln9.seq
  63743689     gbpln90.seq
 391026515     gbpln91.seq
 362500946     gbpln92.seq
 390024684     gbpln93.seq
 341773034     gbpln94.seq
 199854530     gbpln95.seq
 483137313     gbpln96.seq
 493806535     gbpln97.seq
 497200072     gbpln98.seq
 492442383     gbpln99.seq
 148373605     gbpri1.seq
 499825465     gbpri10.seq
 499966274     gbpri11.seq
 248882813     gbpri12.seq
 499849548     gbpri13.seq
 352975484     gbpri14.seq
 162642387     gbpri15.seq
 494717022     gbpri16.seq
 499956353     gbpri17.seq
 499952905     gbpri18.seq
 499962231     gbpri19.seq
 499849563     gbpri2.seq
 254317986     gbpri20.seq
 317623183     gbpri21.seq
 301998886     gbpri22.seq
 491209604     gbpri23.seq
 445784104     gbpri24.seq
 381563743     gbpri25.seq
 343179555     gbpri26.seq
 476586505     gbpri27.seq
 474070691     gbpri28.seq
 368091958     gbpri29.seq
 499891257     gbpri3.seq
 499999042     gbpri30.seq
  73664678     gbpri31.seq
 499936200     gbpri32.seq
 445708926     gbpri33.seq
 427945376     gbpri34.seq
 376528667     gbpri35.seq
 483909000     gbpri36.seq
 361487740     gbpri37.seq
 388659484     gbpri38.seq
 448630212     gbpri39.seq
 499855390     gbpri4.seq
 499941391     gbpri40.seq
 307422144     gbpri41.seq
 314630207     gbpri42.seq
 499998781     gbpri43.seq
 499999272     gbpri44.seq
 213480365     gbpri45.seq
 499994791     gbpri46.seq
 499999165     gbpri47.seq
 316320939     gbpri48.seq
 499983237     gbpri49.seq
 499729136     gbpri5.seq
 499996439     gbpri50.seq
 315505284     gbpri51.seq
 258775295     gbpri52.seq
 499996591     gbpri53.seq
 499998528     gbpri54.seq
 499975059     gbpri55.seq
 279228758     gbpri56.seq
 393528728     gbpri6.seq
 499802910     gbpri7.seq
 499984899     gbpri8.seq
 499967070     gbpri9.seq
    658938     gbrel.txt
 499981989     gbrod1.seq
 499996921     gbrod10.seq
   6033878     gbrod11.seq
 499808157     gbrod12.seq
 203924668     gbrod13.seq
 499994573     gbrod14.seq
 499997569     gbrod15.seq
 499999641     gbrod16.seq
 294801722     gbrod17.seq
 406446251     gbrod18.seq
 485622455     gbrod19.seq
 499802341     gbrod2.seq
 447177630     gbrod20.seq
 401874128     gbrod21.seq
 366906645     gbrod22.seq
 178573611     gbrod23.seq
 488460732     gbrod24.seq
 424418910     gbrod25.seq
 451727107     gbrod26.seq
 499112036     gbrod27.seq
 467946548     gbrod28.seq
 425428799     gbrod29.seq
 499880319     gbrod3.seq
 380509124     gbrod30.seq
 359291146     gbrod31.seq
 441031541     gbrod32.seq
 489661762     gbrod33.seq
 301541852     gbrod34.seq
 245696968     gbrod35.seq
 444533522     gbrod36.seq
 404901396     gbrod37.seq
 350079181     gbrod38.seq
 484303888     gbrod39.seq
 499702715     gbrod4.seq
 464197213     gbrod40.seq
 311672321     gbrod41.seq
 441713729     gbrod42.seq
 398906813     gbrod43.seq
 493373336     gbrod44.seq
 407105696     gbrod45.seq
 117842878     gbrod46.seq
 488265022     gbrod47.seq
 434197329     gbrod48.seq
 412800312     gbrod49.seq
 499960342     gbrod5.seq
 454365663     gbrod50.seq
 382748472     gbrod51.seq
 428038719     gbrod52.seq
 487918369     gbrod53.seq
 440586747     gbrod54.seq
 359290553     gbrod55.seq
 410329952     gbrod56.seq
 258123670     gbrod57.seq
 390007635     gbrod58.seq
 346418766     gbrod59.seq
  80291490     gbrod6.seq
 345548222     gbrod60.seq
 465925928     gbrod61.seq
 403537722     gbrod62.seq
 386823577     gbrod63.seq
 403462511     gbrod64.seq
 391812927     gbrod65.seq
 346719868     gbrod66.seq
 491742089     gbrod67.seq
 445010312     gbrod68.seq
 493387550     gbrod69.seq
 499846851     gbrod7.seq
 300864949     gbrod70.seq
 466768965     gbrod71.seq
 374387663     gbrod72.seq
 350248940     gbrod73.seq
 470230178     gbrod74.seq
 465917437     gbrod75.seq
 493546372     gbrod76.seq
 241665906     gbrod77.seq
 499742719     gbrod8.seq
 499945822     gbrod9.seq
 499999694     gbsts1.seq
 499997730     gbsts10.seq
 433283954     gbsts11.seq
 499997185     gbsts2.seq
  38079720     gbsts3.seq
 499998792     gbsts4.seq
 499996883     gbsts5.seq
 456729482     gbsts6.seq
 499997464     gbsts7.seq
 499999680     gbsts8.seq
  21540654     gbsts9.seq
 300834652     gbsyn1.seq
 484840372     gbsyn10.seq
 420813753     gbsyn11.seq
 490139440     gbsyn12.seq
 343340422     gbsyn13.seq
 372527348     gbsyn14.seq
 417861289     gbsyn15.seq
 448312981     gbsyn16.seq
 416378132     gbsyn17.seq
 453065790     gbsyn18.seq
 263307032     gbsyn19.seq
 343340424     gbsyn2.seq
 484840366     gbsyn20.seq
 420813747     gbsyn21.seq
 498979310     gbsyn22.seq
 499990268     gbsyn23.seq
  48549451     gbsyn24.seq
 499993129     gbsyn25.seq
 499996375     gbsyn26.seq
 499995233     gbsyn27.seq
 245498035     gbsyn28.seq
 347814164     gbsyn29.seq
 372527353     gbsyn3.seq
 417861297     gbsyn4.seq
 448312992     gbsyn5.seq
  81377357     gbsyn6.seq
 470781602     gbsyn7.seq
 317285242     gbsyn8.seq
 263307034     gbsyn9.seq
 499999476     gbtsa1.seq
 500000000     gbtsa10.seq
 499997439     gbtsa100.seq
 499999811     gbtsa101.seq
 499996108     gbtsa102.seq
 404671505     gbtsa103.seq
 499996434     gbtsa104.seq
 499998444     gbtsa105.seq
 499998535     gbtsa106.seq
 473627173     gbtsa107.seq
 499999949     gbtsa108.seq
 499998832     gbtsa109.seq
 499997424     gbtsa11.seq
 236669988     gbtsa110.seq
 499991596     gbtsa111.seq
 499999834     gbtsa112.seq
 499999770     gbtsa113.seq
 499998939     gbtsa114.seq
  34150369     gbtsa115.seq
 499995781     gbtsa116.seq
 499999069     gbtsa117.seq
 499994937     gbtsa118.seq
 470659755     gbtsa119.seq
 280130073     gbtsa12.seq
 499998218     gbtsa120.seq
 499998672     gbtsa121.seq
 499999924     gbtsa122.seq
 280313902     gbtsa123.seq
 499999116     gbtsa124.seq
 499998111     gbtsa125.seq
 499999818     gbtsa126.seq
 423256101     gbtsa127.seq
 499996235     gbtsa13.seq
 499998510     gbtsa14.seq
 152208041     gbtsa15.seq
 499999603     gbtsa16.seq
 499997193     gbtsa17.seq
 258373800     gbtsa18.seq
 499998168     gbtsa19.seq
 499998745     gbtsa2.seq
 499999213     gbtsa20.seq
 500000233     gbtsa21.seq
  67592738     gbtsa22.seq
 499998052     gbtsa23.seq
 499999856     gbtsa24.seq
 499998098     gbtsa25.seq
 277251866     gbtsa26.seq
 499999635     gbtsa27.seq
 499999791     gbtsa28.seq
  71311344     gbtsa29.seq
 146901025     gbtsa3.seq
 499999538     gbtsa30.seq
 499999007     gbtsa31.seq
 158252503     gbtsa32.seq
 499998095     gbtsa33.seq
 499999071     gbtsa34.seq
 499998984     gbtsa35.seq
 489509289     gbtsa36.seq
 499999807     gbtsa37.seq
 499998500     gbtsa38.seq
 499999107     gbtsa39.seq
 499998574     gbtsa4.seq
 227191517     gbtsa40.seq
 499999675     gbtsa41.seq
 499991892     gbtsa42.seq
 500000238     gbtsa43.seq
 175111340     gbtsa44.seq
 499998997     gbtsa45.seq
 499999560     gbtsa46.seq
 354820880     gbtsa47.seq
 499999373     gbtsa48.seq
 499997080     gbtsa49.seq
 499999957     gbtsa5.seq
 292181365     gbtsa50.seq
 499997879     gbtsa51.seq
 500000195     gbtsa52.seq
 395118408     gbtsa53.seq
 499997625     gbtsa54.seq
 499998684     gbtsa55.seq
 500000232     gbtsa56.seq
 344426441     gbtsa57.seq
 499999428     gbtsa58.seq
 499998841     gbtsa59.seq
  50320220     gbtsa6.seq
 499998177     gbtsa60.seq
 224353812     gbtsa61.seq
 499999722     gbtsa62.seq
 500000157     gbtsa63.seq
 259943701     gbtsa64.seq
 499999212     gbtsa65.seq
 465402653     gbtsa66.seq
 499998493     gbtsa67.seq
 499999436     gbtsa68.seq
 499996902     gbtsa69.seq
 499995889     gbtsa7.seq
 165103829     gbtsa70.seq
 499997567     gbtsa71.seq
 500000162     gbtsa72.seq
 499998185     gbtsa73.seq
   2512297     gbtsa74.seq
 499998773     gbtsa75.seq
 499998780     gbtsa76.seq
 131409934     gbtsa77.seq
 500000012     gbtsa78.seq
 500000259     gbtsa79.seq
 499998945     gbtsa8.seq
  33928768     gbtsa80.seq
 499999375     gbtsa81.seq
 499997795     gbtsa82.seq
 499997482     gbtsa83.seq
 499998016     gbtsa84.seq
  45872069     gbtsa85.seq
 499997106     gbtsa86.seq
 499998546     gbtsa87.seq
 499999206     gbtsa88.seq
  81426641     gbtsa89.seq
 271009161     gbtsa9.seq
 499999824     gbtsa90.seq
 389215892     gbtsa91.seq
 499998191     gbtsa92.seq
 499994249     gbtsa93.seq
 499998640     gbtsa94.seq
 208350764     gbtsa95.seq
 499999734     gbtsa96.seq
 499998253     gbtsa97.seq
 499996332     gbtsa98.seq
 230879944     gbtsa99.seq
   7022833     gbuna1.seq
 499960340     gbvrl1.seq
 499998794     gbvrl10.seq
 156024328     gbvrl100.seq
 499950429     gbvrl101.seq
 499968853     gbvrl102.seq
 499995767     gbvrl103.seq
 221920795     gbvrl104.seq
 499976172     gbvrl105.seq
 499960522     gbvrl106.seq
 499973186     gbvrl107.seq
 431560371     gbvrl108.seq
 499982927     gbvrl109.seq
 499986907     gbvrl11.seq
 499977813     gbvrl110.seq
 499971395     gbvrl111.seq
 141536117     gbvrl112.seq
 499982292     gbvrl113.seq
 499958960     gbvrl114.seq
 499976000     gbvrl115.seq
 490319591     gbvrl116.seq
 499943193     gbvrl117.seq
 499977720     gbvrl118.seq
 499982025     gbvrl119.seq
 163528822     gbvrl12.seq
 255824159     gbvrl120.seq
 499957050     gbvrl121.seq
 499973710     gbvrl122.seq
 499972181     gbvrl123.seq
 499987595     gbvrl124.seq
   5907114     gbvrl125.seq
 499986354     gbvrl126.seq
 499942138     gbvrl127.seq
 499963493     gbvrl128.seq
 499948253     gbvrl129.seq
 499996954     gbvrl13.seq
 300623147     gbvrl130.seq
 499962058     gbvrl131.seq
 499975522     gbvrl132.seq
 499984933     gbvrl133.seq
 499965728     gbvrl134.seq
 499976578     gbvrl135.seq
 225739938     gbvrl136.seq
 499977611     gbvrl137.seq
 499973738     gbvrl138.seq
 499972748     gbvrl139.seq
 499997816     gbvrl14.seq
 322559158     gbvrl140.seq
 499982106     gbvrl141.seq
 499975547     gbvrl142.seq
 499968141     gbvrl143.seq
 291475553     gbvrl144.seq
 499949846     gbvrl145.seq
 499942801     gbvrl146.seq
 499994645     gbvrl147.seq
 181294190     gbvrl148.seq
 499970519     gbvrl149.seq
 134084819     gbvrl15.seq
 499986834     gbvrl150.seq
 499950755     gbvrl151.seq
 499987786     gbvrl152.seq
 251540897     gbvrl153.seq
 499972421     gbvrl154.seq
 499942510     gbvrl155.seq
 499988746     gbvrl156.seq
 237753471     gbvrl157.seq
 499974277     gbvrl158.seq
 499975198     gbvrl159.seq
 499995706     gbvrl16.seq
 499943494     gbvrl160.seq
 499953728     gbvrl161.seq
 278848902     gbvrl162.seq
 499956780     gbvrl163.seq
 499969425     gbvrl164.seq
 499954054     gbvrl165.seq
 499936963     gbvrl166.seq
 224690429     gbvrl167.seq
 499966325     gbvrl168.seq
 499961808     gbvrl169.seq
 499998553     gbvrl17.seq
 499948393     gbvrl170.seq
 336410902     gbvrl171.seq
 499980583     gbvrl172.seq
 499974002     gbvrl173.seq
 499935447     gbvrl174.seq
 148681210     gbvrl175.seq
 499963812     gbvrl176.seq
 499948958     gbvrl177.seq
 499951529     gbvrl178.seq
 150727797     gbvrl179.seq
 315373917     gbvrl18.seq
 499950957     gbvrl180.seq
 499956753     gbvrl181.seq
 499945341     gbvrl182.seq
 460290171     gbvrl183.seq
 499942504     gbvrl184.seq
 499947570     gbvrl185.seq
 499954671     gbvrl186.seq
 498557457     gbvrl187.seq
 499990413     gbvrl188.seq
 499970879     gbvrl189.seq
 499999744     gbvrl19.seq
 499991746     gbvrl190.seq
 168858117     gbvrl191.seq
 499952800     gbvrl192.seq
 499986663     gbvrl193.seq
 499953698     gbvrl194.seq
 351909135     gbvrl195.seq
 499938270     gbvrl196.seq
 499943308     gbvrl197.seq
 499937521     gbvrl198.seq
 201555920     gbvrl199.seq
 499970755     gbvrl2.seq
 499995881     gbvrl20.seq
 499946920     gbvrl200.seq
 499971596     gbvrl201.seq
 499958298     gbvrl202.seq
 239440962     gbvrl203.seq
 499963930     gbvrl204.seq
 499974102     gbvrl205.seq
 499956348     gbvrl206.seq
 499967584     gbvrl207.seq
 129150442     gbvrl208.seq
 499964580     gbvrl209.seq
 345438733     gbvrl21.seq
 499998538     gbvrl210.seq
 499953147     gbvrl211.seq
 327401387     gbvrl212.seq
 499951473     gbvrl213.seq
 499963096     gbvrl214.seq
 499985916     gbvrl215.seq
 418063086     gbvrl216.seq
 499993142     gbvrl217.seq
 499986543     gbvrl218.seq
 499994963     gbvrl219.seq
 499995123     gbvrl22.seq
 247183910     gbvrl220.seq
 499988949     gbvrl221.seq
 499981657     gbvrl222.seq
 499995563     gbvrl223.seq
 484639425     gbvrl224.seq
 499951950     gbvrl225.seq
 499932652     gbvrl226.seq
 499959198     gbvrl227.seq
 176335329     gbvrl228.seq
 499995979     gbvrl229.seq
 499997007     gbvrl23.seq
 499992000     gbvrl230.seq
 499979847     gbvrl231.seq
 499936972     gbvrl232.seq
 499955316     gbvrl233.seq
 191299054     gbvrl234.seq
 499977243     gbvrl235.seq
 499980632     gbvrl236.seq
 499992463     gbvrl237.seq
 499950164     gbvrl238.seq
  69194859     gbvrl239.seq
 369156337     gbvrl24.seq
 499957073     gbvrl240.seq
 499935660     gbvrl241.seq
 499980336     gbvrl242.seq
 499955130     gbvrl243.seq
 148453325     gbvrl244.seq
 499933054     gbvrl245.seq
 499996607     gbvrl246.seq
 499970501     gbvrl247.seq
 426558438     gbvrl248.seq
 499944568     gbvrl249.seq
 499997535     gbvrl25.seq
 499981814     gbvrl250.seq
 499997337     gbvrl251.seq
 347801993     gbvrl252.seq
 499980403     gbvrl253.seq
 499955038     gbvrl254.seq
 499995405     gbvrl255.seq
 246207730     gbvrl256.seq
 499941586     gbvrl257.seq
 499957362     gbvrl258.seq
 499949364     gbvrl259.seq
 499999710     gbvrl26.seq
 421397902     gbvrl260.seq
 499988315     gbvrl261.seq
 499981102     gbvrl262.seq
 499934298     gbvrl263.seq
 284386798     gbvrl264.seq
 499983836     gbvrl265.seq
 499987591     gbvrl266.seq
 499996780     gbvrl267.seq
 233831995     gbvrl268.seq
 499987930     gbvrl269.seq
 313952423     gbvrl27.seq
 499967334     gbvrl270.seq
 499977561     gbvrl271.seq
 237166390     gbvrl272.seq
 490193585     gbvrl273.seq
 499992500     gbvrl274.seq
 252523082     gbvrl275.seq
  76688277     gbvrl276.seq
 499994644     gbvrl277.seq
 499965832     gbvrl278.seq
 499992766     gbvrl279.seq
 499766558     gbvrl28.seq
 249246445     gbvrl280.seq
 499997356     gbvrl281.seq
 499968021     gbvrl282.seq
 499975157     gbvrl283.seq
 277362516     gbvrl284.seq
 499986328     gbvrl285.seq
 499980027     gbvrl286.seq
 499966393     gbvrl287.seq
 168156082     gbvrl288.seq
 499975260     gbvrl289.seq
 499997454     gbvrl29.seq
 499961425     gbvrl290.seq
 499971521     gbvrl291.seq
 142698270     gbvrl292.seq
 499994331     gbvrl293.seq
 499995803     gbvrl294.seq
 499991037     gbvrl295.seq
 257487211     gbvrl296.seq
 499977149     gbvrl297.seq
 499988829     gbvrl298.seq
 499978366     gbvrl299.seq
 414914184     gbvrl3.seq
 499981258     gbvrl30.seq
 139136987     gbvrl300.seq
 499971782     gbvrl301.seq
 499992483     gbvrl302.seq
 499968666     gbvrl303.seq
 259142646     gbvrl304.seq
 499993900     gbvrl305.seq
 499988767     gbvrl306.seq
 499989180     gbvrl307.seq
 123572894     gbvrl308.seq
 499970770     gbvrl309.seq
 239907550     gbvrl31.seq
 499994066     gbvrl310.seq
 499994968     gbvrl311.seq
 468067502     gbvrl312.seq
 499990734     gbvrl313.seq
 499988330     gbvrl314.seq
 499996240     gbvrl315.seq
 117898728     gbvrl316.seq
 499981425     gbvrl317.seq
 499994187     gbvrl318.seq
 499989000     gbvrl319.seq
 499993200     gbvrl32.seq
 359700612     gbvrl320.seq
 499994806     gbvrl321.seq
 499976145     gbvrl322.seq
 499997431     gbvrl323.seq
 499999910     gbvrl324.seq
 276718100     gbvrl325.seq
 499962348     gbvrl326.seq
 499993607     gbvrl327.seq
 499993733     gbvrl328.seq
 499981063     gbvrl329.seq
 499998246     gbvrl33.seq
  52572525     gbvrl330.seq
 499984503     gbvrl331.seq
 499977083     gbvrl332.seq
 499987313     gbvrl333.seq
 400921695     gbvrl334.seq
 499965920     gbvrl335.seq
 499974118     gbvrl336.seq
 499974403     gbvrl337.seq
 354399856     gbvrl338.seq
 499975084     gbvrl339.seq
 419826574     gbvrl34.seq
 499977309     gbvrl340.seq
 499974395     gbvrl341.seq
 244521075     gbvrl342.seq
 499969047     gbvrl343.seq
 499998527     gbvrl344.seq
 499963466     gbvrl345.seq
 499983918     gbvrl346.seq
  22842810     gbvrl347.seq
 499962138     gbvrl348.seq
 499990798     gbvrl349.seq
 499992530     gbvrl35.seq
 499977542     gbvrl350.seq
 499986852     gbvrl351.seq
 117796084     gbvrl352.seq
 499984111     gbvrl353.seq
 499990572     gbvrl354.seq
 499986315     gbvrl355.seq
 136842513     gbvrl356.seq
 499960910     gbvrl357.seq
 499963640     gbvrl358.seq
 499986410     gbvrl359.seq
 499993964     gbvrl36.seq
 454678599     gbvrl360.seq
 499963695     gbvrl361.seq
 499975942     gbvrl362.seq
 499976716     gbvrl363.seq
 499989681     gbvrl364.seq
 131902282     gbvrl365.seq
 499966715     gbvrl366.seq
 499969862     gbvrl367.seq
 499965635     gbvrl368.seq
 231328788     gbvrl369.seq
 414962684     gbvrl37.seq
 499967096     gbvrl370.seq
 499996020     gbvrl371.seq
 499973475     gbvrl372.seq
 499991213     gbvrl373.seq
 499999340     gbvrl374.seq
 169210264     gbvrl375.seq
 499999840     gbvrl38.seq
 499991255     gbvrl39.seq
 499997494     gbvrl4.seq
 499995188     gbvrl40.seq
 298714970     gbvrl41.seq
 499936686     gbvrl42.seq
 499996157     gbvrl43.seq
 499987296     gbvrl44.seq
 269548290     gbvrl45.seq
 499984137     gbvrl46.seq
 499998943     gbvrl47.seq
 499940744     gbvrl48.seq
 275939302     gbvrl49.seq
 499999396     gbvrl5.seq
 499996233     gbvrl50.seq
 499993290     gbvrl51.seq
 499934632     gbvrl52.seq
 251912250     gbvrl53.seq
 499941899     gbvrl54.seq
 499954090     gbvrl55.seq
 499984288     gbvrl56.seq
 499979612     gbvrl57.seq
 176857546     gbvrl58.seq
 499972915     gbvrl59.seq
 499998092     gbvrl6.seq
 499984837     gbvrl60.seq
 499990309     gbvrl61.seq
 499944147     gbvrl62.seq
 150433330     gbvrl63.seq
 499997121     gbvrl64.seq
 499956285     gbvrl65.seq
 499997994     gbvrl66.seq
 499998737     gbvrl67.seq
 148187597     gbvrl68.seq
 499986609     gbvrl69.seq
 499982131     gbvrl7.seq
 499971145     gbvrl70.seq
 499948166     gbvrl71.seq
 404497069     gbvrl72.seq
 499934522     gbvrl73.seq
 499971105     gbvrl74.seq
 499949505     gbvrl75.seq
 352443431     gbvrl76.seq
 499981928     gbvrl77.seq
 499939580     gbvrl78.seq
 499977454     gbvrl79.seq
 301488775     gbvrl8.seq
 307756299     gbvrl80.seq
 499965353     gbvrl81.seq
 499962230     gbvrl82.seq
 499981049     gbvrl83.seq
  41227290     gbvrl84.seq
 499974318     gbvrl85.seq
 499962896     gbvrl86.seq
 499972185     gbvrl87.seq
 184848748     gbvrl88.seq
 499986169     gbvrl89.seq
 499998102     gbvrl9.seq
 499941886     gbvrl90.seq
 499934721     gbvrl91.seq
 175000247     gbvrl92.seq
 499977099     gbvrl93.seq
 499975342     gbvrl94.seq
 499961511     gbvrl95.seq
 219017864     gbvrl96.seq
 499951171     gbvrl97.seq
 499963371     gbvrl98.seq
 499960166     gbvrl99.seq
 499953136     gbvrt1.seq
 289935612     gbvrt10.seq
1063697373     gbvrt100.seq
1045817456     gbvrt101.seq
 754876698     gbvrt102.seq
 616753988     gbvrt103.seq
 490283916     gbvrt104.seq
 470651151     gbvrt105.seq
 397152890     gbvrt106.seq
 351566814     gbvrt107.seq
 339881554     gbvrt108.seq
 404716166     gbvrt109.seq
  87348314     gbvrt11.seq
 489465929     gbvrt110.seq
 499108511     gbvrt111.seq
 486719349     gbvrt112.seq
  58362562     gbvrt113.seq
 436489699     gbvrt114.seq
 486735687     gbvrt115.seq
 492786702     gbvrt116.seq
 424170309     gbvrt117.seq
 281367593     gbvrt118.seq
 478264522     gbvrt119.seq
 499776413     gbvrt12.seq
 485840122     gbvrt120.seq
 493662272     gbvrt121.seq
  75046811     gbvrt122.seq
 979125221     gbvrt123.seq
 838606764     gbvrt124.seq
 678362247     gbvrt125.seq
 476490051     gbvrt126.seq
 461393141     gbvrt127.seq
 438814149     gbvrt128.seq
 394334276     gbvrt129.seq
 284656236     gbvrt13.seq
 313818221     gbvrt130.seq
 288999697     gbvrt131.seq
 280186115     gbvrt132.seq
 407765043     gbvrt133.seq
 421856869     gbvrt134.seq
 478932645     gbvrt135.seq
 480028007     gbvrt136.seq
 438022009     gbvrt137.seq
 174441466     gbvrt138.seq
 487902327     gbvrt139.seq
  15637437     gbvrt14.seq
 456814552     gbvrt140.seq
 462308829     gbvrt141.seq
 168813991     gbvrt142.seq
 455915969     gbvrt143.seq
 469542169     gbvrt144.seq
 479148432     gbvrt145.seq
 211438035     gbvrt146.seq
 481255007     gbvrt147.seq
 475910668     gbvrt148.seq
 366785231     gbvrt149.seq
  36032850     gbvrt15.seq
 464881586     gbvrt150.seq
 474452025     gbvrt151.seq
 234874130     gbvrt152.seq
 697335450     gbvrt153.seq
 670835803     gbvrt154.seq
 524090553     gbvrt155.seq
 413420126     gbvrt156.seq
 345317144     gbvrt157.seq
 329841089     gbvrt158.seq
 250750417     gbvrt159.seq
  18507952     gbvrt16.seq
 486600390     gbvrt160.seq
 364885711     gbvrt161.seq
 448395879     gbvrt162.seq
 471877569     gbvrt163.seq
 393642536     gbvrt164.seq
 355134416     gbvrt165.seq
 470602746     gbvrt166.seq
 448657488     gbvrt167.seq
 384724558     gbvrt168.seq
 432320923     gbvrt169.seq
 497676663     gbvrt17.seq
 471132362     gbvrt170.seq
 497676594     gbvrt171.seq
 207882210     gbvrt172.seq
 397267013     gbvrt173.seq
 366771863     gbvrt174.seq
 351249970     gbvrt175.seq
 309532358     gbvrt176.seq
 296271444     gbvrt177.seq
 286321426     gbvrt178.seq
 268164730     gbvrt179.seq
 497173924     gbvrt18.seq
 253329800     gbvrt180.seq
 494939336     gbvrt181.seq
 424426418     gbvrt182.seq
 410896883     gbvrt183.seq
 369957025     gbvrt184.seq
 169574120     gbvrt185.seq
 426847158     gbvrt186.seq
 496824508     gbvrt187.seq
 434394791     gbvrt188.seq
 494363156     gbvrt189.seq
 481350583     gbvrt19.seq
  61896426     gbvrt190.seq
 431425246     gbvrt191.seq
 474666330     gbvrt192.seq
 479195821     gbvrt193.seq
 352877651     gbvrt194.seq
 479851070     gbvrt195.seq
 497038176     gbvrt196.seq
 432867963     gbvrt197.seq
 439843808     gbvrt198.seq
 469531790     gbvrt199.seq
 499838315     gbvrt2.seq
 400795564     gbvrt20.seq
 496015817     gbvrt200.seq
 488626307     gbvrt201.seq
 432135676     gbvrt202.seq
  70119528     gbvrt203.seq
 491056051     gbvrt204.seq
 328508705     gbvrt205.seq
 497328806     gbvrt206.seq
 499238966     gbvrt207.seq
 187508760     gbvrt208.seq
 490842556     gbvrt209.seq
 488197715     gbvrt21.seq
 463385772     gbvrt210.seq
 446788975     gbvrt211.seq
 438416202     gbvrt212.seq
 170595769     gbvrt213.seq
 451342688     gbvrt214.seq
 474563355     gbvrt215.seq
 461335548     gbvrt216.seq
 436658187     gbvrt217.seq
 154682616     gbvrt218.seq
 456837606     gbvrt219.seq
 479291185     gbvrt22.seq
 488930196     gbvrt220.seq
 466502331     gbvrt221.seq
 455725140     gbvrt222.seq
 453475816     gbvrt223.seq
 462276007     gbvrt224.seq
 497473221     gbvrt225.seq
 499283767     gbvrt226.seq
 481742871     gbvrt227.seq
  54779872     gbvrt228.seq
 477445338     gbvrt229.seq
 480798341     gbvrt23.seq
 495314515     gbvrt230.seq
 486008997     gbvrt231.seq
 489201368     gbvrt232.seq
 499536480     gbvrt233.seq
 347470388     gbvrt234.seq
1068402516     gbvrt235.seq
1067356333     gbvrt236.seq
 896844819     gbvrt237.seq
 805318347     gbvrt238.seq
 718662677     gbvrt239.seq
 499274554     gbvrt24.seq
 556944666     gbvrt240.seq
 299728838     gbvrt241.seq
 293507186     gbvrt242.seq
 484357811     gbvrt243.seq
 130768604     gbvrt244.seq
 874873715     gbvrt245.seq
 685858825     gbvrt246.seq
 627564227     gbvrt247.seq
 610271897     gbvrt248.seq
 543871783     gbvrt249.seq
 483255170     gbvrt25.seq
 284797667     gbvrt250.seq
 269299175     gbvrt251.seq
 474717664     gbvrt252.seq
 402979396     gbvrt253.seq
 343325815     gbvrt254.seq
 450550965     gbvrt255.seq
 494368803     gbvrt256.seq
 470716411     gbvrt257.seq
 470514883     gbvrt258.seq
 229630839     gbvrt259.seq
 484153821     gbvrt26.seq
 499998197     gbvrt260.seq
 499998993     gbvrt261.seq
 474776513     gbvrt262.seq
 494963931     gbvrt263.seq
 485274977     gbvrt264.seq
 474231618     gbvrt265.seq
 490948606     gbvrt266.seq
 332441302     gbvrt267.seq
 477156039     gbvrt268.seq
 499226352     gbvrt269.seq
  65325604     gbvrt27.seq
 477696169     gbvrt270.seq
 353039605     gbvrt271.seq
