Release Notes For GenBank Release 248
GBREL.TXT Genetic Sequence Data Bank
February 15 2022
NCBI-GenBank Flat File Release 248.0
Distribution Release Notes
236338284 sequences, 1173984081721 bases, for traditional GenBank records
2384779574 sequences, 15934456405303 bases, for set-based (WGS/TSA/TLS) records
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 248.0
1.2 Cutoff Date
1.3 Important Changes in Release 248.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 248.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for GenBank's web-based submission tool (BankIt) :
http://www.ncbi.nlm.nih.gov/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 248.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:
ftp://ftp.ncbi.nih.gov/genbank/wgs
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/tsa
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tls
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
See the README files in those areas for more information.
Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:
ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.
1.2 Cutoff Date
This full release, 248.0, incorporates data processed by the INSDC databases
as of Tuesday February 15 2022 at 6:23AM EST. For more recent data, users are
advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotide' database (see Section 6.4 of this document).
1.3 Important Changes in Release 248.0
1.3.1 Organizational changes
The total number of sequence data files increased by 348 with this release:
- the BCT division is now composed of 712 files (+24)
- the EST division is now composed of 576 files (+1)
- the GSS division is now composed of 271 files (+3)
- the INV division is now composed of 559 files (+71)
- the MAM division is now composed of 125 files (+9)
- the PAT division is now composed of 247 files (+1)
- the PLN division is now composed of 802 files (+74)
- the VRL division is now composed of 525 files (+150)
- the VRT division is now composed of 292 files (+15)
1.4 Upcoming Changes
No changes to the GenBank flatfile format are planned at this time.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the ENA and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the ENA and DDBJ databases.
BankIt may be used with any modern web browser. You can access BankIt
from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] .
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.
2.2 Files
This GenBank flat file release consists of 4802 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct395.seq - Bacterial sequence entries, part 395.
330. gbbct396.seq - Bacterial sequence entries, part 396.
331. gbbct397.seq - Bacterial sequence entries, part 397.
332. gbbct398.seq - Bacterial sequence entries, part 398.
333. gbbct399.seq - Bacterial sequence entries, part 399.
334. gbbct4.seq - Bacterial sequence entries, part 4.
335. gbbct40.seq - Bacterial sequence entries, part 40.
336. gbbct400.seq - Bacterial sequence entries, part 400.
337. gbbct401.seq - Bacterial sequence entries, part 401.
338. gbbct402.seq - Bacterial sequence entries, part 402.
339. gbbct403.seq - Bacterial sequence entries, part 403.
340. gbbct404.seq - Bacterial sequence entries, part 404.
341. gbbct405.seq - Bacterial sequence entries, part 405.
342. gbbct406.seq - Bacterial sequence entries, part 406.
343. gbbct407.seq - Bacterial sequence entries, part 407.
344. gbbct408.seq - Bacterial sequence entries, part 408.
345. gbbct409.seq - Bacterial sequence entries, part 409.
346. gbbct41.seq - Bacterial sequence entries, part 41.
347. gbbct410.seq - Bacterial sequence entries, part 410.
348. gbbct411.seq - Bacterial sequence entries, part 411.
349. gbbct412.seq - Bacterial sequence entries, part 412.
350. gbbct413.seq - Bacterial sequence entries, part 413.
351. gbbct414.seq - Bacterial sequence entries, part 414.
352. gbbct415.seq - Bacterial sequence entries, part 415.
353. gbbct416.seq - Bacterial sequence entries, part 416.
354. gbbct417.seq - Bacterial sequence entries, part 417.
355. gbbct418.seq - Bacterial sequence entries, part 418.
356. gbbct419.seq - Bacterial sequence entries, part 419.
357. gbbct42.seq - Bacterial sequence entries, part 42.
358. gbbct420.seq - Bacterial sequence entries, part 420.
359. gbbct421.seq - Bacterial sequence entries, part 421.
360. gbbct422.seq - Bacterial sequence entries, part 422.
361. gbbct423.seq - Bacterial sequence entries, part 423.
362. gbbct424.seq - Bacterial sequence entries, part 424.
363. gbbct425.seq - Bacterial sequence entries, part 425.
364. gbbct426.seq - Bacterial sequence entries, part 426.
365. gbbct427.seq - Bacterial sequence entries, part 427.
366. gbbct428.seq - Bacterial sequence entries, part 428.
367. gbbct429.seq - Bacterial sequence entries, part 429.