 438196164     gbvrt272.seq
 489809255     gbvrt273.seq
 460938782     gbvrt274.seq
 476280761     gbvrt275.seq
 497596868     gbvrt276.seq
 443693971     gbvrt277.seq
 437233554     gbvrt28.seq
 488520688     gbvrt29.seq
 466371162     gbvrt3.seq
 456456384     gbvrt30.seq
 341830592     gbvrt31.seq
  14151693     gbvrt32.seq
  21383246     gbvrt33.seq
  90967413     gbvrt34.seq
 499908979     gbvrt35.seq
 499997057     gbvrt36.seq
 499999728     gbvrt37.seq
  55655694     gbvrt38.seq
 499997255     gbvrt39.seq
 179100370     gbvrt4.seq
 269768476     gbvrt40.seq
 385151455     gbvrt41.seq
 490595601     gbvrt42.seq
 386502843     gbvrt43.seq
 499998933     gbvrt44.seq
 118920744     gbvrt45.seq
 499998724     gbvrt46.seq
 444774179     gbvrt47.seq
 500000122     gbvrt48.seq
  28726185     gbvrt49.seq
 448778544     gbvrt5.seq
 444169093     gbvrt50.seq
 499998149     gbvrt51.seq
 388059821     gbvrt52.seq
 499998596     gbvrt53.seq
 279896965     gbvrt54.seq
 499999654     gbvrt55.seq
 499452044     gbvrt56.seq
 497917356     gbvrt57.seq
 490184966     gbvrt58.seq
 483022576     gbvrt59.seq
 490703641     gbvrt6.seq
 450977918     gbvrt60.seq
 202128841     gbvrt61.seq
 123737443     gbvrt62.seq
 483315203     gbvrt63.seq
 481925504     gbvrt64.seq
 499999199     gbvrt65.seq
 499926681     gbvrt66.seq
 296494910     gbvrt67.seq
 492181094     gbvrt68.seq
 492375887     gbvrt69.seq
 499120716     gbvrt7.seq
 479677491     gbvrt70.seq
 480814553     gbvrt71.seq
 362168611     gbvrt72.seq
 490950275     gbvrt73.seq
 475405574     gbvrt74.seq
 489430322     gbvrt75.seq
 352376975     gbvrt76.seq
 465372186     gbvrt77.seq
 488788789     gbvrt78.seq
 189348250     gbvrt79.seq
 483670759     gbvrt8.seq
 451948482     gbvrt80.seq
 443703248     gbvrt81.seq
 400719178     gbvrt82.seq
 427517644     gbvrt83.seq
 319264824     gbvrt84.seq
 275756309     gbvrt85.seq
 252640763     gbvrt86.seq
 251496345     gbvrt87.seq
 466369516     gbvrt88.seq
 418722220     gbvrt89.seq
 263689236     gbvrt9.seq
 186091498     gbvrt90.seq
 404212770     gbvrt91.seq
 481131817     gbvrt92.seq
 474827267     gbvrt93.seq
 480710662     gbvrt94.seq
  89576280     gbvrt95.seq
 435880706     gbvrt96.seq
 487966705     gbvrt97.seq
 497561523     gbvrt98.seq
 468911614     gbvrt99.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         101755     185776336
BCT10        101        247874669
BCT100       118        229172914
BCT101       127        232212861
BCT102       90         178403076
BCT103       114        212138354
BCT104       75         222053892
BCT105       112        225347102
BCT106       124        217786851
BCT107       3          5977905
BCT108       246        222256023
BCT109       104        221252195
BCT11        145        242443173
BCT110       100        224644129
BCT111       83         222703364
BCT112       21         86233168
BCT113       68         221578114
BCT114       87         219795809
BCT115       87         223588406
BCT116       80         226303150
BCT117       20         45564131
BCT118       124        217933644
BCT119       53         217706139
BCT12        167        262397135
BCT120       90         227492926
BCT121       57         149506400
BCT122       94         223837173
BCT123       73         221711999
BCT124       113        222996943
BCT125       78         197436829
BCT126       156        218173209
BCT127       84         220629983
BCT128       79         216070642
BCT129       141        228566924
BCT13        6          12749856
BCT130       106        221256144
BCT131       80         221199213
BCT132       92         196245950
BCT133       115        225967887
BCT134       92         220409897
BCT135       158        214217907
BCT136       88         207032597
BCT137       140        220978157
BCT138       63         217844098
BCT139       90         215013764
BCT14        170        237845538
BCT140       125        217101319
BCT141       88         223616604
BCT142       21         65066945
BCT143       174        220602790
BCT144       128        221993348
BCT145       118        216449560
BCT146       170        220678956
BCT147       54         177570665
BCT148       104        218683705
BCT149       113        217389079
BCT15        151        240481452
BCT150       138        222247056
BCT151       109        220993944
BCT152       101        223667628
BCT153       118        156232056
BCT154       95         229134325
BCT155       104        222093509
BCT156       97         225362965
BCT157       116        220401677
BCT158       94         219188969
BCT159       134        220654115
BCT16        199        252481270
BCT160       36         70525291
BCT161       169        220902025
BCT162       100        223727909
BCT163       94         222167747
BCT164       94         214484227
BCT165       71         223304376
BCT166       123        228309968
BCT167       150        228808455
BCT168       80         212893326
BCT169       100        233591727
BCT17        206        229336468
BCT170       96         224405035
BCT171       134        223606319
BCT172       84         220867011
BCT173       24         84218657
BCT174       119        222185746
BCT175       151        231715107
BCT176       72         216080650
BCT177       81         120955479
BCT178       111        216184725
BCT179       156        227708035
BCT18        2          4770723
BCT180       111        220250972
BCT181       89         136614524
BCT182       133        229717687
BCT183       111        208992481
BCT184       108        219925553
BCT185       77         222877345
BCT186       18         29103391
BCT187       98         220152536
BCT188       133        227333368
BCT189       125        230906352
BCT19        136        236547259
BCT190       118        245874590
BCT191       114        233627230
BCT192       32         86501281
BCT193       131        216438017
BCT194       93         226438829
BCT195       108        224087651
BCT196       116        221458112
BCT197       65         122261042
BCT198       127        225144984
BCT199       137        258852104
BCT2         107        227274960
BCT20        113        230295403
BCT200       100        226683783
BCT201       158        215934234
BCT202       69         111557509
BCT203       123        222422665
BCT204       115        218469346
BCT205       89         219209021
BCT206       102        224188280
BCT207       104        209481600
BCT208       97         234475408
BCT209       102        220656832
BCT21        140        223708984
BCT210       100        218053674
BCT211       94         224743372
BCT212       104        226992367
BCT213       107        231904945
BCT214       70         148112573
BCT215       104        221826114
BCT216       108        221051727
BCT217       98         226007841
BCT218       76         270744187
BCT219       75         254647899
BCT22        200        220359484
BCT220       106        225376718
BCT221       176        219971681
BCT222       132        226738257
BCT223       55         106489903
BCT224       324        275336670
BCT225       116        218712797
BCT226       118        218047051
BCT227       45         74298835
BCT228       89         220099828
BCT229       86         226600378
BCT23        24         29385563
BCT230       83         233332678
BCT231       103        224217713
BCT232       24         60324544
BCT233       60         216868170
BCT234       120        221119124
BCT235       86         223426276
BCT236       85         217995381
BCT237       30         67668948
BCT238       157        275025230
BCT239       87         234185848
BCT24        174        220036188
BCT240       96         219765338
BCT241       135        191926241
BCT242       109        262921422
BCT243       72         217635148
BCT244       100        214909619
BCT245       76         205489624
BCT246       143        306547296
BCT247       72         239204396
BCT248       88         216728836
BCT249       132        223474256
BCT25        157        217996559
BCT250       142        267934611
BCT251       46         90275869
BCT252       146        273570514
BCT253       109        252612009
BCT254       35         229012536
BCT255       56         209847636
BCT256       110        218761905
BCT257       130        219578217
BCT258       90         250893937
BCT259       80         203207828
BCT26        52         221902715
BCT260       124        215159011
BCT261       113        223367533
BCT262       144        228597181
BCT263       114        228439247
BCT264       114        231113225
BCT265       120        228230620
BCT266       26         74228471
BCT267       106        218843831
BCT268       82         215186387
BCT269       87         232931079
BCT27        105        237356821
BCT270       98         219566714
BCT271       13         10410673
BCT272       93         235647841
BCT273       104        235928514
BCT274       69         223063860
BCT275       99         208185886
BCT276       119        217748117
BCT277       165        223745463
BCT278       161        212763762
BCT279       133        231781514
BCT28        53         100436723
BCT280       100        227626264
BCT281       123        231590590
BCT282       160        251320587
BCT283       101        227802166
BCT284       122        221777912
BCT285       112        212578426
BCT286       96         229032785
BCT287       123        222518405
BCT288       174        224603753
BCT289       146        214297168
BCT29        81         239594577
BCT290       66         116580172
BCT291       130        226536352
BCT292       105        224013789
BCT293       83         219368049
BCT294       81         216493682
BCT295       103        168153425
BCT296       88         244048892
BCT297       107        228886299
BCT298       83         221517737
BCT299       61         216100377
BCT3         37541      123332243
BCT30        100        222853857
BCT300       75         170636859
BCT301       115        219540003
BCT302       101        218974130
BCT303       124        216924787
BCT304       90         217527347
BCT305       140        185056878
BCT306       124        248813935
BCT307       110        222498371
BCT308       81         224631234
BCT309       61         221300332
BCT31        96         226432790
BCT310       88         179376157
BCT311       128        238885544
BCT312       197        234044756
BCT313       149        219659340
BCT314       120        215711231
BCT315       119        190631862
BCT316       141        246427155
BCT317       167        279237902
BCT318       170        216918027
BCT319       131        219454695
BCT32        129        224597211
BCT320       15         110010139
BCT321       72         228738867
BCT322       128        242193459
BCT323       1242       223734795
BCT324       115        224896454
BCT325       72         181783799
BCT326       101        222185425
BCT327       126        217279454
BCT328       105        212886231
BCT329       130        222884236
BCT33        87         223628495
BCT330       233        231488171
BCT331       188        221578382
BCT332       115        220062307
BCT333       41         85434399
BCT334       123        216507866
BCT335       144        220140457
BCT336       146        218600953
BCT337       124        227417343
BCT338       149        234265173
BCT339       91         238304642
BCT34        112        237222831
BCT340       45         86498994
BCT341       111        224832352
BCT342       159        234833925
BCT343       118        225344370
BCT344       134        231232559
BCT345       61         155047624
BCT346       125        234008897
BCT347       122        226223828
BCT348       77         220312740
BCT349       84         219810323
BCT35        79         218851207
BCT350       55         217536973
BCT351       50         220946014
BCT352       173        224610961
BCT353       3          2825298
BCT354       195        229604129
BCT355       130        250400642
BCT356       142        222978469
BCT357       212        224523784
BCT358       28         60552651
BCT359       94         242189407
BCT36        164        223048523
BCT360       110        247993139
BCT361       46         215287487
BCT362       53         215300620
BCT363       16         60029943
BCT364       92         217200838
BCT365       90         231500758
BCT366       117        246538204
BCT367       203        232314981
BCT368       92         220627220
BCT369       120        214832865
BCT37        532        205551953
BCT370       22         48955354
BCT371       166        261984346
BCT372       180        236857563
BCT373       477        233890189
BCT374       139        234982226
BCT375       148        240643544
BCT376       96         230627278
BCT377       77         123809930
BCT378       110        230934388
BCT379       85         220353169
BCT38        5200       7533877
BCT380       92         218533698
BCT381       104        232991105
BCT382       162        222657737
BCT383       42         76520643
BCT384       88         219801256
BCT385       100        226032023
BCT386       156        310068527
BCT387       112        248255848
BCT388       98         283687676
BCT389       79         182479910
BCT39        10402      13141863
BCT390       114        227850421
BCT391       146        217630758
BCT392       105        227003732
BCT393       148        223405170
BCT394       120        225492649
BCT395       113        228628833
BCT396       86         105656974
BCT397       105        226068926
BCT398       143        223058556
BCT399       113        234518747
BCT4         41293      139254430
BCT40        53922      202025650
BCT400       177        218440412
BCT401       29         61315594
BCT402       129        231508633
BCT403       143        217992395
BCT404       140        221014593
BCT405       109        225377333
BCT406       60         159790523
BCT407       108        234695862
BCT408       138        240972634
BCT409       91         305006086
BCT41        185        214548596
BCT410       97         213066701
BCT411       67         99800639
BCT412       120        221718706
BCT413       121        216687071
BCT414       87         221343640
BCT415       93         259722290
BCT416       30         68667546
BCT417       121        215033983
BCT418       119        228238463
BCT419       118        214080125
BCT42        104        232516945
BCT420       111        222440492
BCT421       8          14459449
BCT422       144        219919128
BCT423       107        252494589
BCT424       165        214214629
BCT425       157        206720897
BCT426       238        214458452
BCT427       127        213318904
BCT428       102        217958513
BCT429       111        255569279
BCT43        116        205561869
BCT430       135        256991516
BCT431       47         110554099
BCT432       101        235232040
BCT433       128        234585657
BCT434       116        218121724
BCT435       114        229642984
BCT436       91         181627435
BCT437       154        213693155
BCT438       111        221269896
BCT439       152        220120956
BCT44        103        222777517
BCT440       97         225592274
BCT441       103        221184160
BCT442       302        214942895
BCT443       13         11235012
BCT444       364        210657095
BCT445       110        214726128
BCT446       142        213119125
BCT447       158        217105943
BCT448       168        218983591
BCT449       174        208501241
BCT45        131        222293417
BCT450       24         45926834
BCT451       161        208257957
BCT452       162        212193463
BCT453       114        210605338
BCT454       157        213126972
BCT455       132        209356669
BCT456       131        195243107
BCT457       183        210687290
BCT458       116        210811583
BCT459       136        211510245
BCT46        123        223122738
BCT460       161        217802986
BCT461       33         52695846
BCT462       168        242619762
BCT463       120        224618414
BCT464       137        225114532
BCT465       108        228056033
BCT466       130        222038116
BCT467       135        226318248
BCT468       136        116206201
BCT469       107        232838404
BCT47        150        224035996
BCT470       101        219419825
BCT471       89         227873694
BCT472       93         227716613
BCT473       104        285959088
BCT474       113        224770003
BCT475       1          3039501
BCT476       124        230097780
BCT477       119        217641315
BCT478       125        220337202
BCT479       188        223112133
BCT48        157        222523995
BCT480       138        226588520
BCT481       74         139461444
BCT482       107        258561528
BCT483       89         212143620
BCT484       158        216707113
BCT485       140        217074444
BCT486       103        225282290
BCT487       132        221285131
BCT488       55         76373529
BCT489       153        246886803
BCT49        103        120901509
BCT490       125        324156894
BCT491       123        246022338
BCT492       194        241856809
BCT493       98         231471692
BCT494       53         151032801
BCT495       99         221181511
BCT496       77         214541590
BCT497       109        234374705
BCT498       126        220074155
BCT499       121        216906928
BCT5         20648      169648440
BCT50        255        227294457
BCT500       68         71301239
BCT501       131        215005041
BCT502       121        220809665
BCT503       138        227841328
BCT504       221        225805718
BCT505       166        144980074
BCT506       133        226910571
BCT507       116        212440150
BCT508       146        244216301
BCT509       134        220559267
BCT51        97         225049518
BCT510       111        220885611
BCT511       147        187909205
BCT512       127        222414510
BCT513       177        214900913
BCT514       140        229675886
BCT515       109        218884211
BCT516       100        135717571
BCT517       148        251704567
BCT518       174        237850274
BCT519       191        210225765
BCT52        105        223456641
BCT520       121        249972207
BCT521       54         192306540
BCT522       124        232858776
BCT523       146        226121334
BCT524       124        228321158
BCT525       97         217908717
BCT526       85         195077841
BCT527       115        216604435
BCT528       119        225008835
BCT529       103        216948181
BCT53        130        225426913
BCT530       117        227156732
BCT531       80         220660553
BCT532       129        227385316
BCT533       160        222067990
BCT534       159        221685726
BCT535       137        221389912
BCT536       126        218500440
BCT537       113        239088222
BCT538       153        228675433
BCT539       151        215312891
BCT54        133        219722042
BCT540       88         223523097
BCT541       166        212067501
BCT542       115        215447043
BCT543       61         208737714
BCT544       60         209982617
BCT545       85         227478197
BCT546       64         199854429
BCT547       73         210314457
BCT548       71         211048635
BCT549       151        222584775
BCT55        107        149028776
BCT550       139        261641589
BCT551       205        240483392
BCT552       54         143268788
BCT553       106        223564250
BCT554       109        221738149
BCT555       119        213187912
BCT556       73         216089179
BCT557       111        135876944
BCT558       121        238759328
BCT559       129        224537672
BCT56        136        223054995
BCT560       127        217814507
BCT561       119        266272178
BCT562       103        388584999
BCT563       88         227677607
BCT564       91         317300604
BCT565       194        223597024
BCT566       119        221819730
BCT567       149        276502385
BCT568       59         56831837
BCT569       108        221474500
BCT57        112        217399067
BCT570       79         225880480
BCT571       180        272624619
BCT572       92         235388308
BCT573       287        220056755
BCT574       121        213230170
BCT575       14         30830533
BCT576       155        259162747
BCT577       119        223811119
BCT578       144        211071910
BCT579       130        210174400
BCT58        131        223635367
BCT580       39         55390545
BCT581       120        211093125
BCT582       123        212731133
BCT583       199        213135589
BCT584       155        223098306
BCT585       169        215938894
BCT586       17         43381733
BCT587       182        228831309
BCT588       121        232279181
BCT589       132        223270245
BCT59        121        221481204
BCT590       116        222726208
BCT591       31         49944878
BCT592       134        210260272
BCT593       181        239594051
BCT594       98         215193160
BCT595       48         211643751
BCT596       9          15566569
BCT597       102        212230252
BCT598       98         212747217
BCT599       86         215225823
BCT6         2600       37759883
BCT60        138        232661918
BCT600       94         245033389
BCT601       10         28861878
BCT602       139        223909880
BCT603       316        211118911
BCT604       93         229974245
BCT605       90         220150066
BCT606       45         125580003
BCT607       111        223842225
BCT608       148        211085348
BCT609       127        210728553
BCT61        108        225781339
BCT610       143        206521634
BCT611       138        215033366
BCT612       114        149068377
BCT613       528        115589384
BCT614       1589       2511957
BCT615       3172       5268484
BCT616       6338       7796395
BCT617       12613      14997690
BCT618       25523      27672494
BCT619       50566      54072396
BCT62        38         50860113
BCT620       148864     156705080
BCT621       14219      193528085
BCT622       3297       203942569
BCT623       2509       213411401
BCT624       7215       212675624
BCT625       164        249069009
BCT626       39928      39703867
BCT627       75102      180239641
BCT628       11057      202910557
BCT629       6079       198788687
BCT63        94         229475332
BCT630       97387      180456180
BCT631       63918      70589904
BCT632       149185     156905313
BCT633       84517      88080422
BCT634       144584     151086417
BCT635       25894      25557033
BCT636       132569     167518864
BCT637       31496      43702397
BCT638       116174     178749610
BCT639       7905       17300263
BCT64        117        227983621
BCT640       32958      53337698
BCT641       30892      249205870
BCT642       6368       291344221
BCT643       5035       225442726
BCT644       3847       224092509
BCT645       1442       273316652
BCT646       109        222593498
BCT647       55         216844860
BCT648       70         213822191
BCT649       34         137765382
BCT65        160        232898310
BCT650       69         224394912
BCT651       364        238323955
BCT652       889        289911825
BCT653       316        85816731
BCT654       1274       198668008
BCT655       333        211837174
BCT656       514        379401000
BCT657       883        314043216
BCT658       262        70200635
BCT659       3569       247581755
BCT66        154        221704284
BCT660       322        301468663
BCT661       334        391121871
BCT662       277        260588329
BCT663       362        393266490
BCT664       364        392445913
BCT665       2140       260288424
BCT666       63         145106063
BCT667       86         222746849
BCT668       78         227354684
BCT669       3023       245927078
BCT67        128        238275556
BCT670       1230       124242115
BCT671       1412       261424764
BCT672       47         241352896
BCT673       45         243003094
BCT674       2180       269716913
BCT675       945        54278114
BCT676       2288       268994823
BCT677       83         274582043
BCT678       422        283036369
BCT679       3015       248690235
BCT68        114        230664549
BCT680       11940      19905115
BCT681       25214      42009550
BCT682       118419     188773431
BCT683       115811     191204701
BCT684       79517      138823668
BCT685       102167     196089335
BCT686       113483     208563805
BCT687       12853      282203492
BCT688       11828      22146794
BCT69        54         123393656
BCT7         1310       133308362
BCT70        300        239582260
BCT71        142        231562727
BCT72        354        225466658
BCT73        111        222896198
BCT74        121        213352666
BCT75        120        227473574
BCT76        98         224926366
BCT77        90         224039666
BCT78        98         225070223
BCT79        58         138528232
BCT8         191        234251938
BCT80        53         211054879
BCT81        45         210584326
BCT82        45         210864282
BCT83        45         212727898
BCT84        76         222861078
BCT85        40         115080869
BCT86        112        227959956
BCT87        129        231316827
BCT88        99         245428056
BCT89        87         223381451
BCT9         133        236750743
BCT90        59         181990919
BCT91        93         237302287
BCT92        103        223843089
BCT93        62         225168570
BCT94        64         140507059
BCT95        97         233623581
BCT96        82         229505918
BCT97        100        238937572
BCT98        24         34605217
BCT99        94         226656782
ENV1         189982     141874265
ENV10        173855     166589843
ENV11        65213      34655833
ENV12        218986     102584580
ENV13        176384     159892020
ENV14        19547      17057460
ENV15        204700     124201887
ENV16        186255     146035020
ENV17        209745     130993068
ENV18        179486     146067073
ENV19        1415       1898084
ENV2         148971     161139594
ENV20        155448     156524394
ENV21        250294     68810308
ENV22        87168      20074006
ENV23        220965     118700470
ENV24        255777     108832989
ENV25        205134     126617565
ENV26        26930      25481171
ENV27        152293     158746214
ENV28        201147     103381957
ENV29        68254      51342584
ENV3         65987      142821091
ENV30        213318     108924480
ENV31        170956     153785998
ENV32        135008     163683922
ENV33        11532      15711524
ENV34        179950     128304632
ENV35        218057     118479883
ENV36        78482      41729198
ENV37        143993     98017210
ENV38        100657     112290439
ENV39        130550     80387732
ENV4         124        288213636
ENV40        173942     138869886
ENV41        163506     139637537
ENV42        179624     114231226
ENV43        200986     107353842
ENV44        196375     109569349
ENV45        111545     97796771
ENV46        158066     134829296
ENV47        145098     136814785
ENV48        169098     47789387
ENV49        172196     133125957
ENV5         83         221317267
ENV50        211020     100433902
ENV51        142308     62179102
ENV52        216483     84261105
ENV53        212752     92644509
ENV54        108059     43423495
ENV55        224310     98787879
ENV56        224820     91761971
ENV57        142869     92450995
ENV58        198721     110748728
ENV59        182641     90460397
ENV6         97         218466622
ENV60        192130     114104534
ENV61        32634      21034577
ENV62        129142     185728154
ENV63        224079     135799121
ENV64        231214     95377034
ENV65        76690      34633236
ENV66        194774     111983942
ENV67        125738     173623962
ENV68        66716      228825645
ENV69        115227     150585292
ENV7         63         204534087
ENV70        43940      42498219
ENV8         76         217162029
ENV9         88         228545332
EST1         152690     59075604
EST10        155841     67142647
EST100       152899     76533320
EST101       145118     99319879
EST102       145153     85348913
EST103       148976     93026423
EST104       7202       4208037
EST105       149683     109460875
EST106       135200     99322475
EST107       136257     97452494
EST108       136284     94853959
EST109       2297       1519204
EST11        163596     69202196
EST110       136920     77327965
EST111       176687     106050647
EST112       194369     119409911
EST113       236609     141475405
EST114       6067       3721593
EST115       229453     127643708
EST116       182810     103717899
EST117       191453     94556126
EST118       2649       2084299
EST119       148549     100251847
EST12        150682     64736779
EST120       154735     119130159
EST121       166270     97893382
EST122       22076      15469633
EST123       130039     82535239
EST124       83544      30919856
EST125       36757      12481811
EST126       84106      31034635
EST127       84264      34515269
EST128       33711      11378339
EST129       85031      32709177
EST13        186775     83515461
EST130       82017      34968192
EST131       83454      35266094
EST132       84118      32965334
EST133       14468      5903340
EST134       83460      51063090
EST135       173481     87480434
EST136       170378     77656565
EST137       146503     92405772
EST138       28666      18158607
EST139       141402     87644345
EST14        104666     47796016
EST140       149169     98038750
EST141       157781     78491749
EST142       180947     92630877
EST143       7809       4568886
EST144       141652     76089203
EST145       151600     73212463
EST146       148400     87046443
EST147       155872     83630976
EST148       11550      6810689
EST149       166186     102136895
EST15        197334     111632923
EST150       202211     107329025
EST151       158885     93296243
EST152       102216     51071043
EST153       156473     79478757
EST154       135311     80239330
EST155       141446     88012873
EST156       166518     86082889
EST157       7780       4492262
EST158       179041     104197304
EST159       218733     94431044
EST16        147209     104729060
EST160       145808     85870166
EST161       161419     87629009
EST162       2881       1405734
EST163       140904     82600306
EST164       133037     84115331
EST165       147197     88183849
EST166       146344     80519535
EST167       20047      10151922
EST168       117769     61073260
EST169       115690     61941713
EST17        156572     83431034
EST170       122419     54128062
EST171       121107     48630686
EST172       29423      11431564
EST173       122215     48678047
EST174       125703     48478095
EST175       165762     83297665
EST176       172200     75566620
EST177       24701      15540946
EST178       147743     104364925
EST179       163429     99358064
EST18        191133     116914855
EST180       205284     116217156
EST181       167204     93396394
EST182       154071     103341968
EST183       134240     92949965
EST184       10672      5956502
EST185       146642     94153416
EST186       155031     80976156
EST187       132039     71141342
EST188       160889     90606816
EST189       13157      8318140
EST19        177385     113034633
EST190       148885     87668246
EST191       153770     95507815
EST192       175569     99208167
EST193       140565     77269449
EST194       4787       3937199
EST195       124049     64324468
EST196       162986     91001193
EST197       172959     99449352
EST198       149725     92920886
EST199       5972       3763796
EST2         157294     60515133
EST20        70833      55594967
EST200       165077     79250588
EST201       122391     84352364
EST202       163499     96411266
EST203       163942     96037285
EST204       13937      6668670
EST205       5847       2580354
EST206       111210     63109502
EST207       151258     87141554
EST208       107046     63442451
EST209       164567     100983680
EST21        194467     109200353
EST210       168503     124867991
EST211       82159      66786101
EST212       186522     95181519
EST213       145766     90574874
EST214       86781      65214858
EST215       141936     85229954
EST216       137996     75168597
EST217       95484      30656388
EST218       146951     86298614
EST219       149234     82714699
EST22        179940     92457377
EST220       141191     94332052
EST221       156023     90298582
EST222       8574       6134787
EST223       162088     99653428
EST224       153953     93687394
EST225       123359     88331915
EST226       145963     90179428
EST227       6829       4133477
EST228       128898     82067873
EST229       127965     89748598
EST23        107170     50424590
EST230       44286      31824886
EST231       156430     83332027
EST232       167399     92029681
EST233       166930     92691512
EST234       158124     88082424
EST235       163896     91508682
EST236       163228     92242200
EST237       166033     91294921
EST238       154891     85088026
EST239       168030     90687163
EST24        191019     61404489
EST240       187909     98489047
EST241       191634     107203138
EST242       168058     100162600
EST243       180324     103395206
EST244       190067     112774100
EST245       186271     113269841
EST246       177969     115370580
EST247       6823       5405260
EST248       140678     86230531
EST249       212622     138844321
EST25        136507     39208104
EST250       226925     111316658
EST251       164069     113913134
EST252       183146     95756964
EST253       198080     98535367
EST254       122995     89266798
EST255       7420       5143960
EST256       140264     82389170
EST257       206368     112807460
EST258       162380     106263195
EST259       93796      92617953
EST26        102352     27614927
EST260       15103      19661197
EST261       147677     99225559
EST262       150845     89791238
EST263       139060     101685483
EST264       216355     99358875
EST265       4529       2802996
EST266       133641     96440141
EST267       130218     90891668
EST268       135817     98456038
EST269       113498     81468042
EST27        201361     85182682
EST270       16334      10302901
EST271       136074     84237789
EST272       126197     86196946
EST273       128323     97050498
EST274       35670      25454263
EST275       126736     89458518
EST276       116536     79046724
EST277       139019     83785438
EST278       145795     114764182
EST279       15520      10975069
EST28        19773      8874629
EST280       125388     117381359
EST281       132658     98908640
EST282       162514     97700191
EST283       165607     104413716
EST284       18919      11863137
EST285       142285     92456214
EST286       169004     115153071
EST287       151628     103870677
EST288       136300     103171057
EST289       3411       2247987
EST29        203774     100081169
EST290       159541     97224651
EST291       222465     90720377
EST292       152865     111339324
EST293       160396     71799076
EST294       10553      1193300
EST295       208919     37982085
EST296       212168     83253851
EST297       150194     115334993
EST298       168070     97736830
EST299       154876     103183719
EST3         156026     54734733
EST30        216496     109027723
EST300       169010     109940649
EST301       149577     109937373
EST302       2047       1383922
EST303       180827     102281924
EST304       178602     93097581
EST305       168947     109496172
EST306       158905     104112356
EST307       2301       1836837
EST308       226903     106725089
EST309       267054     116129355
EST31        154021     67128068
EST310       184680     111793289
EST311       150001     28271688
EST312       229940     100512738
EST313       174951     100179676
EST314       156364     99977355
EST315       158624     94456753
EST316       166394     114093378
EST317       179942     95197248
EST318       143687     97189386
EST319       188156     110324042
EST32        149408     63700868
EST320       187330     49206581
EST321       201871     33888691
EST322       174430     95507560
EST323       14499      9114509
EST324       158346     113326097
EST325       184784     110470367
EST326       167585     97771317
EST327       165651     109621930
EST328       165922     71417216
EST329       127843     80161184
EST33        165215     65707574
EST330       121728     80853125
EST331       146532     101245025
EST332       21820      7774986
EST333       250640     26635193
EST334       254708     23392102
EST335       151991     94206454
EST336       152235     98594976
EST337       151209     99840551
EST338       145953     92202538
EST339       237888     43423594
EST34        147091     64543076
EST340       185289     81055476
EST341       3831       4735967
EST342       168933     99821815
EST343       163873     101087370
EST344       145612     92727124
EST345       189485     103146623
EST346       156145     109738093
EST347       153432     101614360
EST348       2288       864923
EST349       184471     108452053
EST35        162685     70898185
EST350       169884     94645155
EST351       169244     105166617
EST352       178324     59608381
EST353       195038     71941256
EST354       194528     75305704
EST355       197065     74426894
EST356       135405     70508640
EST357       174807     127367579
EST358       148414     85118544
EST359       150556     86650597
EST36        160539     65861740
EST360       121467     94921597
EST361       5845       4638473
EST362       142908     94503918
EST363       155404     94371977
EST364       162321     90297561
EST365       157495     100342924
EST366       22567      9986532
EST367       45656      24624838
EST368       155308     104544223
EST369       138149     97255037
EST37        107944     33683544
EST370       158633     102056658
EST371       152663     109858372
EST372       29680      25288248
EST373       173564     146756127
EST374       163564     85431758
EST375       127677     80996734
EST376       137841     94057317
EST377       51157      35811072
EST378       131619     88276056
EST379       137447     89871154
EST38        99513      30489629
EST380       139754     97233001
EST381       147706     97347466
EST382       49930      40332362
EST383       164182     86552371
EST384       143622     81415127
EST385       144915     86073821
EST386       144157     103713157
EST387       155646     93181756
EST388       137963     87470976
EST389       133431     84870432
EST39        99153      31399282
EST390       19448      11945202
EST391       196902     107235645
EST392       137014     75086496
EST393       92962      54579752
EST394       120552     80253239
EST395       23222      14225572
EST396       131518     83245448
EST397       119611     76575368
EST398       147506     80759467
EST399       210530     82593877
EST4         142938     56345501
EST40        98816      29786707
EST400       29795      12545416
EST401       163649     84380495
EST402       163929     99177970
EST403       159177     95841266
EST404       125973     81299685
EST405       12110      7935207
EST406       129506     86704326
EST407       137484     90244035
EST408       178709     111928688
EST409       154288     93121919
EST41        39234      11599533
EST410       27624      12033186
EST411       166658     91952291
EST412       168798     124868987
EST413       87450      56185339
EST414       69678      41107319
EST415       34158      16817373
EST416       137675     80049361
EST417       82268      49325811
EST418       139989     56900987
EST419       148868     30145031
EST42        101326     31351096
EST420       148732     30447487
EST421       163341     80758198
EST422       25882      13994606
EST423       201236     115851401
EST424       237754     108749660
EST425       220126     107466859
EST426       127110     74510970
EST427       128057     85803248
EST428       131704     80409324
EST429       93228      56881081
EST43        102633     36243427
EST430       173975     110008863
EST431       213030     84734194
EST432       106810     28527327
EST433       184604     112683361
EST434       204032     111425126
EST435       179047     105682535
EST436       197423     116761422
EST437       134572     63148204
EST438       110907     60524263
EST439       162601     108614110
EST44        95475      48218258
EST440       181510     116038684
EST441       107719     85697863
EST442       177578     140349548
EST443       150447     90322050
EST444       53524      34057685
EST445       166324     107087931
EST446       178587     101256659
EST447       42327      24215122
EST448       195643     106683981
EST449       185000     94875495
EST45        121121     52335541
EST450       50905      38186851
EST451       189907     115816753
EST452       180028     118006489
EST453       54560      33977145
EST454       196573     133887305
EST455       219858     123775639
EST456       190129     126982964
EST457       183837     144586907
EST458       204235     155997292
EST459       192463     115363460
EST46        55810      33167886
EST460       161320     96627740
EST461       181301     94469393
EST462       6514       541380
EST463       53496      4381716
EST464       158232     12239421
EST465       144975     12987161
EST466       148608     30079541
EST467       149063     29643665
EST468       7062       1471579
EST469       148744     30417064
EST47        177020     89152389
EST470       141959     81858084
EST471       172661     101046443
EST472       161280     110585728
EST473       17077      12231595
EST474       160825     92803556
EST475       150648     104118732
EST476       133685     93217910
EST477       141794     98144377
EST478       16200      8333478
EST479       157157     103510844
EST48        158156     65087434
EST480       146227     105186557
EST481       161980     97553210
EST482       165874     51113462
EST483       12282      1932641
EST484       160517     40369185
EST485       150815     102160424
EST486       146721     96562650
EST487       170801     112275584
EST488       21806      11812767
EST489       132815     75920561
EST49        162318     92154071
EST490       189715     107933025
EST491       149560     109195789
EST492       53160      36077311
EST493       126855     87064282
EST494       145577     90234473
EST495       148608     89434104
EST496       163475     89083574
EST497       35424      18054695
EST498       151814     92135788
EST499       156183     92080965
EST5         162082     62608784
EST50        154343     80230369
EST500       168394     101996402
EST501       136268     85441647
EST502       15668      8801102
EST503       100266     71178650
EST504       78634      60627274
EST505       97503      64771452
EST506       143432     80472324
EST507       37129      21174627
EST508       120968     73589785
EST509       133541     87504697
EST51        156434     74815564
EST510       135322     79344957
EST511       151966     92813762
EST512       45965      25226580
EST513       155676     85797389
EST514       184681     110501583
EST515       120275     78975961
EST516       178599     94870924
EST517       5472       2068756
EST518       52576      18674859
EST519       183137     100957942
EST52        108175     61178993
EST520       152175     81363374
EST521       22458      13592932
EST522       162316     94446797
EST523       211757     123975299
EST524       29664      19024876
EST525       147952     99622109
EST526       158950     98067836
EST527       134284     87368944
EST528       128632     87802150
EST529       25678      16071401
EST53        153907     88947354
EST530       179560     74468277
EST531       179121     79605250
EST532       198821     83560789
EST533       194805     80470030
EST534       3280       1144491
EST535       178841     95307232
EST536       174407     102458892
EST537       180222     107874027
EST538       171896     103671986
EST539       196696     126518824
EST54        154265     84990557
EST540       186164     103323533
EST541       178872     82793691
EST542       146564     93624885
EST543       206771     125126638
EST544       205624     126733200
EST545       188949     108252864
EST546       208319     121337435
EST547       34072      17688009
EST548       154068     96424423
EST549       187947     117401468
EST55        152201     92256141
EST550       166655     99005330
EST551       133842     98224898
EST552       8916       7253889
EST553       157240     92159075
EST554       170464     84942643
EST555       149142     85090487
EST556       151163     81932683
EST557       11887      7106830
EST558       156643     80037173
EST559       181306     106392845
EST56        149962     69910171
EST560       162463     103032191
EST561       175342     108161051
EST562       3265       2193046
EST563       170740     117103699
EST564       183914     113636430
EST565       129050     83670403
EST566       169422     97775191
EST567       184959     110599310
EST568       36235      23666360
EST569       204465     119127975
EST57        142200     76730860
EST570       269542     91763948
EST571       25664      9425377
EST572       262943     83717893
EST573       157488     57559226
EST574       162301     59144259
EST575       80398      30735657
EST58        151702     83209748
EST59        161189     65789374
EST6         166267     65037339
EST60        144565     70124844
EST61        160487     90001957
EST62        150435     92621597
EST63        150089     99320726
EST64        157731     94531135
EST65        2397       992589
EST66        154803     103449832
EST67        163009     82999675
EST68        166573     84863254
EST69        142258     77778692
EST7         163878     67752112
EST70        148469     82574868
EST71        149056     86144188
EST72        148550     92242235
EST73        150768     87593603
EST74        2767       1630284
EST75        29919      18235506
EST76        186707     102811942
EST77        170458     90758531
EST78        212600     115717827
EST79        179457     103369706
EST8         160931     67798598
EST80        2123       1442005
EST81        196745     121640362
EST82        167564     93350039
EST83        136131     63336816
EST84        128099     62635550
EST85        11016      5645786
EST86        150359     92610323
EST87        154646     96984150
EST88        130214     66325764
EST89        140261     89341569
EST9         169418     69380160
EST90        14381      7458009
EST91        183467     91897835
EST92        204521     119847865
EST93        202012     107982494
EST94        192027     90407181
EST95        204070     87102143
EST96        145885     86968514
EST97        137843     84893226
EST98        158617     76448051
EST99        9280       6073374
GSS1         172832     126575132
GSS10        14980      14463402
GSS100       169231     144356515
GSS101       157749     108935751
GSS102       155985     106347536
GSS103       152502     105561845
GSS104       168005     122783070
GSS105       149804     126570500
GSS106       162066     125204781
GSS107       186623     116025316
GSS108       16058      9820533
GSS109       185735     119778325
GSS11        146494     107085566
GSS110       201336     103953762
GSS111       219954     124091627
GSS112       87417      56990793
GSS113       152238     114271565
GSS114       155173     118809397
GSS115       155139     118869811
GSS116       163366     106680649
GSS117       37173      21505622
GSS118       179780     132238950
GSS119       189809     117152112
GSS12        200835     104101173
GSS120       166036     55081336
GSS121       169957     76572607
GSS122       2295       1480054
GSS123       161723     105208392
GSS124       189169     124964186
GSS125       200745     81604444
GSS126       167188     79936559
GSS127       137268     94431217
GSS128       129855     104605133
GSS129       132043     108777560
GSS13        192062     84601331
GSS130       132451     106048276
GSS131       8056       5958858