368. gbbct43.seq - Bacterial sequence entries, part 43.
369. gbbct430.seq - Bacterial sequence entries, part 430.
370. gbbct431.seq - Bacterial sequence entries, part 431.
371. gbbct432.seq - Bacterial sequence entries, part 432.
372. gbbct433.seq - Bacterial sequence entries, part 433.
373. gbbct434.seq - Bacterial sequence entries, part 434.
374. gbbct435.seq - Bacterial sequence entries, part 435.
375. gbbct436.seq - Bacterial sequence entries, part 436.
376. gbbct437.seq - Bacterial sequence entries, part 437.
377. gbbct438.seq - Bacterial sequence entries, part 438.
378. gbbct439.seq - Bacterial sequence entries, part 439.
379. gbbct44.seq - Bacterial sequence entries, part 44.
380. gbbct440.seq - Bacterial sequence entries, part 440.
381. gbbct441.seq - Bacterial sequence entries, part 441.
382. gbbct442.seq - Bacterial sequence entries, part 442.
383. gbbct443.seq - Bacterial sequence entries, part 443.
384. gbbct444.seq - Bacterial sequence entries, part 444.
385. gbbct445.seq - Bacterial sequence entries, part 445.
386. gbbct446.seq - Bacterial sequence entries, part 446.
387. gbbct447.seq - Bacterial sequence entries, part 447.
388. gbbct448.seq - Bacterial sequence entries, part 448.
389. gbbct449.seq - Bacterial sequence entries, part 449.
390. gbbct45.seq - Bacterial sequence entries, part 45.
391. gbbct450.seq - Bacterial sequence entries, part 450.
392. gbbct451.seq - Bacterial sequence entries, part 451.
393. gbbct452.seq - Bacterial sequence entries, part 452.
394. gbbct453.seq - Bacterial sequence entries, part 453.
395. gbbct454.seq - Bacterial sequence entries, part 454.
396. gbbct455.seq - Bacterial sequence entries, part 455.
397. gbbct456.seq - Bacterial sequence entries, part 456.
398. gbbct457.seq - Bacterial sequence entries, part 457.
399. gbbct458.seq - Bacterial sequence entries, part 458.
400. gbbct459.seq - Bacterial sequence entries, part 459.
401. gbbct46.seq - Bacterial sequence entries, part 46.
402. gbbct460.seq - Bacterial sequence entries, part 460.
403. gbbct461.seq - Bacterial sequence entries, part 461.
404. gbbct462.seq - Bacterial sequence entries, part 462.
405. gbbct463.seq - Bacterial sequence entries, part 463.
406. gbbct464.seq - Bacterial sequence entries, part 464.
407. gbbct465.seq - Bacterial sequence entries, part 465.
408. gbbct466.seq - Bacterial sequence entries, part 466.
409. gbbct467.seq - Bacterial sequence entries, part 467.
410. gbbct468.seq - Bacterial sequence entries, part 468.
411. gbbct469.seq - Bacterial sequence entries, part 469.
412. gbbct47.seq - Bacterial sequence entries, part 47.
413. gbbct470.seq - Bacterial sequence entries, part 470.
414. gbbct471.seq - Bacterial sequence entries, part 471.
415. gbbct472.seq - Bacterial sequence entries, part 472.
416. gbbct473.seq - Bacterial sequence entries, part 473.
417. gbbct474.seq - Bacterial sequence entries, part 474.
418. gbbct475.seq - Bacterial sequence entries, part 475.
419. gbbct476.seq - Bacterial sequence entries, part 476.
420. gbbct477.seq - Bacterial sequence entries, part 477.
421. gbbct478.seq - Bacterial sequence entries, part 478.
422. gbbct479.seq - Bacterial sequence entries, part 479.
423. gbbct48.seq - Bacterial sequence entries, part 48.
424. gbbct480.seq - Bacterial sequence entries, part 480.
425. gbbct481.seq - Bacterial sequence entries, part 481.
426. gbbct482.seq - Bacterial sequence entries, part 482.
427. gbbct483.seq - Bacterial sequence entries, part 483.
428. gbbct484.seq - Bacterial sequence entries, part 484.
429. gbbct485.seq - Bacterial sequence entries, part 485.
430. gbbct486.seq - Bacterial sequence entries, part 486.
431. gbbct487.seq - Bacterial sequence entries, part 487.
432. gbbct488.seq - Bacterial sequence entries, part 488.
433. gbbct489.seq - Bacterial sequence entries, part 489.