GSS132       135214     112032054
GSS133       56598      47104660
GSS134       132584     107786768
GSS135       139149     116140565
GSS136       140043     114408742
GSS137       138251     109584898
GSS138       4155       2820771
GSS139       134784     106426486
GSS14        173265     89245149
GSS140       134049     108003847
GSS141       134400     111531585
GSS142       138188     116474348
GSS143       4675       3643453
GSS144       139468     108106612
GSS145       136810     113648547
GSS146       136898     113473892
GSS147       137299     112649085
GSS148       559        466085
GSS149       137155     110923756
GSS15        167983     83930679
GSS150       134480     106278327
GSS151       133002     107665198
GSS152       138659     116136290
GSS153       1985       1674795
GSS154       127182     92203837
GSS155       174080     105026233
GSS156       184435     110103307
GSS157       162417     108627913
GSS158       177494     102481389
GSS159       197022     129307000
GSS16        160060     81615096
GSS160       201458     133365835
GSS161       200723     134048006
GSS162       179465     125486286
GSS163       198341     136948587
GSS164       196713     139067120
GSS165       196065     138672070
GSS166       174298     134353538
GSS167       144587     97412907
GSS168       138114     80517957
GSS169       165347     73456578
GSS17        156174     85673627
GSS170       130087     57900795
GSS171       163014     141019316
GSS172       170951     113528738
GSS173       80811      52919501
GSS174       191881     129015715
GSS175       196554     117983862
GSS176       28456      14940540
GSS177       180225     98140530
GSS178       181302     123365801
GSS179       178800     126906476
GSS18        152981     95677320
GSS180       181098     127179984
GSS181       19114      12799890
GSS182       165902     130533276
GSS183       170977     155597399
GSS184       219919     123799690
GSS185       216581     103401654
GSS186       17290      8049466
GSS187       210015     95106166
GSS188       156568     134374532
GSS189       6818       6760628
GSS19        153707     72745819
GSS190       125540     102753347
GSS191       122235     93469471
GSS192       156847     154495780
GSS193       167720     158232911
GSS194       131396     104305071
GSS195       149360     107958474
GSS196       170325     141788280
GSS197       174263     119970230
GSS198       20136      11688868
GSS199       181316     133971324
GSS2         173589     107819358
GSS20        106546     59105521
GSS200       184910     120116892
GSS201       180126     93029160
GSS202       172830     121726505
GSS203       189216     117024741
GSS204       189414     116726891
GSS205       21729      12651457
GSS206       200615     129990067
GSS207       215712     142629172
GSS208       217635     140382802
GSS209       166429     136402995
GSS21        132536     64638951
GSS210       152472     108704003
GSS211       159966     120564247
GSS212       160040     145460321
GSS213       158462     140421086
GSS214       160859     145750229
GSS215       162431     144534355
GSS216       163049     142910892
GSS217       159417     122903915
GSS218       168345     139695448
GSS219       161743     115993986
GSS22        125191     56725897
GSS220       180530     88689585
GSS221       2575       1768585
GSS222       251369     52150506
GSS223       262481     40466091
GSS224       262523     40408947
GSS225       122800     38229504
GSS226       253355     52912344
GSS227       182565     86129448
GSS228       188825     55952994
GSS229       154339     118463226
GSS23        134196     73094577
GSS230       177033     144334259
GSS231       160568     145787944
GSS232       159531     147010793
GSS233       174549     109955224
GSS234       238210     57319690
GSS235       198151     101373468
GSS236       229423     39758510
GSS237       119094     74590504
GSS238       174029     112048984
GSS239       147861     90042086
GSS24        143035     74371292
GSS240       140661     84073818
GSS241       159796     149652844
GSS242       5899       5023719
GSS243       112668     95722541
GSS244       180351     149222837
GSS245       172954     122407496
GSS246       201906     127716652
GSS247       188210     120275961
GSS248       166175     94403497
GSS249       159873     84506384
GSS25        12092      5172754
GSS250       156433     119872540
GSS251       203514     148104443
GSS252       14298      9398581
GSS253       171523     67875770
GSS254       176683     96454754
GSS255       195475     152072364
GSS256       199776     154504000
GSS257       7495       6183699
GSS258       197813     157229673
GSS259       197524     124135901
GSS26        140902     65659537
GSS260       194959     142650302
GSS261       611        422080
GSS262       214911     131530338
GSS263       189958     57638710
GSS264       218598     111928830
GSS265       170488     153872948
GSS266       163848     150141940
GSS267       234900     132469628
GSS268       240183     119740511
GSS27        159863     79841194
GSS28        156781     92818285
GSS29        165484     85429269
GSS3         138093     115755641
GSS30        9310       4808678
GSS31        171978     102877480
GSS32        182794     109078835
GSS33        182356     87082611
GSS34        172894     102149372
GSS35        191042     104301903
GSS36        162180     112295088
GSS37        160410     98257518
GSS38        173347     108755067
GSS39        3659       2625600
GSS4         140176     112446360
GSS40        183985     122974505
GSS41        181701     117299100
GSS42        52326      27358639
GSS43        177824     102907428
GSS44        164532     141986785
GSS45        179635     148566932
GSS46        139666     92482471
GSS47        182856     132009094
GSS48        181603     114543151
GSS49        204426     116967764
GSS5         11600      8663177
GSS50        185614     99479137
GSS51        211954     108037045
GSS52        211747     108318359
GSS53        197315     132797049
GSS54        158211     124808059
GSS55        185583     139405028
GSS56        196775     63137269
GSS57        171822     96460264
GSS58        157621     106112242
GSS59        23373      13575160
GSS6         152749     116375726
GSS60        166616     156645100
GSS61        177157     98801574
GSS62        161196     115202462
GSS63        172331     112351434
GSS64        175439     118751394
GSS65        184542     127843483
GSS66        205677     128792296
GSS67        188167     112097249
GSS68        200686     134224634
GSS69        215702     158336970
GSS7         170814     119984140
GSS70        189038     138024221
GSS71        173742     107642623
GSS72        198219     111980277
GSS73        140725     76414851
GSS74        163079     95884017
GSS75        10697      6814502
GSS76        159270     97756741
GSS77        159481     96970229
GSS78        172285     114351414
GSS79        170749     109399099
GSS8         177198     108971414
GSS80        174370     122402741
GSS81        188875     105213057
GSS82        174789     125779909
GSS83        164306     106587290
GSS84        1781       1416018
GSS85        189251     108546104
GSS86        180944     113833644
GSS87        167309     118209772
GSS88        193311     106233375
GSS89        8554       4944340
GSS9         141908     118712459
GSS90        213831     107550639
GSS91        227222     89202095
GSS92        213483     139456408
GSS93        182686     91963194
GSS94        94686      37020965
GSS95        193805     75823638
GSS96        201086     123394316
GSS97        191020     122180795
GSS98        156116     139401502
GSS99        16660      10968419
HTC1         41206      63404125
HTC2         32318      72275691
HTC3         32080      77890442
HTC4         84836      50647832
HTC5         129773     161432183
HTC6         125015     122865024
HTC7         137623     130766468
HTC8         67932      61167822
HTG1         3784       374870703
HTG10        2848       363016285
HTG11        1976       365940103
HTG12        1714       382089084
HTG13        1718       381796340
HTG14        1659       383118453
HTG15        1835       380424998
HTG16        1750       361896240
HTG17        1843       380599315
HTG18        1752       382301790
HTG19        1775       381824019
HTG2         5068       373604329
HTG20        1891       380883515
HTG21        2135       355865123
HTG22        2426       376351102
HTG23        2269       379507879
HTG24        2442       381163865
HTG25        2175       382733656
HTG26        2070       368006459
HTG27        2074       380458182
HTG28        2061       380108509
HTG29        1047       202962639
HTG3         2556       370662362
HTG30        2040       379446758
HTG31        2203       375546591
HTG32        986        170706729
HTG33        2152       379221269
HTG34        2348       376393195
HTG35        1372       195850538
HTG36        2462       370234045
HTG37        2428       372528369
HTG38        1015       169191937
HTG39        2235       381490266
HTG4         2735       369989641
HTG40        2336       385145188
HTG41        1069       180930974
HTG42        2312       384776536
HTG43        2363       384490832
HTG44        906        155597869
HTG45        2500       379735659
HTG46        2319       385244375
HTG47        927        158722850
HTG48        2315       385567657
HTG49        2293       386023883
HTG5         2500       373389217
HTG50        900        149450476
HTG51        2237       385154833
HTG52        2106       380011723
HTG53        657        122585305
HTG54        2010       379525743
HTG55        1981       378955508
HTG56        1184       193581815
HTG57        2144       380658486
HTG58        2686       383430148
HTG59        2973       383248998
HTG6         2          386956
HTG60        884        128257683
HTG61        2959       380503057
HTG62        3012       366231486
HTG63        2990       372824610
HTG64        2953       336850403
HTG65        3178       359117111
HTG66        3179       359260560
HTG67        3186       360427818
HTG68        3128       367889098
HTG69        2913       377859052
HTG7         2327       375791086
HTG70        1846       312468258
HTG71        3415       365492036
HTG72        2071       381329139
HTG73        1668       298160154
HTG74        2088       382520375
HTG75        2244       384445864
HTG76        1669       296247510
HTG77        2201       385233869
HTG78        2249       384504439
HTG79        3219       384192102
HTG8         1500       384347777
HTG80        2166       384708164
HTG81        3033       373087380
HTG82        2056       208001329
HTG9         1582       384062276
INV1         154214     140640933
INV10        14         359428768
INV100       32679      23464004
INV101       148923     103605739
INV102       152212     116398734
INV103       121751     83651264
INV104       154941     113616553
INV105       153605     120477844
INV106       54022      36075945
INV107       152799     109375436
INV108       153465     115493295
INV109       37197      32123644
INV11        9          363281720
INV110       141580     88513374
INV111       147770     93670302
INV112       43751      33362749
INV113       148100     97247951
INV114       139030     81413294
INV115       43128      25564228
INV116       138170     82625343
INV117       137814     82616392
INV118       54036      35679511
INV119       138821     83289431
INV12        52         355336707
INV120       135265     98788268
INV121       75087      58795734
INV122       141990     108087313
INV123       150956     120582485
INV124       156044     118329910
INV125       108799     225604215
INV126       7054       14257427
INV127       183035     236941459
INV128       216228     165877386
INV129       38629      187147326
INV13        14         371434550
INV130       800        42674647
INV131       566        40635863
INV132       8037       115580217
INV133       23329      332915377
INV134       23255      171962006
INV135       68041      305365919
INV136       123287     266863020
INV137       64375      76908791
INV138       180571     237306452
INV139       41592      302727004
INV14        78         134821644
INV140       315        394021049
INV141       1012       100307854
INV142       2059       383654064
INV143       2          41011863
INV144       587        361649714
INV145       8          378508614
INV146       974        354275690
INV147       6          380479040
INV148       2          95552909
INV149       22         390382246
INV15        6          384224499
INV150       10036      362338941
INV151       377        367082657
INV152       3415       40188607
INV153       1          685423969
INV154       1          640667275
INV155       1          639123876
INV156       1          612949391
INV157       1          577192767
INV158       1          641629864
INV159       497        320978344
INV16        14         379706462
INV160       2          371500015
INV161       2          289902239
INV162       2965       358959205
INV163       59277      333080486
INV164       34         383065485
INV165       19         393344928
INV166       14         327270017
INV167       27         393651567
INV168       32         390738662
INV169       24         383706785
INV17        31         388860819
INV170       25         382049854
INV171       31         378115211
INV172       13         297748085
INV173       18         387848160
INV174       24         381271345
INV175       36         390867092
INV176       34         389743485
INV177       26         391141334
INV178       19         292893418
INV179       11         371260264
INV18        11         377131664
INV180       19         391738068
INV181       12         391781067
INV182       13         372901688
INV183       32         389502837
INV184       22         330411078
INV185       29         389284801
INV186       38         387663352
INV187       17         367589223
INV188       12         387517245
INV189       17         362786034
INV19        3          241225934
INV190       10         320557524
INV191       13         376469258
INV192       35         380323776
INV193       26         392110963
INV194       24         388964019
INV195       21         391745060
INV196       22         309540561
INV197       27         392282931
INV198       24         388632304
INV199       12         375724207
INV2         2288       315894747
INV20        3          393880593
INV200       16         393313708
INV201       13         392068811
INV202       10         277290815
INV203       15         358735036
INV204       11         386907833
INV205       16         377160071
INV206       21         392427759
INV207       5          215849302
INV208       15         382505853
INV209       743        382889760
INV21        3          261336042
INV210       26         386022184
INV211       28         394591284
INV212       7          307846652
INV213       4          182170525
INV214       2          342421305
INV215       2          269826459
INV216       18         385786230
INV217       1901       346423963
INV218       8863       319021282
INV219       11615      311682508
INV22        3          322765503
INV220       29288      83527942
INV221       149749     106269296
INV222       152762     93799470
INV223       83465      48589229
INV224       151203     93782192
INV225       151094     109841000
INV226       59612      50546718
INV227       151668     123267883
INV228       149727     121589297
INV229       79775      64060773
INV23        2          265971290
INV230       149602     114005216
INV231       143939     122400158
INV232       78842      99846119
INV233       146013     123750475
INV234       99799      176099704
INV235       1896       379101147
INV236       3199       260759195
INV237       96781      321023124
INV238       217342     232110336
INV239       60949      250981301
INV24        4          328757598
INV240       104213     292697254
INV241       28749      364829410
INV242       1766       378350697
INV243       2736       196647685
INV244       184144     268358078
INV245       1785       378880292
INV246       5583       374469857
INV247       20768      153711624
INV248       288223     205808194
INV249       1224       379793465
INV25        5          378753109
INV250       4515       373876603
INV251       92490      210334617
INV252       391527     140904810
INV253       109733     258294965
INV254       62463      308727005
INV255       4162       375136162
INV256       44629      350112618
INV257       2155       4626806
INV258       298725     199657065
INV259       214334     249067665
INV26        5          371191486
INV260       2226       377046597
INV261       19303      366955288
INV262       16948      41978773
INV263       298408     186907243
INV264       1355       379516794
INV265       3687       378313727
INV266       136930     300095839
INV267       38349      357698579
INV268       664        92151452
INV269       8529       370827851
INV27        4          376987297
INV270       197744     256830145
INV271       359558     128682792
INV272       93023      322972837
INV273       2568       378355489
INV274       61847      343439542
INV275       110721     285908317
INV276       12         169407469
INV277       15         379655485
INV278       6          355188453
INV279       1          239744465
INV28        4          293537168
INV280       1          231634122
INV281       1          221096292
INV282       1          220877407
INV283       1          216720617
INV284       1          210676062
INV285       2          387811394
INV286       2          329972158
INV287       2          302384449
INV288       20         360081608
INV289       9          301825222
INV29        4          373434888
INV290       23         382490317
INV291       23         380735444
INV292       18         387931948
INV293       33         390736486
INV294       780        381140152
INV295       20         391287680
INV296       2          32244328
INV297       27         388830496
INV298       21         386972019
INV299       9          351834369
INV3         104809     182024877
INV30        47         389240333
INV300       5          163634948
INV301       1          292306469
INV302       1          164045107
INV303       2          318230244
INV304       855        391020194
INV305       30         391515590
INV306       25         383908286
INV307       25         388289419
INV308       3          49480870
INV309       25         384967207
INV31        25309      346462434
INV310       26         391482668
INV311       22         392427991
INV312       26         383547221
INV313       26         265978999
INV314       6          371290168
INV315       13         374069663
INV316       19         385560269
INV317       15         373391572
INV318       13         350978987
INV319       22         386100611
INV32        127810     103598195
INV320       24         386055502
INV321       23         389090030
INV322       31         366704932
INV323       12         307588661
INV324       24         393918543
INV325       16         362929629
INV326       8          361035446
INV327       13         369493806
INV328       13         384884009
INV329       18         390461886
INV33        167272     134294671
INV330       22         394170044
INV331       11         336163521
INV332       6          353407420
INV333       7          372089599
INV334       3          84055540
INV335       9          390324178
INV336       19         393988728
INV337       11         137914990
INV338       1          346874609
INV339       1          248688513
INV34        126789     112378558
INV340       1          195213701
INV341       21         389226046
INV342       16         380802157
INV343       17         384888603
INV344       24         390785021
INV345       14         272669524
INV346       19         394017224
INV347       17         391933486
INV348       7          291754234
INV349       2          360067285
INV35        37136      273256295
INV350       1          158111693
INV351       5          390880948
INV352       1          269711166
INV353       1          265788494
INV354       5          389225578
INV355       8          84827761
INV356       32         385162699
INV357       29         391336068
INV358       26         380265073
INV359       8          257485661
INV36        2779       371575686
INV360       20         383534539
INV361       18         388997674
INV362       13         372064491
INV363       12         246225518
INV364       18         394216238
INV365       18         380558243
INV366       10         378653212
INV367       35         286756574
INV368       50         386517834
INV369       41         394290459
INV37        44         370097852
INV370       30         391877099
INV371       23         388833300
INV372       17         384297034
INV373       16         391613329
INV374       12         375795023
INV375       18         391634427
INV376       20         380480634
INV377       22         271076993
INV378       29         389236155
INV379       23         387510109
INV38        24         379270378
INV380       25         393194949
INV381       29         393406758
INV382       10         389413895
INV383       12         256001243
INV384       25         382453876
INV385       25         387644779
INV386       17         390017898
INV387       13         185974631
INV388       1          252586203
INV389       2          382245123
INV39        5          76533839
INV390       1          170640157
INV391       3          172715237
INV392       1          265601162
INV393       1          235131548
INV394       8          377013040
INV395       18         389308576
INV396       6          76294397
INV397       2          316929497
INV398       5          371999024
INV399       13         377525467
INV4         59185      272955779
INV40        32         391299062
INV400       20         380130864
INV401       4          94235370
INV402       20         386111019
INV403       10         330750052
INV404       8          388492156
INV405       29         385235322
INV406       3          68204675
INV407       1          375708846
INV408       147        377882925
INV409       3          72566929
INV41        25         362900281
INV410       18         393806697
INV411       12         375328864
INV412       13         388485421
INV413       17         389690952
INV414       10         355855682
INV415       12         388165924
INV416       5          66893570
INV417       2          334507981
INV418       2          271847796
INV419       9          384970046
INV42        18         380479131
INV420       14         380331769
INV421       17         331062789
INV422       4          353245537
INV423       5          361980503
INV424       1          66459093
INV425       6          375950524
INV426       11         380698960
INV427       13         393299321
INV428       16         371834617
INV429       4          107829629
INV43        19         390062857
INV430       16         390859621
INV431       35         393136677
INV432       18         389411089
INV433       79         348191088
INV434       10         366985680
INV435       18         382945053
INV436       3          55752453
INV437       23         351194891
INV438       4          361297550
INV439       7          382899134
INV44        5          134896453
INV440       16         391635138
INV441       18         314878223
INV442       25         391765795
INV443       7          316364288
INV444       3          332270074
INV445       4          368005921
INV446       23         389089573
INV447       17         270136971
INV448       2          278332741
INV449       6          275271247
INV45        18         373966012
INV450       9          360027838
INV451       12         393015501
INV452       10         354694948
INV453       6          369954565
INV454       6          341098428
INV455       2          109343042
INV456       8          392102027
INV457       24         394471285
INV458       24         378149829
INV459       13         203497026
INV46        24         386582132
INV460       9          372379570
INV461       12         384804523
INV462       16         389458670
INV463       46         389323171
INV464       6          41869888
INV465       36         366039518
INV466       20         379859277
INV467       27         386406984
INV468       41         380881166
INV469       15         386326246
INV47        8          380395300
INV470       1          21660759
INV471       8          116281656
INV472       1          410988561
INV473       2          347081175
INV474       2          60458881
INV475       1          429819325
INV476       1          230177572
INV477       2          394052085
INV478       35         354776638
INV479       7          318208416
INV48        19         379365223
INV480       3          214479292
INV481       7          381813918
INV482       9          359428332
INV483       2          318574174
INV484       2          277111903
INV485       3          387176093
INV486       3          351940327
INV487       6          365463711
INV488       20090      279663127
INV49        9          138772803
INV5         37249      75746579
INV50        28         391443577
INV51        28         392100242
INV52        45         382097969
INV53        27         372689565
INV54        18         385206419
INV55        12         373566826
INV56        1          94407144
INV57        15         381614547
INV58        29         387067226
INV59        25         384930048
INV6         129081     165754942
INV60        18         381070342
INV61        96940      235208859
INV62        124249     97188162
INV63        28932      319690973
INV64        28941      347133943
INV65        20         388604938
INV66        15         389699299
INV67        16         252138391
INV68        34         391108664
INV69        71         392017627
INV7         207        346774014
INV70        24         388974367
INV71        21         381982755
INV72        20         377528210
INV73        24         388990901
INV74        29         394663938
INV75        27         393364049
INV76        23         381713426
INV77        134        350713408
INV78        4          381900476
INV79        24         389620287
INV8         85         322154899
INV80        33         393229173
INV81        9          344807465
INV82        23         323415557
INV83        32         372768847
INV84        20         384741007
INV85        25         385708546
INV86        29         388680045
INV87        22         323658394
INV88        25         386606940
INV89        22         384360764
INV9         3          136766944
INV90        22         375170777
INV91        31         394116451
INV92        20         281624502
INV93        11         364532943
INV94        14         378464462
INV95        38         390437780
INV96        20         259303673
INV97        35         382133951
INV98        38989      329147920
INV99        150715     102219903
MAM1         32388      323882267
MAM10        26814      24994146
MAM100       5          381968701
MAM101       4          345040697
MAM102       3          176472919
MAM103       6          356825309
MAM104       3          354814440
MAM105       3336       333279354
MAM106       66885      270491063
MAM107       67321      96527981
MAM108       1          179953079
MAM109       4          274800947
MAM11        13731      20581276
MAM110       4          294612101
MAM111       4          368804057
MAM112       5          360824188
MAM113       3          381844289
MAM114       4          323611747
MAM115       5          314441637
MAM116       8291       281091208
MAM12        3445       7368868
MAM13        107        699953
MAM14        20         277696380
MAM15        1          249270926
MAM16        2          343930246
MAM17        3          325384739
MAM18        1          90795278
MAM19        4          322903327
MAM2         22252      277073294
MAM20        4          298795355
MAM21        6          353843759
MAM22        5          329700903
MAM23        2          289079565
MAM24        3          348530310
MAM25        4          336581445
MAM26        5          375256260
MAM27        6          373952570
MAM28        8          377813420
MAM29        5          379300313
MAM3         2          316219032
MAM30        1          38035513
MAM31        5          285741626
MAM32        5          342804543
MAM33        8          370485433
MAM34        6          316655225
MAM35        4          238884849
MAM36        4          355768297
MAM37        6          355037276
MAM38        7          389945117
MAM39        6          319172640
MAM4         2          376685399
MAM40        5          323047396
MAM41        4          347221982
MAM42        5          288444151
MAM43        5          375232988
MAM44        5          248962388
MAM45        1          277956744
MAM46        1          154038104
MAM47        3          374028897
MAM48        2          298256496
MAM49        3          355148320
MAM5         2          295769989
MAM50        3          355658200
MAM51        3          369352591
MAM52        13         295784090
MAM53        54         7614329
MAM54        215        34073042
MAM55        431        71272130
MAM56        861        68509101
MAM57        1706       2411269
MAM58        6836       6159435
MAM59        110526     193401624
MAM6         2          385026516
MAM60        33167      281592591
MAM61        4          358286156
MAM62        5          387739617
MAM63        5          335893012
MAM64        6          364021592
MAM65        6          304412506
MAM66        10         386743576
MAM67        132599     153988220
MAM68        117954     169545135
MAM69        5871       5207043
MAM7         3          316699161
MAM70        1          716413629
MAM71        1          662751787
MAM72        1          611347268
MAM73        1          464895054
MAM74        1          288121652
MAM75        3          338107697
MAM76        1          223449203
MAM77        1          210645437
MAM78        1          201318998
MAM79        1          197708286
MAM8         5          343489620
MAM80        2          320231256
MAM81        2          293750401
MAM82        3          367535284
MAM83        4          351244600
MAM84        367        269065793
MAM85        1          203623556
MAM86        2          383513587
MAM87        4          383666147
MAM88        5          381503248
MAM89        263        390074346
MAM9         933        216317382
MAM90        2          265153725
MAM91        4          366992153
MAM92        5          369689861
MAM93        5          392803577
MAM94        6          298207437
MAM95        3          363734450
MAM96        1          118519168
MAM97        3          328935722
MAM98        4          359964523
MAM99        4          383777488
PAT1         420072     157363817
PAT10        304138     130867531
PAT100       352852     189327041
PAT101       310862     206556098
PAT102       261889     226571161
PAT103       130469     96637053
PAT104       304402     217824161
PAT105       276793     236021165
PAT106       255575     243191966
PAT107       219302     91982645
PAT108       185522     168147091
PAT109       194734     145573860
PAT11        235969     217001618
PAT110       98142      56009604
PAT111       244010     110313663
PAT112       143100     226369725
PAT113       78463      27201918
PAT114       88275      271848443
PAT115       224850     124890935
PAT116       225594     104823639
PAT117       1429       4493399
PAT118       247765     75673289
PAT119       230776     33741646
PAT12        83512      75761949
PAT120       94886      123403652
PAT121       98574      119749391
PAT122       81936      115812708
PAT123       203199     107726574
PAT124       26053      9049911
PAT125       203753     100524714
PAT126       183498     80758866
PAT127       117398     19496465
PAT128       249601     208803263
PAT129       386164     114645354
PAT13        242994     211781414
PAT130       52464      7541176
PAT131       283983     180108026
PAT132       123556     298380793
PAT133       110200     303234802
PAT134       393173     122391607
PAT135       290823     158915495
PAT136       12505      8419526
PAT137       287141     182646284
PAT138       409360     14039521
PAT139       496812     33315384
PAT14        328299     148441113
PAT140       525210     7878150
PAT141       153458     3896573
PAT142       377415     123797918
PAT143       245707     106305353
PAT144       259895     238802744
PAT145       4634       392128968
PAT146       190899     207809354
PAT147       308470     120437803
PAT148       140526     153750733
PAT149       6432       91696404
PAT15        63707      1592675
PAT150       177885     181303248
PAT151       71548      185117089
PAT152       75797      115786083
PAT153       75754      115775734
PAT154       46229      38674255
PAT155       245585     68642488
PAT156       201628     63082013
PAT157       264566     57807463
PAT158       309583     83974277
PAT159       458732     54677761
PAT16        197481     165317752
PAT160       227775     118065838
PAT161       360552     132693725
PAT162       287882     50231443
PAT163       154057     4622388
PAT164       229227     77275728
PAT165       228121     72916652
PAT166       281284     18699015
PAT167       64337      7031178
PAT168       153383     170227500
PAT169       73417      134980723
PAT17        217864     141819681
PAT170       74139      123431457
PAT171       137229     84274353
PAT172       175192     2627880
PAT173       234158     99492766
PAT174       198435     145143798
PAT175       229722     110406144
PAT176       105083     67822652
PAT177       80124      122466507
PAT178       260801     46024540
PAT179       294811     4422165
PAT18        217789     104558172
PAT180       7781       116715
PAT181       278538     10765362
PAT182       99590      135915739
PAT183       220910     105875731
PAT184       23917      35278529
PAT185       143999     206566501
PAT186       173285     186742155
PAT187       70129      243259642
PAT188       6542       8869371
PAT189       137168     133366031
PAT19        238917     105580979
PAT190       136594     204924247
PAT191       208575     98959238
PAT192       284104     31395226
PAT193       26280      42269494
PAT194       264589     66935450
PAT195       227269     82111943
PAT196       179588     5746816
PAT197       194343     81150933
PAT198       52350      9088688
PAT199       82690      146051882
PAT2         329685     203025577
PAT20        217522     131791310
PAT200       75930      116106222
PAT201       76058      115438165
PAT202       205771     85563217
PAT203       2801       56020
PAT204       342231     6844620
PAT205       341891     7168782
PAT206       341071     7503562
PAT207       331154     110021550
PAT208       268658     230373189
PAT209       282624     222310160
PAT21        295514     53562493
PAT210       192664     139614235
PAT211       276098     235021090
PAT212       188385     291326630
PAT213       137484     196232251
PAT214       247191     246690030
PAT215       11728      387687504
PAT216       313354     152356909
PAT217       244602     252477336
PAT218       160029     300870611
PAT219       215545     135077252
PAT22        146925     94683972
PAT220       172971     290885692
PAT221       266012     215701137
PAT222       351348     145812501
PAT223       304078     76036517
PAT224       317818     206630332
PAT225       43590      365712261
PAT226       151381     180550783
PAT227       338212     193787787
PAT228       332520     206353769
PAT229       155792     199233054
PAT23        196051     155681695
PAT230       249094     251157045
PAT231       209852     277995521
PAT232       262858     236722257
PAT233       313828     214462099
PAT234       164472     182083893
PAT235       218335     140106906
PAT236       284534     19076352
PAT237       283825     19293837
PAT238       106269     19050125
PAT239       281624     22162860
PAT24        279821     73243680
PAT240       286514     14630240
PAT241       287155     13479675
PAT242       96564      20012546
PAT243       263509     44902329
PAT244       293106     5569014
PAT245       293106     5569014
PAT246       123658     19117456
PAT25        228204     147409353
PAT26        209297     140270153
PAT27        62580      53901225
PAT28        304662     206975876
PAT29        321045     202870000
PAT3         50180      20260693
PAT30        69609      127456994
PAT31        217213     274043600
PAT32        399532     38379558
PAT33        255749     169048211
PAT34        232475     137936527
PAT35        62211      29249686
PAT36        159610     193120910
PAT37        187244     152014323
PAT38        212000     134509372
PAT39        97875      9820258
PAT4         329511     180386857
PAT40        349667     21562036
PAT41        269132     102155254
PAT42        166        390395449
PAT43        7285       386170321
PAT44        91553      5256860
PAT45        304606     19422510
PAT46        304621     19407682
PAT47        188156     183524069
PAT48        31139      33397375
PAT49        100021     274296388
PAT5         261927     200082814
PAT50        347914     22045690
PAT51        356635     6776065
PAT52        92431      1756189
PAT53        351487     15876250
PAT54        360979     6858601
PAT55        133552     2537488
PAT56        360626     6851894
PAT57        359974     6839506
PAT58        125418     2711844
PAT59        535700     100616524
PAT6         217647     164402205
PAT60        111356     330233433
PAT61        289774     158820679
PAT62        481510     50384146
PAT63        225628     89296979
PAT64        254551     194646755
PAT65        328369     204069827
PAT66        171734     140681449
PAT67        349862     190728733
PAT68        612603     75778089
PAT69        132887     40797313
PAT7         247422     122522282
PAT70        484033     127126269
PAT71        126354     109119371
PAT72        150168     307250321
PAT73        318626     211710240
PAT74        51881      214846609
PAT75        189165     289007376
PAT76        317843     207880789
PAT77        123868     129694058
PAT78        342751     192409991
PAT79        362616     180214431
PAT8         224285     103120736
PAT80        20467      17346132
PAT81        311143     212599739
PAT82        414691     138165335
PAT83        481329     57361173
PAT84        327289     49350302
PAT85        456880     82648416
PAT86        157574     115871211
PAT87        167196     186345594
PAT88        316168     151202056
PAT89        224216     179583881
PAT9         153311     78043594
PAT90        160892     40126467
PAT91        548289     10417491
PAT92        499577     9491963
PAT93        509422     32511534
PAT94        211221     45759082
PAT95        257687     203232161
PAT96        388298     141389415
PAT97        39463      44148194
PAT98        361773     186862184
PAT99        415062     154422395
PHG1         8914       216260788
PHG2         4805       223666272
PHG3         5303       216101949
PHG4         7771       238152117
PHG5         3421       151330418
PLN1         135045     172305967
PLN10        18921      157294990
PLN100       57         390189770
PLN101       11         373036233
PLN102       8          357693623
PLN103       6          351635285
PLN104       12         293471641
PLN105       78         341267500
PLN106       131        317758159
PLN107       124        358113214
PLN108       105        219857218
PLN109       196        355571810
PLN11        29377      278503063
PLN110       126        326901077
PLN111       75         366349697
PLN112       8          311786530
PLN113       117        351878453
PLN114       168        389953378
PLN115       83         391444557
PLN116       89         389460779
PLN117       142        373285858
PLN118       37         16871
PLN119       149        79314
PLN12        2658       334144218
PLN120       2469       93786416
PLN121       7181       18795412
PLN122       14346      29953091
PLN123       97686      209391101
PLN124       129456     90021506
PLN125       158989     148223727
PLN126       162795     146546909
PLN127       57609      31477802
PLN128       181655     125377433
PLN129       49816      254932253
PLN13        37         329935405
PLN130       41637      287857567
PLN131       71877      108804425
PLN132       98644      85504671
PLN133       49729      72847341
PLN134       25061      110565816
PLN135       13561      89764040
PLN136       1          774434471
PLN137       8305       28494037
PLN138       1861       361385154
PLN139       5          372618381
PLN14        46         124218893
PLN140       6          372447772
PLN141       6          368295254
PLN142       2          132503639
PLN143       428        311697900
PLN144       8          327823341
PLN145       6          343447962
PLN146       1          66465249
PLN147       1          474651383
PLN148       1          612216829
PLN149       1          571018318
PLN15        9          366014477
PLN150       1          574020038
PLN151       1          538550714
PLN152       1          514282554
PLN153       1          575541767
PLN154       131        336044503
PLN155       13436      306721111
PLN156       175202     124224769
PLN157       23716      15789680
PLN158       148447     156345649
PLN159       149692     145702591
PLN16        2395       340580897
PLN160       86487      71749507
PLN161       154563     132804814
PLN162       163972     118773191
PLN163       24516      26690245
PLN164       147691     134509689
PLN165       125620     155874192
PLN166       167303     121796894
PLN167       116023     120542165
PLN168       134594     149644253
PLN169       102159     121622355
PLN17        1949       233857567
PLN170       135892     149974629
PLN171       126630     163224490
PLN172       120529     166610792
PLN173       20143      18065287
PLN174       124346     164171902
PLN175       112939     173112638
PLN176       85826      158293970
PLN177       118924     172057219
PLN178       112287     186107308
PLN179       12351      318054410
PLN18        3          330514248
PLN180       18889      192078726
PLN181       19737      363518883
PLN182       10232      333664247
PLN183       302        288936846
PLN184       5          324373291
PLN185       1670       369972731
PLN186       1585       2233569
PLN187       1382       387001316
PLN188       8          179149947
PLN189       1282       232633870
PLN19        37         346663474
PLN190       1          522466905
PLN191       1          675310294
PLN192       1          628753756
PLN193       1          624247919
PLN194       1          599018945
PLN195       1          573247234
PLN196       1          634667502
PLN197       8563       149646365
PLN198       1          727344967
PLN199       1          946003158
PLN2         39532      282847162
PLN20        19733      84550131
PLN200       1          965754312
PLN201       1          906459801
PLN202       1          876148008
PLN203       1          885153844
PLN204       1          899925126
PLN205       1          528437893
PLN206       4140       344356697
PLN207       10         362580157
PLN208       4          120184706
PLN209       129        363593727
PLN21        96586      101383894
PLN210       404        366581476
PLN211       9          335385998
PLN212       130        308977848
PLN213       2          317663561
PLN214       1          192140685
PLN215       1          279860179
PLN216       1          259520967
PLN217       2          294703259
PLN218       1          238633233
PLN219       1          162496318
PLN22        113432     117615216
PLN220       1          420743833
PLN221       206        92200731
PLN222       16         383095167
PLN223       32         120825431
PLN224       1          541700351
PLN225       1          696809892
PLN226       1          655542733
PLN227       1          648987779
PLN228       1          622068216
PLN229       1          583456046
PLN23        57311      72144580
PLN230       1          654005093
PLN231       130        298375
PLN232       1          522466905
PLN233       1          675310294
PLN234       1          628753756
PLN235       1          624247919
PLN236       1          599018945
PLN237       1          573247234
PLN238       1          634667502
PLN239       313        95007523
PLN24        28689      28922869
PLN240       1          521073757
PLN241       1          672273650
PLN242       1          634137895
PLN243       1          624121443
PLN244       1          607506942
PLN245       1          564293627
PLN246       1          632401812
PLN247       1          520603772
PLN248       1          661076038
PLN249       1          626572591
PLN25        2648       194594881
PLN250       1          612852138
PLN251       1          598896166
PLN252       1          570629545
PLN253       1          623813090
PLN254       1          513014082
PLN255       1          653624577
PLN256       1          616219606
PLN257       1          610044819
PLN258       1          583417444
PLN259       1          550735148
PLN26        344        254550430
PLN260       1          620104558
PLN261       1          536602846
PLN262       1          671211297
PLN263       1          630677708
PLN264       1          623428415
PLN265       1          604298040
PLN266       1          558526623
PLN267       1          628419988
PLN268       1          500012378
PLN269       1          648922534
PLN27        400        261235914
PLN270       1          604770208
PLN271       1          597403059
PLN272       1          576456374
PLN273       1          556080982
PLN274       1          603311816
PLN275       1          512023576
PLN276       1          652551272
PLN277       1          615767531
PLN278       1          605571303
PLN279       1          592249714
PLN28        198        168828441
PLN280       1          549757368
PLN281       1          616509610
PLN282       1          550024188
PLN283       1          710194481
PLN284       1          661081403
PLN285       1          659460550
PLN286       1          630572514
PLN287       1          598618390
PLN288       1          658974642
PLN289       1          559656399
PLN29        298        258873545
PLN290       1          717517502
PLN291       1          672450454
PLN292       1          665297378
PLN293       1          636785599
PLN294       1          599706080
PLN295       1          675658265
PLN296       1          523168208
PLN297       1          495661851
PLN298       1          640830439
PLN299       1          597781253
PLN3         3694       380437784
PLN30        339        265493888
PLN300       1          600363860
PLN301       1          570178053
PLN302       1          534998810
PLN303       1          616598997
PLN304       1          537457279
PLN305       1          685947972
PLN306       1          649921694
PLN307       1          641099225
PLN308       1          611845738
PLN309       1          581041262
PLN31        485        350911896
PLN310       1          655783664
PLN311       1          521174834
PLN312       1          667717957
PLN313       1          631819663
PLN314       1          624692602
PLN315       1          597351075
PLN316       1          561737938
PLN317       1          629651422
PLN318       1          524514255
PLN319       1          670202054
PLN32        112        80604200
PLN320       1          631946783
PLN321       1          626743494
PLN322       1          600801835
PLN323       1          566971015
PLN324       1          629827058
PLN325       1          522114480
PLN326       1          671530377
PLN327       1          631910401
PLN328       1          622474059