434. gbbct49.seq - Bacterial sequence entries, part 49.
435. gbbct490.seq - Bacterial sequence entries, part 490.
436. gbbct491.seq - Bacterial sequence entries, part 491.
437. gbbct492.seq - Bacterial sequence entries, part 492.
438. gbbct493.seq - Bacterial sequence entries, part 493.
439. gbbct494.seq - Bacterial sequence entries, part 494.
440. gbbct495.seq - Bacterial sequence entries, part 495.
441. gbbct496.seq - Bacterial sequence entries, part 496.
442. gbbct497.seq - Bacterial sequence entries, part 497.
443. gbbct498.seq - Bacterial sequence entries, part 498.
444. gbbct499.seq - Bacterial sequence entries, part 499.
445. gbbct5.seq - Bacterial sequence entries, part 5.
446. gbbct50.seq - Bacterial sequence entries, part 50.
447. gbbct500.seq - Bacterial sequence entries, part 500.
448. gbbct501.seq - Bacterial sequence entries, part 501.
449. gbbct502.seq - Bacterial sequence entries, part 502.
450. gbbct503.seq - Bacterial sequence entries, part 503.
451. gbbct504.seq - Bacterial sequence entries, part 504.
452. gbbct505.seq - Bacterial sequence entries, part 505.
453. gbbct506.seq - Bacterial sequence entries, part 506.
454. gbbct507.seq - Bacterial sequence entries, part 507.
455. gbbct508.seq - Bacterial sequence entries, part 508.
456. gbbct509.seq - Bacterial sequence entries, part 509.
457. gbbct51.seq - Bacterial sequence entries, part 51.
458. gbbct510.seq - Bacterial sequence entries, part 510.
459. gbbct511.seq - Bacterial sequence entries, part 511.
460. gbbct512.seq - Bacterial sequence entries, part 512.
461. gbbct513.seq - Bacterial sequence entries, part 513.
462. gbbct514.seq - Bacterial sequence entries, part 514.
463. gbbct515.seq - Bacterial sequence entries, part 515.
464. gbbct516.seq - Bacterial sequence entries, part 516.
465. gbbct517.seq - Bacterial sequence entries, part 517.
466. gbbct518.seq - Bacterial sequence entries, part 518.
467. gbbct519.seq - Bacterial sequence entries, part 519.
468. gbbct52.seq - Bacterial sequence entries, part 52.
469. gbbct520.seq - Bacterial sequence entries, part 520.
470. gbbct521.seq - Bacterial sequence entries, part 521.
471. gbbct522.seq - Bacterial sequence entries, part 522.
472. gbbct523.seq - Bacterial sequence entries, part 523.
473. gbbct524.seq - Bacterial sequence entries, part 524.
474. gbbct525.seq - Bacterial sequence entries, part 525.
475. gbbct526.seq - Bacterial sequence entries, part 526.
476. gbbct527.seq - Bacterial sequence entries, part 527.
477. gbbct528.seq - Bacterial sequence entries, part 528.
478. gbbct529.seq - Bacterial sequence entries, part 529.
479. gbbct53.seq - Bacterial sequence entries, part 53.
480. gbbct530.seq - Bacterial sequence entries, part 530.
481. gbbct531.seq - Bacterial sequence entries, part 531.
482. gbbct532.seq - Bacterial sequence entries, part 532.
483. gbbct533.seq - Bacterial sequence entries, part 533.
484. gbbct534.seq - Bacterial sequence entries, part 534.
485. gbbct535.seq - Bacterial sequence entries, part 535.
486. gbbct536.seq - Bacterial sequence entries, part 536.
487. gbbct537.seq - Bacterial sequence entries, part 537.
488. gbbct538.seq - Bacterial sequence entries, part 538.
489. gbbct539.seq - Bacterial sequence entries, part 539.
490. gbbct54.seq - Bacterial sequence entries, part 54.
491. gbbct540.seq - Bacterial sequence entries, part 540.
492. gbbct541.seq - Bacterial sequence entries, part 541.
493. gbbct542.seq - Bacterial sequence entries, part 542.
494. gbbct543.seq - Bacterial sequence entries, part 543.
495. gbbct544.seq - Bacterial sequence entries, part 544.
496. gbbct545.seq - Bacterial sequence entries, part 545.
497. gbbct546.seq - Bacterial sequence entries, part 546.
498. gbbct547.seq - Bacterial sequence entries, part 547.