PLN329       1          598240357
PLN33        455        379563194
PLN330       1          562137082
PLN331       1          633805855
PLN332       1          525723083
PLN333       1          684336246
PLN334       1          636053469
PLN335       1          629969872
PLN336       1          604087610
PLN337       1          568600391
PLN338       1          640498578
PLN339       1          519546829
PLN34        127        379253996
PLN340       1          665715246
PLN341       1          624683667
PLN342       1          621078253
PLN343       1          600910593
PLN344       1          558953701
PLN345       1          626840912
PLN346       1          543344542
PLN347       1          697540743
PLN348       1          655862368
PLN349       1          646765634
PLN35        91         241350431
PLN350       1          618540729
PLN351       1          587963859
PLN352       1          658085510
PLN353       439        378681748
PLN354       15         312691008
PLN355       20         111531882
PLN356       1          596211899
PLN357       1          705338699
PLN358       1          493450010
PLN359       1          804285258
PLN36        108        325736871
PLN360       1          810734643
PLN361       1          673981989
PLN362       1          754496630
PLN363       1          855759449
PLN364       1          614042580
PLN365       1          743847818
PLN366       1          673340788
PLN367       1          515668560
PLN368       1          713320806
PLN369       1          703598484
PLN37        17         390428741
PLN370       1          570159854
PLN371       1          625793224
PLN372       1          721110502
PLN373       1          459355444
PLN374       1          745201001
PLN375       1          749284433
PLN376       1          643344672
PLN377       1          595297365
PLN378       1          688905267
PLN379       1          491807393
PLN38        234        283333018
PLN380       1          769338634
PLN381       1          671568023
PLN382       1          635285330
PLN383       1          745618965
PLN384       1          839470345
PLN385       1          646400022
PLN386       1          747589525
PLN387       1          665179885
PLN388       1          506585010
PLN389       1          703962928
PLN39        161        383746871
PLN390       1          702438406
PLN391       1          568126671
PLN392       1          610851963
PLN393       1          707596419
PLN394       1          465558328
PLN395       1          734536914
PLN396       1          738743901
PLN397       1          636778132
PLN398       1          602900890
PLN399       1          697493198
PLN4         3521       387756969
PLN40        65         329728329
PLN400       1          490518203
PLN401       1          784661008
PLN402       1          810500911
PLN403       1          655314739
PLN404       1          752710991
PLN405       1          890847171
PLN406       1          621781073
PLN407       1          743084022
PLN408       1          676741658
PLN409       1          509452426
PLN41        16         386556087
PLN410       1          710124532
PLN411       1          480767623
PLN412       1          578021311
PLN413       1          620140791
PLN414       1          716573881
PLN415       1          476726550
PLN416       1          756324664
PLN417       1          977471539
PLN418       1          642207261
PLN419       1          502612092
PLN42        20         328777414
PLN420       1          646234737
PLN421       1          605172934
PLN422       1          593744788
PLN423       1          571972453
PLN424       1          545472572
PLN425       1          607667504
PLN426       1          590561804
PLN427       1          685720839
PLN428       1          490910922
PLN429       1          782694893
PLN43        6          376299569
PLN430       1          796420183
PLN431       1          650274702
PLN432       1          739889549
PLN433       1          848590828
PLN434       1          610626473
PLN435       1          738023571
PLN436       1          667607564
PLN437       1          506274898
PLN438       1          701434008
PLN439       1          690770133
PLN44        1          65870126
PLN440       1          567265955
PLN441       1          612987783
PLN442       1          704156067
PLN443       1          475327881
PLN444       1          732118298
PLN445       1          733931846
PLN446       1          636796232
PLN447       1          599764323
PLN448       1          691313424
PLN449       1          493357854
PLN45        93         388494695
PLN450       1          782685093
PLN451       1          786410271
PLN452       1          648139033
PLN453       1          744407562
PLN454       1          835583350
PLN455       1          623221719
PLN456       1          741299132
PLN457       1          669032550
PLN458       1          517040482
PLN459       1          711661679
PLN46        15         373888800
PLN460       1          708205786
PLN461       1          573398137
PLN462       1          583494258
PLN463       1          707105489
PLN464       1          471251328
PLN465       1          737453356
PLN466       1          736349413
PLN467       1          639162162
PLN468       1          586755746
PLN469       1          704478343
PLN47        9          363551984
PLN470       1          492109999
PLN471       1          791475352
PLN472       1          785940626
PLN473       1          661246824
PLN474       1          756990402
PLN475       1          858776195
PLN476       1          621195942
PLN477       1          754256086
PLN478       1          670301833
PLN479       1          509263899
PLN48        60         374148929
PLN480       1          708234589
PLN481       1          725120110
PLN482       1          575129590
PLN483       1          620883766
PLN484       1          727285804
PLN485       1          479660269
PLN486       1          745978486
PLN487       1          750160716
PLN488       1          642428577
PLN489       1          591313643
PLN49        14         212654302
PLN490       1          705330581
PLN491       1          495656580
PLN492       1          803232604
PLN493       1          790745243
PLN494       1          657494025
PLN495       1          759305888
PLN496       1          856542542
PLN497       1          628321883
PLN498       1          754364263
PLN499       1          697113365
PLN5         97749      201760120
PLN50        74         124609184
PLN500       1          504254270
PLN501       1          715354979
PLN502       1          713929667
PLN503       1          572943128
PLN504       1          626959190
PLN505       1          715714221
PLN506       1          483823121
PLN507       1          742917797
PLN508       1          748536659
PLN509       1          643784981
PLN51        8          358353307
PLN510       1          600654286
PLN511       1          685083685
PLN512       1          486317123
PLN513       1          794150360
PLN514       1          799857935
PLN515       1          655329108
PLN516       1          749763888
PLN517       1          838116175
PLN518       1          610468321
PLN519       1          736551279
PLN52        3          347496433
PLN520       1          666328382
PLN521       1          504826275
PLN522       1          702606209
PLN523       1          467876140
PLN524       1          566465558
PLN525       1          614421429
PLN526       1          698878671
PLN527       1          480431564
PLN528       1          735408736
PLN529       1          969998116
PLN53        4          370651368
PLN530       1          635024734
PLN531       10         3368
PLN532       1          595339094
PLN533       1          698605642
PLN534       1          499102108
PLN535       1          791748890
PLN536       1          797311483
PLN537       1          656817438
PLN538       1          753360318
PLN539       1          845838138
PLN54        2          271593360
PLN540       1          619661694
PLN541       1          752772853
PLN542       1          689709469
PLN543       1          509595892
PLN544       1          712797596
PLN545       1          710493282
PLN546       1          570643040
PLN547       1          619886155
PLN548       1          705533140
PLN549       1          484551304
PLN55        1          150766190
PLN550       1          740148362
PLN551       1          757233630
PLN552       1          642499559
PLN553       1          594006513
PLN554       1          693261537
PLN555       1          492948387
PLN556       1          781462734
PLN557       1          802944975
PLN558       1          650275864
PLN559       1          756841830
PLN56        2          288204953
PLN560       1          850623622
PLN561       1          614136911
PLN562       1          723255126
PLN563       1          669876730
PLN564       1          507533340
PLN565       1          712168462
PLN566       1          712339524
PLN567       1          564869106
PLN568       1          619418949
PLN569       1          715454519
PLN57        2          286787940
PLN570       1          478264344
PLN571       1          734693445
PLN572       1          749685439
PLN573       1          633598967
PLN574       191        140765345
PLN575       1          516505932
PLN576       1          665585731
PLN577       1          621516506
PLN578       1          610333535
PLN579       1          588218686
PLN58        2          295931502
PLN580       1          561794515
PLN581       1          632540561
PLN582       118        87991
PLN583       1          313789095
PLN584       1          248068439
PLN585       1          241454477
PLN586       1          251811976
PLN587       1          225452224
PLN588       1          173806927
PLN589       2          370152128
PLN59        50         360868274
PLN590       158        374282142
PLN591       599        391596749
PLN592       10         362580157
PLN593       7          281547701
PLN594       1          314258027
PLN595       1          394306295
PLN596       1          325599754
PLN597       1          288763641
PLN598       1          187311108
PLN599       1          277174932
PLN6         111696     128135306
PLN60        8          373615720
PLN600       1          235078182
PLN601       15         332895745
PLN602       16436      36185494
PLN603       5636       1862075
PLN604       5224       2478918
PLN605       1          563502314
PLN606       833        298337632
PLN607       1194       92707173
PLN608       1          594102056
PLN609       1          689851870
PLN61        7          376229618
PLN610       1          495453186
PLN611       1          780798557
PLN612       1          801256715
PLN613       1          651852609
PLN614       1          750843639
PLN615       1          830829764
PLN616       1          615552423
PLN617       1          744588157
PLN618       1          673617499
PLN619       1          509857067
PLN62        6          342806685
PLN620       1          709773743
PLN621       1          713149757
PLN622       1          566080677
PLN623       1          618079260
PLN624       1          720988478
PLN625       1          473592718
PLN626       1          736706236
PLN627       1          750620385
PLN628       1          638686055
PLN629       1          480980714
PLN63        6          347730275
PLN630       6684       330577769
PLN631       3760       370633860
PLN632       10097      326490424
PLN633       1753       12315783
PLN634       1          585266722
PLN635       1          681112512
PLN636       1          775448786
PLN637       1          790338525
PLN638       1          746673839
PLN639       1          836514780
PLN64        6          350661716
PLN640       1          736872137
PLN641       1          676292951
PLN642       1          669155517
PLN643       1          701372996
PLN644       1          615672275
PLN645       1          698614761
PLN646       1          728031845
PLN647       1          722970987
PLN648       12302      8480478
PLN649       94663      142071821
PLN65        43         144640005
PLN650       109265     181590851
PLN651       90304      195853653
PLN652       80527      197998663
PLN653       98715      191422274
PLN654       102271     190171111
PLN655       101947     188417681
PLN656       9926       22165276
PLN657       89526      204547491
PLN658       88989      203757767
PLN659       74454      219786613
PLN66        144        326417895
PLN660       30501      81358955
PLN661       71656      229068958
PLN662       75969      213199658
PLN663       60740      236629293
PLN664       74955      225372317
PLN665       51887      244696093
PLN666       15923      50601146
PLN667       62147      232657038
PLN668       43872      259925927
PLN669       53511      264485593
PLN67        7          298887356
PLN670       18746      68775490
PLN671       61848      155149450
PLN672       4          357989979
PLN673       5          248779719
PLN674       1          532083992
PLN675       1          684376481
PLN676       1          642597466
PLN677       1          631979072
PLN678       1          607115911
PLN679       1          582960187
PLN68        6          332369654
PLN680       1          640026769
PLN681       1          608979116
PLN682       1          720972993
PLN683       1          501257520
PLN684       1          804602427
PLN685       1          808121247
PLN686       1          649118519
PLN687       1          758906661
PLN688       1          861141126
PLN689       1          642382296
PLN69        50         340388796
PLN690       1          759893476
PLN691       1          689766370
PLN692       1          531462149
PLN693       1          714517032
PLN694       1          717288350
PLN695       1          586345039
PLN696       1          626266972
PLN697       1          738085275
PLN698       1          505809789
PLN699       1          759124079
PLN7         64151      184698553
PLN70        34         333743749
PLN700       1          751612808
PLN701       1          653055523
PLN702       7          358620060
PLN703       674        378721715
PLN704       1          322486422
PLN705       1          260047251
PLN706       1          262402055
PLN707       1          330012911
PLN708       1          349800169
PLN709       1          354403191
PLN71        1          48961553
PLN710       1          317988395
PLN711       1          376468909
PLN712       297        341997202
PLN713       6          385538869
PLN714       18         375740512
PLN715       12         364214839
PLN716       51         171035642
PLN717       38         343074766
PLN718       5          325733636
PLN719       11         384023275
PLN72        195        309764478
PLN720       10         375480087
PLN721       10         379071384
PLN722       9          351388705
PLN723       125        364494783
PLN724       10         394439500
PLN725       10         375932913
PLN726       10         373983960
PLN727       10         369372075
PLN728       37245      264839939
PLN73        6          336790634
PLN74        5          336035871
PLN75        6          326965702
PLN76        5          304407451
PLN77        13         303962775
PLN78        5          284426683
PLN79        8          327303441
PLN8         21750      106937494
PLN80        61         76849044
PLN81        2          355063454
PLN82        1          333667882
PLN83        1          302574826
PLN84        1          296818136
PLN85        1          257455782
PLN86        1          252943167
PLN87        1          225803546
PLN88        1          219123305
PLN89        2          394302667
PLN9         35233      291274408
PLN90        38         30696039
PLN91        15         305289289
PLN92        2          286029496
PLN93        2          307738366
PLN94        2          269669619
PLN95        1          157681923
PLN96        40         376080648
PLN97        33         389701062
PLN98        106        384154506
PLN99        99         346737635
PRI1         23047      60053106
PRI10        2265       387936439
PRI11        4375       381717987
PRI12        2068       191950792
PRI13        2459       391017609
PRI14        17343      243216304
PRI15        27929      79132073
PRI16        96050      166265556
PRI17        11025      363947920
PRI18        3741       383223079
PRI19        15303      353911286
PRI2         23840      319341223
PRI20        2239       172855211
PRI21        1          250749103
PRI22        1          238414537
PRI23        2          387789264
PRI24        2          351926207
PRI25        2          301224727
PRI26        2          270924633
PRI27        3          376243325
PRI28        4          374251276
PRI29        5          290585290
PRI3         2613       370370379
PRI30        42409      314482865
PRI31        18912      23568975
PRI32        53141      193817517
PRI33        4          351860731
PRI34        5          337827736
PRI35        3          297245061
PRI36        3          382019003
PRI37        2          285375381
PRI38        2          306826759
PRI39        2          354172067
PRI4         2409       360399901
PRI40        2          394680893
PRI41        1          242696752
PRI42        1          248387328
PRI43        17506      351876446
PRI44        118269     177479229
PRI45        43852      90882728
PRI46        74330      199952244
PRI47        54429      215566213
PRI48        34622      144332518
PRI49        69722      214218466
PRI5         2593       353874487
PRI50        97141      191928360
PRI51        158        230113596
PRI52        1          190673448
PRI53        9368       358512524
PRI54        48771      211007198
PRI55        83915      189800930
PRI56        58592      119478970
PRI6         2112       282951291
PRI7         2729       356953890
PRI8         3181       362167571
PRI9         2423       385530941
ROD1         38451      309764896
ROD10        15053      352243468
ROD11        1336       2453179
ROD12        22213      347967024
ROD13        1002       157743814
ROD14        53466      238707384
ROD15        21658      310382782
ROD16        228381     97417834
ROD17        97011      65140425
ROD18        38009      248623028
ROD19        2          383374219
ROD2         1810       346957759
ROD20        2          353017828
ROD21        2          317259772
ROD22        2          289653994
ROD23        1          140975125
ROD24        3          385591618
ROD25        4          335044383
ROD26        5          356599364
ROD27        2          394024503
ROD28        2          369416674
ROD29        2          335852806
ROD3         1885       352024250
ROD30        2          300392300
ROD31        2          283621167
ROD32        3          348161973
ROD33        5          386542915
ROD34        154        237877425
ROD35        1          193958709
ROD36        2          350925653
ROD37        2          319642044
ROD38        2          276360533
ROD39        3          382322699
ROD4         1943       360884621
ROD40        3          366447402
ROD41        84         245931526
ROD42        2          348668775
ROD43        2          314889876
ROD44        3          389462371
ROD45        3          321351180
ROD46        1          93020901
ROD47        5          385423505
ROD48        6          342729329
ROD49        3          325864489
ROD5         1990       363733749
ROD50        4          358685719
ROD51        4          302148481
ROD52        5          337904903
ROD53        6          385168143
ROD54        6          347801590
ROD55        6          283624907
ROD56        64732      199377972
ROD57        1          203594213
ROD58        2          307631349
ROD59        2          273205312
ROD6         306        57843793
ROD60        2          272523522
ROD61        3          367476852
ROD62        3          318205593
ROD63        5          305035074
ROD64        2          318173246
ROD65        2          308990189
ROD66        2          273361793
ROD67        3          387778067
ROD68        3          350884214
ROD69        4          388911322
ROD7         1975       368354297
ROD70        4          237246301
ROD71        2          368078907
ROD72        2          295232279
ROD73        2          276158786
ROD74        3          370764878
ROD75        3          367374895
ROD76        5          389069045
ROD77        20543      154840115
ROD8         1990       369693686
ROD9         1959       368016559
STS1         170456     86853136
STS10        202215     61355397
STS11        167032     59462482
STS2         143554     63344283
STS3         8245       4839643
STS4         108725     63673512
STS5         110379     70040590
STS6         106166     81423611
STS7         122521     86625645
STS8         198741     60873501
STS9         8954       2431337
SYN1         54442      100617525
SYN10        2          382762979
SYN11        2          332214168
SYN12        4          386933112
SYN13        1          271050050
SYN14        2          294093621
SYN15        3          329883353
SYN16        4          353920981
SYN17        2          328712085
SYN18        4          357672913
SYN19        1          207870274
SYN2         1          271050050
SYN20        2          382762979
SYN21        2          332214168
SYN22        8          392789107
SYN23        65482      196007195
SYN24        894        34300580
SYN25        9183       352928592
SYN26        17218      334475810
SYN27        109363     160506319
SYN28        32874      97953896
SYN29        8599       242419983
SYN3         2          294093621
SYN4         3          329883353
SYN5         4          353920981
SYN6         1          64242768
SYN7         3          371658272
SYN8         2          250483958
SYN9         1          207870274
TSA1         233379     79653713
TSA10        168620     151882439
TSA100       63252      114802277
TSA101       79841      41351312
TSA102       82721      28609319
TSA103       67721      19747702
TSA104       84021      22863253
TSA105       84236      21912832
TSA106       84446      20981295
TSA107       134042     46621688
TSA108       155667     149676184
TSA109       183730     101083950
TSA11        157833     129928381
TSA110       47348      107503283
TSA111       136867     166252974
TSA112       166495     124901244
TSA113       97423      237859520
TSA114       99257      234633653
TSA115       12708      5978473
TSA116       134189     172362066
TSA117       127781     180160426
TSA118       129595     177105775
TSA119       121186     168272985
TSA12        96970      81223522
TSA120       161588     123667649
TSA121       122311     187541168
TSA122       147961     145186533
TSA123       94592      61300137
TSA124       136202     168455642
TSA125       159235     124954199
TSA126       156460     125810552
TSA127       123500     121448801
TSA13        144445     166877725
TSA14        183179     128348861
TSA15        63956      19389564
TSA16        207559     109270376
TSA17        186915     104023410
TSA18        49380      65170400
TSA19        154738     149587836
TSA2         222489     88761403
TSA20        216986     100238238
TSA21        205873     104166326
TSA22        22693      12535715
TSA23        158964     127360041
TSA24        173318     148890122
TSA25        214965     83902995
TSA26        105827     75169883
TSA27        172910     71716168
TSA28        221930     89798997
TSA29        26888      19147632
TSA3         74606      22549982
TSA30        203801     105213489
TSA31        180460     145757585
TSA32        69461      30780900
TSA33        188249     126080028
TSA34        147105     171156456
TSA35        162844     143034354
TSA36        150188     161796191
TSA37        167342     152072055
TSA38        141406     134174466
TSA39        170369     157568728
TSA4         200107     117397278
TSA40        68539      95284697
TSA41        171892     122248327
TSA42        190077     128883583
TSA43        179565     129786674
TSA44        74788      42541556