499. gbbct548.seq - Bacterial sequence entries, part 548.
500. gbbct549.seq - Bacterial sequence entries, part 549.
501. gbbct55.seq - Bacterial sequence entries, part 55.
502. gbbct550.seq - Bacterial sequence entries, part 550.
503. gbbct551.seq - Bacterial sequence entries, part 551.
504. gbbct552.seq - Bacterial sequence entries, part 552.
505. gbbct553.seq - Bacterial sequence entries, part 553.
506. gbbct554.seq - Bacterial sequence entries, part 554.
507. gbbct555.seq - Bacterial sequence entries, part 555.
508. gbbct556.seq - Bacterial sequence entries, part 556.
509. gbbct557.seq - Bacterial sequence entries, part 557.
510. gbbct558.seq - Bacterial sequence entries, part 558.
511. gbbct559.seq - Bacterial sequence entries, part 559.
512. gbbct56.seq - Bacterial sequence entries, part 56.
513. gbbct560.seq - Bacterial sequence entries, part 560.
514. gbbct561.seq - Bacterial sequence entries, part 561.
515. gbbct562.seq - Bacterial sequence entries, part 562.
516. gbbct563.seq - Bacterial sequence entries, part 563.
517. gbbct564.seq - Bacterial sequence entries, part 564.
518. gbbct565.seq - Bacterial sequence entries, part 565.
519. gbbct566.seq - Bacterial sequence entries, part 566.
520. gbbct567.seq - Bacterial sequence entries, part 567.
521. gbbct568.seq - Bacterial sequence entries, part 568.
522. gbbct569.seq - Bacterial sequence entries, part 569.
523. gbbct57.seq - Bacterial sequence entries, part 57.
524. gbbct570.seq - Bacterial sequence entries, part 570.
525. gbbct571.seq - Bacterial sequence entries, part 571.
526. gbbct572.seq - Bacterial sequence entries, part 572.
527. gbbct573.seq - Bacterial sequence entries, part 573.
528. gbbct574.seq - Bacterial sequence entries, part 574.
529. gbbct575.seq - Bacterial sequence entries, part 575.
530. gbbct576.seq - Bacterial sequence entries, part 576.
531. gbbct577.seq - Bacterial sequence entries, part 577.
532. gbbct578.seq - Bacterial sequence entries, part 578.
533. gbbct579.seq - Bacterial sequence entries, part 579.
534. gbbct58.seq - Bacterial sequence entries, part 58.
535. gbbct580.seq - Bacterial sequence entries, part 580.
536. gbbct581.seq - Bacterial sequence entries, part 581.
537. gbbct582.seq - Bacterial sequence entries, part 582.
538. gbbct583.seq - Bacterial sequence entries, part 583.
539. gbbct584.seq - Bacterial sequence entries, part 584.
540. gbbct585.seq - Bacterial sequence entries, part 585.
541. gbbct586.seq - Bacterial sequence entries, part 586.
542. gbbct587.seq - Bacterial sequence entries, part 587.
543. gbbct588.seq - Bacterial sequence entries, part 588.
544. gbbct589.seq - Bacterial sequence entries, part 589.
545. gbbct59.seq - Bacterial sequence entries, part 59.
546. gbbct590.seq - Bacterial sequence entries, part 590.
547. gbbct591.seq - Bacterial sequence entries, part 591.
548. gbbct592.seq - Bacterial sequence entries, part 592.
549. gbbct593.seq - Bacterial sequence entries, part 593.
550. gbbct594.seq - Bacterial sequence entries, part 594.
551. gbbct595.seq - Bacterial sequence entries, part 595.
552. gbbct596.seq - Bacterial sequence entries, part 596.
553. gbbct597.seq - Bacterial sequence entries, part 597.
554. gbbct598.seq - Bacterial sequence entries, part 598.
555. gbbct599.seq - Bacterial sequence entries, part 599.
556. gbbct6.seq - Bacterial sequence entries, part 6.
557. gbbct60.seq - Bacterial sequence entries, part 60.
558. gbbct600.seq - Bacterial sequence entries, part 600.
559. gbbct601.seq - Bacterial sequence entries, part 601.
560. gbbct602.seq - Bacterial sequence entries, part 602.
561. gbbct603.seq - Bacterial sequence entries, part 603.
562. gbbct604.seq - Bacterial sequence entries, part 604.
563. gbbct605.seq - Bacterial sequence entries, part 605.
564. gbbct606.seq - Bacterial sequence entries, part 606.