TSA45        179837     148961559
TSA46        157618     110427650
TSA47        134614     95382384
TSA48        185173     132793697
TSA49        208467     104145310
TSA5         215390     134315100
TSA50        79060      109863998
TSA51        193270     109670524
TSA52        179789     118955400
TSA53        112018     117198240
TSA54        155065     135926838
TSA55        161491     91811831
TSA56        130880     143874686
TSA57        137221     81350084
TSA58        155281     162331143
TSA59        162870     156978878
TSA6         15756      19456676
TSA60        193460     121152461
TSA61        58307      95815324
TSA62        173904     118336485
TSA63        151865     162169634
TSA64        60981      124236666
TSA65        201109     152115772
TSA66        185638     143700395
TSA67        163423     121712708
TSA68        182114     137377481
TSA69        170731     97712914
TSA7         193738     53823711
TSA70        40637      38146354
TSA71        119065     123313318
TSA72        131964     141438855
TSA73        151655     115933671
TSA74        830        251943
TSA75        152989     102336522
TSA76        156503     143538644
TSA77        40595      33645981
TSA78        176683     138455592
TSA79        161932     158903820
TSA8         157351     121760532
TSA80        11473      9475196
TSA81        185669     115791752
TSA82        143388     147833423
TSA83        177758     145461495
TSA84        159207     177073302
TSA85        17073      11909470
TSA86        168307     128893220
TSA87        156344     150391937
TSA88        195417     125563889
TSA89        31946      22565095
TSA9         99887      68939156
TSA90        196286     138439609
TSA91        112986     113189975
TSA92        98986      206634893
TSA93        87112      229168164
TSA94        77344      247719367
TSA95        30093      107285833
TSA96        141033     144555977
TSA97        106053     76615758
TSA98        74413      65471527
TSA99        33768      32853514
UNA1         713        4436341
VRL1         132414     138777887
VRL10        44177      308098589
VRL100       2588       70143626
VRL101       9216       222070295
VRL102       9000       220925388
VRL103       8399       222314457
VRL104       3450       99018611
VRL105       7542       222798704
VRL106       8481       222342344
VRL107       7541       222039971
VRL108       7606       191489142
VRL109       7469       222617997
VRL11        115601     146305734
VRL110       7660       221917498
VRL111       7698       222064552
VRL112       2108       62823796
VRL113       7479       222259253
VRL114       7485       221552147
VRL115       8411       222475161
VRL116       7539       218218599
VRL117       7738       219687007
VRL118       7369       218154802
VRL119       8023       222001322
VRL12        22911      79776921
VRL120       3795       112794498
VRL121       7551       221475386
VRL122       7476       222844210
VRL123       8212       222941214
VRL124       7418       219925136
VRL125       87         2577293
VRL126       7849       218822501
VRL127       7721       222235544
VRL128       7514       220490813
VRL129       7373       218285751
VRL13        114063     144977044
VRL130       5199       154595161
VRL131       12365      369630589
VRL132       12387      370295291
VRL133       12393      370567303
VRL134       12384      370286134
VRL135       12382      370211898
VRL136       5593       167207813
VRL137       12391      370378994
VRL138       12393      370390238
VRL139       12395      370424114
VRL14        112585     147955960
VRL140       7993       238860319
VRL141       12409      370814633
VRL142       12404      370667524
VRL143       12459      371903729
VRL144       5733       170858745
VRL145       7445       221929148
VRL146       7873       222585801
VRL147       7444       221865957
VRL148       2717       80820397
VRL149       7650       223348921
VRL15        26373      44259789
VRL150       7457       222064080
VRL151       7598       222200402
VRL152       8204       221526099
VRL153       3722       110331731
VRL154       7512       220722783
VRL155       7408       219833868
VRL156       7409       219748913
VRL157       3588       103837431
VRL158       7413       219157477
VRL159       7527       222563592
VRL16        91100      158466153
VRL160       7488       219920420
VRL161       7609       223004974
VRL162       4429       124200516
VRL163       7764       221768439
VRL164       7450       221516016
VRL165       7363       218047165
VRL166       7914       221352857
VRL167       3570       99729366
VRL168       7443       221912979
VRL169       7417       220600930
VRL17        96717      150177445
VRL170       7454       220827257
VRL171       5055       150614940
VRL172       7533       221973138
VRL173       7456       221885618
VRL174       7462       219507196
VRL175       2191       64820359
VRL176       7522       221905234
VRL177       7821       222009260
VRL178       7433       220989056
VRL179       2274       66973885
VRL18        60953      99688982
VRL180       7855       222784820
VRL181       7627       223205749
VRL182       7631       223011146
VRL183       6943       203972089
VRL184       7364       218005430
VRL185       7498       222152562
VRL186       7560       223117835
VRL187       7463       221896947
VRL188       7447       221890174
VRL189       7602       222279181
VRL19        92385      166032863
VRL190       7442       221347380
VRL191       2515       75010713
VRL192       7600       221963321
VRL193       7387       219054561
VRL194       7528       220390955
VRL195       5270       156999921
VRL196       7482       222890054
VRL197       7617       222921322
VRL198       7554       221837223
VRL199       3027       90259423
VRL2         126444     151471712
VRL20        91155      163931909
VRL200       7435       219464199
VRL201       7406       219724563
VRL202       7457       222066680
VRL203       3598       105987095
VRL204       7524       223593418
VRL205       7572       224219932
VRL206       7577       222246985
VRL207       7447       221713651
VRL208       2048       57727519
VRL209       7519       222412726
VRL21        53961      120923805
VRL210       7431       221233234
VRL211       7386       219102489
VRL212       4893       145324823
VRL213       7511       221910656
VRL214       8131       223124821
VRL215       7552       224876222
VRL216       6398       185520356
VRL217       7483       221806706
VRL218       7481       222674161
VRL219       7395       219451019
VRL22        83155      172778768
VRL220       3809       109022083
VRL221       7558       223034392
VRL222       7524       223014582
VRL223       7472       222216004
VRL224       7292       216327617
VRL225       7456       222171623
VRL226       7383       219061715
VRL227       7424       221068122
VRL228       2626       78049171
VRL229       7552       223238227
VRL23        85993      167265659
VRL230       7552       222079339
VRL231       7477       222133967
VRL232       7554       222599811
VRL233       7619       222029230
VRL234       2870       85284253
VRL235       7452       221759674
VRL236       7381       219102170
VRL237       7431       221234825
VRL238       7453       222416660
VRL239       1031       30733164
VRL24        69463      119030629
VRL240       7569       223034763
VRL241       7473       222923340
VRL242       7452       222456927
VRL243       7583       223559616
VRL244       2233       66446665
VRL245       7457       221635917
VRL246       7410       220601824
VRL247       7434       221590460
VRL248       6344       188895014
VRL249       7533       222875801
VRL25        82970      167612962
VRL250       7438       221584316
VRL251       7520       222336956
VRL252       5183       154361376
VRL253       7573       219801182
VRL254       7412       220547796
VRL255       7451       221917771
VRL256       4339       108886662
VRL257       7457       221379308
VRL258       7569       223431441
VRL259       7456       222057880
VRL26        83252      167328982
VRL260       6288       187154162
VRL261       7462       222349861
VRL262       7399       219903249
VRL263       7481       222256072
VRL264       4588       126597123
VRL265       7459       222258777
VRL266       7474       222595538
VRL267       7448       221867952
VRL268       3487       103835298
VRL269       7454       222321174
VRL27        50274      112038035
VRL270       7492       223015063
VRL271       7432       221420391
VRL272       4304       128254661
VRL273       12227      365134813
VRL274       12346      368941421
VRL275       6276       187454790
VRL276       1904       56895892
VRL277       12412      370879597
VRL278       12615      376530246
VRL279       12642      377214922
VRL28        88466      184808853
VRL280       6339       188939939
VRL281       12640      377031424
VRL282       12732      379414321
VRL283       12742      379705519
VRL284       7006       208976171
VRL285       12705      378687920
VRL286       12643      377171669
VRL287       12570      374982296
VRL288       4234       126319737
VRL289       12563      374631629
VRL29        48181      281024838
VRL290       12551      374528581
VRL291       12589      375488908
VRL292       3548       106009595
VRL293       12492      372907154
VRL294       12432      371444506
VRL295       12406      370719895
VRL296       6412       191544890
VRL297       12420      370922953
VRL298       12405      370740440
VRL299       12392      370374902
VRL3         100365     122798920
VRL30        73207      193329123
VRL300       3446       102996629
VRL301       12465      372209245
VRL302       12442      371607689
VRL303       12298      368780193
VRL304       6433       192236959
VRL305       12555      374690328
VRL306       12414      370927670
VRL307       12130      362534777
VRL308       3014       90082279
VRL309       12422      371167299
VRL31        37939      87605889
VRL310       12261      366451044
VRL311       12386      370106341
VRL312       11574      345921941
VRL313       12375      369587244
VRL314       12390      369740875
VRL315       12379      370001711
VRL316       2818       84233233
VRL317       12290      367379494
VRL318       12510      373034066
VRL319       12366      369235414
VRL32        67784      182231549
VRL320       8841       264242569
VRL321       12371      369579323
VRL322       12404      370568074
VRL323       12579      375437866
VRL324       12370      369707372
VRL325       6792       202887204
VRL326       12355      369205246
VRL327       12444      371704645
VRL328       12371      369747768
VRL329       12440      371544438
VRL33        77053      186601686
VRL330       1311       39148614
VRL331       12301      367635353
VRL332       12375      369821506
VRL333       12376      369854194
VRL334       9922       296540679
VRL335       12418      371109515
VRL336       12357      369316303
VRL337       12364      369502706
VRL338       8756       261662439
VRL339       12392      370309151
VRL34        65127      153346634
VRL340       12364      369530954
VRL341       12373      369795214
VRL342       6051       180847472
VRL343       12089      361310448
VRL344       11884      355177935
VRL345       12279      366995197
VRL346       12379      369940129
VRL347       570        17013008
VRL348       12439      371649960
VRL349       12231      365563714
VRL35        75273      192269322
VRL350       12376      369888686
VRL351       12358      369342861
VRL352       2911       87000964
VRL353       12296      367175259
VRL354       12392      370337006
VRL355       12637      376641056
VRL356       3475       103531946
VRL357       12423      371100313
VRL358       12499      373201033
VRL359       12414      370789479
VRL36        83574      171872428
VRL360       11257      336322505
VRL361       12266      366416888
VRL362       12486      372717575
VRL363       12366      369573371
VRL364       12360      369353490
VRL365       3266       97611260
VRL366       12432      370526059
VRL367       12374      369743924
VRL368       12247      366038327
VRL369       5681       169794634
VRL37        70817      140929893
VRL370       12470      372461867
VRL371       12606      375805530
VRL372       12380      370004101
VRL373       12402      370640890
VRL374       12384      370120977
VRL375       31260      77097281
VRL38        79285      176377833
VRL39        67236      183068515
VRL4         94614      149040310
VRL40        42034      198262593
VRL41        18158      125567214
VRL42        24376      217375070
VRL43        15527      218692718
VRL44        33648      206750888
VRL45        6853       118777801
VRL46        16140      220046602
VRL47        22228      215349921
VRL48        15309      218639047
VRL49        6502       121688709
VRL5         87219      144400840
VRL50        12868      220105592
VRL51        8837       220841044
VRL52        9545       221384011
VRL53        4516       111298304
VRL54        8354       223689438
VRL55        8768       220992696
VRL56        8364       222453327
VRL57        9289       222012664
VRL58        3411       77518848
VRL59        9790       221537232
VRL6         93293      144785513
VRL60        12688      218205428
VRL61        7816       221605104
VRL62        9534       220916918
VRL63        2364       66266321
VRL64        7489       220957043
VRL65        7760       222142993
VRL66        9095       219451984
VRL67        18431      213031018
VRL68        2333       65673048
VRL69        7736       220619790
VRL7         130391     141296444
VRL70        7520       221225121
VRL71        7997       220761438
VRL72        6345       179771599
VRL73        7806       221565981
VRL74        8124       220522342
VRL75        7574       219657736
VRL76        5907       156307860
VRL77        11088      220062973
VRL78        7652       219851287
VRL79        8092       221744641
VRL8         70174      88335781
VRL80        4790       137374224
VRL81        7424       220835960
VRL82        7603       222380069
VRL83        7631       222865514
VRL84        631        18365850
VRL85        8235       222098988
VRL86        7743       222153458
VRL87        7421       220933452
VRL88        3049       82367332
VRL89        7543       222410132
VRL9         121328     144536257
VRL90        8523       221659559
VRL91        7568       220841042
VRL92        2974       78251834
VRL93        9227       219104789
VRL94        7968       222084387
VRL95        8155       223112882
VRL96        3658       97248403
VRL97        8854       222603105
VRL98        8921       223070145
VRL99        9519       222484992
VRT1         70024      272630303
VRT10        37396      74041240
VRT100       1          839681426
VRT101       1          825560060
VRT102       1          595904407
VRT103       1          486875112
VRT104       1          387033265
VRT105       1          371528181
VRT106       1          313513962
VRT107       1          277530821
VRT108       1          268302114
VRT109       3          319484498
VRT11        18698      27611025
VRT110       5          386368861
VRT111       7          393936069
VRT112       7          384166854
VRT113       1          46063367
VRT114       7          344525641
VRT115       6          384186008
VRT116       8          388949147
VRT117       332        334400544
VRT118       1          222115097
VRT119       3          377547369
VRT12        5986       380511905
VRT120       10         383496928
VRT121       33         389650655
VRT122       6          59236435
VRT123       1          772932187
VRT124       1          662004353
VRT125       1          535506559
VRT126       1          376147139
VRT127       1          364230008
VRT128       1          346409914
VRT129       1          311292523
VRT13        3363       217068541
VRT130       1          247732340
VRT131       1          228143320
VRT132       1          221182781
VRT133       2          321892640
VRT134       490        332426844
VRT135       12         378048109
VRT136       9          378909870
VRT137       6          345737823
VRT138       2          137693511
VRT139       7          385107928
VRT14        4685       4674270
VRT140       8          360581972
VRT141       10         364952837
VRT142       4          133261911
VRT143       8          359905961
VRT144       5          370674748
VRT145       9          378247816
VRT146       6          166907986
VRT147       14         379842153
VRT148       15         375595384
VRT149       41         289507176
VRT15        1171       26255719
VRT150       11         366984719
VRT151       14         374291772
VRT152       10         185283047
VRT153       1          550518975
VRT154       1          529596002
VRT155       1          413748038
VRT156       1          326378286
VRT157       1          272612222
VRT158       1          260396842
VRT159       1          197956435
VRT16        293        13983146
VRT160       2          384149701
VRT161       2          288058306
VRT162       4          353983664
VRT163       461        371881983
VRT164       2          310725315
VRT165       2          280326572
VRT166       3          371471404
VRT167       3          354148189
VRT168       3          303679844
VRT169       4          341249946
VRT17        37         392789976
VRT170       382        371460784
VRT171       13         392880011
VRT172       13         164097178
VRT173       1          313568160
VRT174       1          289498315
VRT175       1          277254249
VRT176       1          244324502
VRT177       1          233859027
VRT178       1          225974235
VRT179       1          211674833
VRT18        13         392458500
VRT180       1          199962141
VRT181       2          390673241
VRT182       2          334991523
VRT183       2          324316137
VRT184       2          292002398
VRT185       1          133841611
VRT186       3          336899598
VRT187       28         389500106
VRT188       6          332993899
VRT189       6          378599539
VRT19        12         379958897
VRT190       1          47256133
VRT191       6          330076811
VRT192       7          362796652
VRT193       8          365387335
VRT194       20         273534543
VRT195       9          378695651
VRT196       11         392251032
VRT197       205        341394663
VRT198       7          347210350
VRT199       7          370650631
VRT2         72835      271698363
VRT20        11         316368323
VRT200       8          391548385
VRT201       6          385659507
VRT202       7          341110862
VRT203       1          55350661
VRT204       8          387616857
VRT205       3          259325358
VRT206       5          392602723
VRT207       41         394037361
VRT208       3          148003845
VRT209       7          387415360
VRT21        13         385338369
VRT210       7          365756282
VRT211       6          352657526
VRT212       5          346047628
VRT213       2          134650353
VRT214       5          356250620
VRT215       6          374573269
VRT216       6          364137996
VRT217       7          343458516
VRT218       2          121348818
VRT219       7          358240592
VRT22        14         372163844
VRT220       8          383435354
VRT221       8          365970383
VRT222       6          357597984
VRT223       7          355728138
VRT224       8          362648569
VRT225       7          390172982
VRT226       8          391413434
VRT227       8          377681388
VRT228       1          42933508
VRT229       100        376541917
VRT23        14         352781625
VRT230       20         391000381
VRT231       13         383659375
VRT232       58         386123281
VRT233       11         394338841
VRT234       11         274288418
VRT235       1          843366180
VRT236       1          842558404
VRT237       1          707956555
VRT238       1          635713434
VRT239       1          567300182
VRT24        19         384683297
VRT240       1          439630435
VRT241       1          236595445
VRT242       1          231667822
VRT243       2          382351630
VRT244       2          103223822
VRT245       1          690654357
VRT246       1          541439571
VRT247       1          495417988
VRT248       1          481763206
VRT249       1          429350720
VRT25        16         379729070
VRT250       1          224823088
VRT251       1          212589178
VRT252       2          374746477
VRT253       2          318111367
VRT254       32         270969991
VRT255       2          352563619
VRT256       7          386835620
VRT257       4314       352825248
VRT258       19         370712563
VRT259       15988      152796988
VRT26        16         381718727
VRT260       139344     132737398
VRT261       144440     125658042
VRT262       131311     124639283
VRT263       134283     133926968
VRT264       5          383094575
VRT265       5          374381301
VRT266       16         387558511
VRT267       41         262370602
VRT268       14         376657571
VRT269       16         394062851
VRT27        2          51507477
VRT270       16         377073984
VRT271       8          278699154
VRT272       13         345916081
VRT273       3          386677656
VRT274       5          363840571
VRT275       26         375942556
VRT276       11         392818628
VRT277       13210      328615031
VRT28        6          344600068
VRT29        7          384846875
VRT3         9006       334129504
VRT30        7          359521465
VRT31        33         269170512
VRT32        147        10842596
VRT33        586        15797052
VRT34        2343       67436863
VRT35        19198      357652178
VRT36        54157      304795318
VRT37        158681     137228288
VRT38        18089      13374643
VRT39        117693     200745678
VRT4         3          141387178
VRT40        84130      68199786
VRT41        2          304060631
VRT42        6          387303573
VRT43        28         305102738
VRT44        156524     129498792
VRT45        39643      26607666
VRT46        185764     123620850
VRT47        148584     105819123
VRT48        168363     113478362
VRT49        8428       7214021
VRT5         8          354279535
VRT50        133023     105740718
VRT51        156399     117964862
VRT52        142031     87313772
VRT53        188518     120085844
VRT54        103239     61379831
VRT55        157552     119284532
VRT56        157298     129049054
VRT57        129        388713808
VRT58        358        381748347
VRT59        1698       374024838
VRT6         11         387350249
VRT60        93605      262107503
VRT61        145106     21008965
VRT62        75789      25336814
VRT63        13375      365641119
VRT64        20         379347618
VRT65        270        393447049
VRT66        3067       391133617
VRT67        3471       230588304
VRT68        6925       378855996
VRT69        16         388667304
VRT7         11         393947221
VRT70        16         378559418
VRT71        12         379509384
VRT72        7          285874095
VRT73        12         387522266
VRT74        18         375242791
VRT75        16         386329687
VRT76        229        277860126
VRT77        17         367327734
VRT78        15         385834222
VRT79        7          149460915
VRT8         30744      333424138
VRT80        1          356776219
VRT81        1          350268637
VRT82        1          316334699
VRT83        1          337490635
VRT84        1          252032905
VRT85        1          217689105
VRT86        1          199443007
VRT87        1          198537509
VRT88        2          368166310
VRT89        2          330550494
VRT9         74952      70629182
VRT90        1          146904662
VRT91        3          319096504
VRT92        7          379783228
VRT93        11         374771935
VRT94        13         379441801
VRT95        3          70710155
VRT96        16         344076996
VRT97        10         385210617
VRT98        15         392781064
VRT99        22         370094349