565. gbbct607.seq - Bacterial sequence entries, part 607.
566. gbbct608.seq - Bacterial sequence entries, part 608.
567. gbbct609.seq - Bacterial sequence entries, part 609.
568. gbbct61.seq - Bacterial sequence entries, part 61.
569. gbbct610.seq - Bacterial sequence entries, part 610.
570. gbbct611.seq - Bacterial sequence entries, part 611.
571. gbbct612.seq - Bacterial sequence entries, part 612.
572. gbbct613.seq - Bacterial sequence entries, part 613.
573. gbbct614.seq - Bacterial sequence entries, part 614.
574. gbbct615.seq - Bacterial sequence entries, part 615.
575. gbbct616.seq - Bacterial sequence entries, part 616.
576. gbbct617.seq - Bacterial sequence entries, part 617.
577. gbbct618.seq - Bacterial sequence entries, part 618.
578. gbbct619.seq - Bacterial sequence entries, part 619.
579. gbbct62.seq - Bacterial sequence entries, part 62.
580. gbbct620.seq - Bacterial sequence entries, part 620.
581. gbbct621.seq - Bacterial sequence entries, part 621.
582. gbbct622.seq - Bacterial sequence entries, part 622.
583. gbbct623.seq - Bacterial sequence entries, part 623.
584. gbbct624.seq - Bacterial sequence entries, part 624.
585. gbbct625.seq - Bacterial sequence entries, part 625.
586. gbbct626.seq - Bacterial sequence entries, part 626.
587. gbbct627.seq - Bacterial sequence entries, part 627.
588. gbbct628.seq - Bacterial sequence entries, part 628.
589. gbbct629.seq - Bacterial sequence entries, part 629.
590. gbbct63.seq - Bacterial sequence entries, part 63.
591. gbbct630.seq - Bacterial sequence entries, part 630.
592. gbbct631.seq - Bacterial sequence entries, part 631.
593. gbbct632.seq - Bacterial sequence entries, part 632.
594. gbbct633.seq - Bacterial sequence entries, part 633.
595. gbbct634.seq - Bacterial sequence entries, part 634.
596. gbbct635.seq - Bacterial sequence entries, part 635.
597. gbbct636.seq - Bacterial sequence entries, part 636.
598. gbbct637.seq - Bacterial sequence entries, part 637.
599. gbbct638.seq - Bacterial sequence entries, part 638.
600. gbbct639.seq - Bacterial sequence entries, part 639.
601. gbbct64.seq - Bacterial sequence entries, part 64.
602. gbbct640.seq - Bacterial sequence entries, part 640.
603. gbbct641.seq - Bacterial sequence entries, part 641.
604. gbbct642.seq - Bacterial sequence entries, part 642.
605. gbbct643.seq - Bacterial sequence entries, part 643.
606. gbbct644.seq - Bacterial sequence entries, part 644.
607. gbbct645.seq - Bacterial sequence entries, part 645.
608. gbbct646.seq - Bacterial sequence entries, part 646.
609. gbbct647.seq - Bacterial sequence entries, part 647.
610. gbbct648.seq - Bacterial sequence entries, part 648.
611. gbbct649.seq - Bacterial sequence entries, part 649.
612. gbbct65.seq - Bacterial sequence entries, part 65.
613. gbbct650.seq - Bacterial sequence entries, part 650.
614. gbbct651.seq - Bacterial sequence entries, part 651.
615. gbbct652.seq - Bacterial sequence entries, part 652.
616. gbbct653.seq - Bacterial sequence entries, part 653.
617. gbbct654.seq - Bacterial sequence entries, part 654.
618. gbbct655.seq - Bacterial sequence entries, part 655.
619. gbbct656.seq - Bacterial sequence entries, part 656.
620. gbbct657.seq - Bacterial sequence entries, part 657.
621. gbbct658.seq - Bacterial sequence entries, part 658.
622. gbbct659.seq - Bacterial sequence entries, part 659.
623. gbbct66.seq - Bacterial sequence entries, part 66.
624. gbbct660.seq - Bacterial sequence entries, part 660.
625. gbbct661.seq - Bacterial sequence entries, part 661.
626. gbbct662.seq - Bacterial sequence entries, part 662.
627. gbbct663.seq - Bacterial sequence entries, part 663.
628. gbbct664.seq - Bacterial sequence entries, part 664.
629. gbbct665.seq - Bacterial sequence entries, part 665.