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 247.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:

Entries        Bases   Species

1942643 172374634626   Triticum aestivum
1347430  97059428399   Hordeum vulgare subsp. vulgare
2703508  80497317866   Severe acute respiratory syndrome coronavirus 2
27437763 27714770678   Homo sapiens
150422   13502686559   Escherichia coli
1730239  10890050390   Danio rerio
2241632  10650539694   Bos taurus
10029578 10459557283   Mus musculus
23087     9981497962   Triticum turgidum subsp. durum
4219695   7411312909   Zea mays
21316     7083888984   Klebsiella pneumoniae
21523     6749236152   Secale cereale
2202024   6547403015   Rattus norvegicus
1471062   5775151674   Canis lupus familiaris
54        5178626132   Rhinatrema bivittatum
3307728   5083049438   Sus scrofa
1955      4991603121   Bufo bufo
17        4548077046   Microcaecilia unicolor
29708     4348333235   Hordeum vulgare subsp. spontaneum
10371     4262019239   Macrobrachium nipponense

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691
   217   Dec 2016   224973060433   198565475
   218   Feb 2017   228719437638   199341377
   219   Apr 2017   231824951552   200877884
   220   Jun 2017   234997362623   201663568
   221   Aug 2017   240343378258   203180606
   222   Oct 2017   244914705468   203953682
   223   Dec 2017   249722163594   206293625
   224   Feb 2018   253630708098   207040555
   225   Apr 2018   260189141631   208452303
   226   Jun 2018   263957884539   209775348
   227   Aug 2018   260806936411   208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
   228   Oct 2018   279668290132   209656636
   229   Dec 2018   285688542186   211281415
   230   Feb 2019   303709510632   212260377
   231   Apr 2019   321680566570   212775414
   232   Jun 2019   329835282370   213383758
   233   Aug 2019   366733917629   213865349
   234   Oct 2019   386197018538   216763706
   235   Dec 2019   388417258009   215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
   236   Feb 2020   399376854872   216214215
   237   Apr 2020   415770027949   216531829
   238   Jun 2020   427823258901   217122233
   239   Aug 2020   654057069549   218642238
   240   Oct 2020   698688094046   219055207
   241   Dec 2020   723003822007   221467827
   242   Feb 2021   776291211106   226241476
   243   Apr 2021   832400799511   227123201
   244   Jun 2021   866009790959   227888889
   245   Aug 2021   940513260726   231982592
   246   Oct 2021  1014763752113   233642893
   247   Dec 2021  1053275115030   234557297
   
  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315
  217    Dec 2016  1817189565845   395301176
  218    Feb 2017  1892966308635   409490397
  219    Apr 2017  2035032639807   451840147
  220    Jun 2017  2164683993369   487891767
  221    Aug 2017  2242294609510   499965722
  222    Oct 2017  2318156361999   508825331
  223    Dec 2017  2466098053327   551063065
  224    Feb 2018  2608532210351   564286852
  225    Apr 2018  2784740996536   621379029
  226    Jun 2018  2944617324086   639804105
  227    Aug 2018  3204855013281   665309765
  228    Oct 2018  3444172142207   722438528
  229    Dec 2018  3656719423096   773773190
  230    Feb 2019  4164513961679   945019312
  231    Apr 2019  4421986382065   993732214
  232    Jun 2019  4847677297950  1022913321
  233    Aug 2019  5585922333160  1075272215
  234    Oct 2019  5985250251028  1097629174
  235    Dec 2019  6277551200690  1127023870
  236    Feb 2020  6968991265752  1206720688
  237    Apr 2020  7788133221338  1267547429
  238    Jun 2020  8114046262158  1302852615
  239    Aug 2020  8841649410652  1408122887
  240    Oct 2020  9215815569509  1432874252
  241    Dec 2020 11830842428018  1517995689
  242    Feb 2021 12270717209612  1563938043
  243    Apr 2021 12732048052023  1590670459
  244    Jun 2021 13442974346437  1632796606
  245    Aug 2021 13888187863722  1653427055
  246    Oct 2021 14599101574547  1721064101
  247    Dec 2021 14922033922302  1734664952

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597
  217    Dec 2016   125328824508   142094337
  218    Feb 2017   133517212104   151431485
  219    Apr 2017   149038907599   165068542
  220    Jun 2017   158112969073   176812130
  221    Aug 2017   167045663417   186777106
  222    Oct 2017   172909268535   192754804
  223    Dec 2017   181394660188   201559502
  224    Feb 2018   193940551226   214324264
  225    Apr 2018   205232396043   227364990
  226    Jun 2018   216556686631   238788334
  227    Aug 2018   225520004678   249295386
  228    Oct 2018   235875573598   259927414
  229    Dec 2018   248592892188   274845473
  230    Feb 2019   263936885705   294772430
  231    Apr 2019   277118019688   311247136
  232    Jun 2019   285390240861   319927264
  233    Aug 2019   294727165179   331347807
  234    Oct 2019   305371891408   342811151
  235    Dec 2019   325433016129   367193844
  236    Feb 2020   340994289065   386644871
  237    Apr 2020   349692751528   396392280
  238    Jun 2020   359947709062   409725050
  239    Aug 2020   366968951160   417524567
  240    Oct 2020   382996662270   435968379
  241    Dec 2020   392206975386   446397378
  242    Feb 2021   407605409948   463151000
  243    Apr 2021   425076483459   481154920
  244    Jun 2021   436594941165   494641358
  245    Aug 2021   440578422611   498305045
  246    Oct 2021   449891016597   508319391
  247    Dec 2021   455870853358   514158576

  The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.

  Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
	  ftp://ftp.ncbi.nih.gov/genbank/tls

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  217    Dec 2016      584697919     1268690
  218    Feb 2017      636923295     1438349
  219    Apr 2017      636923295     1438349  (unchanged)
  220    Jun 2017      824191338     1628475
  221    Aug 2017      824191338     1628475  (unchanged)
  222    Oct 2017     2993818315     9479460
  223    Dec 2017     4458042616    12695198
  224    Feb 2018     4531966831    12819978
  225    Apr 2018     5612769448    14782654
  226    Jun 2018     5896511468    15393041
  227    Aug 2018     6077824493    15822538
  228    Oct 2018     8435112913    20752288
  229    Dec 2018     8511829281    20924588
  230    Feb 2019     9146836085    23259929
  231    Apr 2019     9623321565    24240761
  232    Jun 2019    10182427815    25530139
  233    Aug 2019    10531800829    26363945
  234    Oct 2019    10848455369    27460978
  235    Dec 2019    11280596614    28227180
  236    Feb 2020    13669678196    34037371
  237    Apr 2020    24615270313    65521132
  238    Jun 2020    27500635128    75063181
  239    Aug 2020    27825059498    75682157
  240    Oct 2020    28814798868    78177358
  241    Dec 2020    33036509446    88039152
  242    Feb 2021    33634122995    90130561
  243    Apr 2021    37998534461   102395753
  244    Jun 2021    38198113354   102662929
  245    Aug 2021    39930167315   106995218
  246    Oct 2021    40168874815   107569935
  247    Dec 2021    41143480750   109379021

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          December 15 2021

                NCBI-GenBank Flat File Release 247.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

  NOTE : Presentation of GI sequence identifiers in the GenBank
  flatfile format was discontinued as of March 2017.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, possibly 'LINEAGE'. But because changes like this can be
   very disruptive for customers, implementation has not yet been scheduled.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

3.4.4.1 : Important notice about parsing the LOCUS line

  Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.

  Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.

  Consider this LOCUS line for a typical complete bacterial genome:

LOCUS       CP032762             5868661 bp    DNA     circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:

LOCUS       AZZZAA02123456789 9999999999 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:

LOCUS       AZZZAA0212345678910000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:

LOCUS       AZZZAA02123456789 10000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.

3.4.4.2 : Data elements of the LOCUS line

  The data elements of the LOCUS line format and their typical/historical
column positions are as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus Name (usually identical to the Accession Number)
29-29      space
30-40      Sequence Length, right-justified
41-41      space
42-43      'bp'
44-44      space
45-47      Strandedness : spaces (if not known), ss- (single-stranded),
           ds- (double-stranded), or ms- (mixed-stranded)
48-53      Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      Molecule Topology : 'linear' followed by two spaces,
           or 'circular'
64-64      space
65-67      Division Code
68-68      space
69-79      Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.

  The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :

LOCUS       HUMPDNRC                 273 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S125 polymorphic dinucleotide repeat.
ACCESSION   L10620

LOCUS       HUMPDNRG                 169 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S114 polymorphic dinucleotide repeat.
ACCESSION   L10624

  But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:

LOCUS       AF035771                1357 bp    mRNA    linear   PRI 30-JUN-1998
DEFINITION  Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
            complete cds.
ACCESSION   AF035771
	    
  The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1
            ^^^^^^^^^^
            Compound  
            Accession.Version
            Number

  A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.

  GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://www.ncbi.nlm.nih.gov/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://www.ncbi.nlm.nih.gov/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://www.ncbi.nlm.nih.gov/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://www.ncbi.nlm.nih.gov/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:

	http://www.insdc.org/documents/feature-table

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.2

3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

  The list of valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.3

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       KZ271580              141308 bp    DNA     linear   CON 17-AUG-2017
DEFINITION  Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
            O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION   KZ271580 LQNL01000000
VERSION     KZ271580.1
DBLINK      BioProject: PRJNA230512
            BioSample: SAMN04226856
KEYWORDS    WGS; HIGH_QUALITY_DRAFT.
...
     mRNA            complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /product="hypothetical protein"
     CDS             complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="OZC04795.1"
                     /db_xref="GI:1233056989"
                     /translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
                     SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
                     ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
                     TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
                     LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
                     HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
                     LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
                     IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
                     YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
                     AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
                     IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG      join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
            gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Scaffold/CON-division join() sequence


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              [email protected]

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.

  The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address: [email protected] .

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

   Sayers E, Cavanaugh M, Clark K, Ostell J, Pruitt K,
   Karsch-Mizrachi I, "GenBank", Nucleic Acids Research,
   Volume 47, Issue D1, January 2019, pp. D94-D99

   PMID:  30365038
   PMCID: PMC6323954
   DOI:   10.1093/nar/gky989

  The following statement is an example of how one might cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'

  (1) Sayers, E. et al, Nucleic Acids Res. 47(D1):D94-D99 (2019)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: Simply direct your web browser of choice to:

	 http://www.ncbi.nlm.nih.gov/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] .

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  [email protected].  Please be certain to
indicate the GenBank release number (e.g., Release 218.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Andreina Castillo Siri, Larry Chlumsky, Karen Clark,
	Scott Durkin, Francescopaolo di Cello, Michel Eschenbrenner,
	Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
	Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Augustus Tilley,
	Beverly Underwood, Simone Walker and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
	Sergiy Gotvyanskyy, Eugene Gribov, Jonathan Kans, Leonid Khotomliansky,
	Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh, Alex Kotliarov,
	Frank Ludwig, Anatoly Mnev, Vasuki Palanigobu,
	Anton Perkov, Andriy Petrow, Sergey Petrunin, Wenyao Shi, Denis Sinyakov,
	Thomas Smith, Vladimir Soussov, Elena Starchenko, Hanzhen Sun,
	Andrei Vereshchagin, Jewen Xiao, Eugene Yaschenko, Liwei Zhou

Database Administration
	Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
	Benjamin Slade, Constantin Vasilyev

Customer Support
	Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
	Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	Steve Sherry : Acting Director, NCBI
	Kim Pruitt   : Branch Chief, NCBI/IEB

Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
Support Center