630. gbbct666.seq - Bacterial sequence entries, part 666.
631. gbbct667.seq - Bacterial sequence entries, part 667.
632. gbbct668.seq - Bacterial sequence entries, part 668.
633. gbbct669.seq - Bacterial sequence entries, part 669.
634. gbbct67.seq - Bacterial sequence entries, part 67.
635. gbbct670.seq - Bacterial sequence entries, part 670.
636. gbbct671.seq - Bacterial sequence entries, part 671.
637. gbbct672.seq - Bacterial sequence entries, part 672.
638. gbbct673.seq - Bacterial sequence entries, part 673.
639. gbbct674.seq - Bacterial sequence entries, part 674.
640. gbbct675.seq - Bacterial sequence entries, part 675.
641. gbbct676.seq - Bacterial sequence entries, part 676.
642. gbbct677.seq - Bacterial sequence entries, part 677.
643. gbbct678.seq - Bacterial sequence entries, part 678.
644. gbbct679.seq - Bacterial sequence entries, part 679.
645. gbbct68.seq - Bacterial sequence entries, part 68.
646. gbbct680.seq - Bacterial sequence entries, part 680.
647. gbbct681.seq - Bacterial sequence entries, part 681.
648. gbbct682.seq - Bacterial sequence entries, part 682.
649. gbbct683.seq - Bacterial sequence entries, part 683.
650. gbbct684.seq - Bacterial sequence entries, part 684.
651. gbbct685.seq - Bacterial sequence entries, part 685.
652. gbbct686.seq - Bacterial sequence entries, part 686.
653. gbbct687.seq - Bacterial sequence entries, part 687.
654. gbbct688.seq - Bacterial sequence entries, part 688.
655. gbbct689.seq - Bacterial sequence entries, part 689.
656. gbbct69.seq - Bacterial sequence entries, part 69.
657. gbbct690.seq - Bacterial sequence entries, part 690.
658. gbbct691.seq - Bacterial sequence entries, part 691.
659. gbbct692.seq - Bacterial sequence entries, part 692.
660. gbbct693.seq - Bacterial sequence entries, part 693.
661. gbbct694.seq - Bacterial sequence entries, part 694.
662. gbbct695.seq - Bacterial sequence entries, part 695.
663. gbbct696.seq - Bacterial sequence entries, part 696.
664. gbbct697.seq - Bacterial sequence entries, part 697.
665. gbbct698.seq - Bacterial sequence entries, part 698.
666. gbbct699.seq - Bacterial sequence entries, part 699.
667. gbbct7.seq - Bacterial sequence entries, part 7.
668. gbbct70.seq - Bacterial sequence entries, part 70.
669. gbbct700.seq - Bacterial sequence entries, part 700.
670. gbbct701.seq - Bacterial sequence entries, part 701.
671. gbbct702.seq - Bacterial sequence entries, part 702.
672. gbbct703.seq - Bacterial sequence entries, part 703.
673. gbbct704.seq - Bacterial sequence entries, part 704.
674. gbbct705.seq - Bacterial sequence entries, part 705.
675. gbbct706.seq - Bacterial sequence entries, part 706.
676. gbbct707.seq - Bacterial sequence entries, part 707.
677. gbbct708.seq - Bacterial sequence entries, part 708.
678. gbbct709.seq - Bacterial sequence entries, part 709.
679. gbbct71.seq - Bacterial sequence entries, part 71.
680. gbbct710.seq - Bacterial sequence entries, part 710.
681. gbbct711.seq - Bacterial sequence entries, part 711.
682. gbbct712.seq - Bacterial sequence entries, part 712.
683. gbbct72.seq - Bacterial sequence entries, part 72.
684. gbbct73.seq - Bacterial sequence entries, part 73.
685. gbbct74.seq - Bacterial sequence entries, part 74.
686. gbbct75.seq - Bacterial sequence entries, part 75.
687. gbbct76.seq - Bacterial sequence entries, part 76.
688. gbbct77.seq - Bacterial sequence entries, part 77.
689. gbbct78.seq - Bacterial sequence entries, part 78.
690. gbbct79.seq - Bacterial sequence entries, part 79.
691. gbbct8.seq - Bacterial sequence entries, part 8.
692. gbbct80.seq - Bacterial sequence entries, part 80.
693. gbbct81.seq - Bacterial sequence entries, part 81.
694. gbbct82.seq - Bacterial sequence entries, part 82.
695. gbbct83.seq - Bacterial sequence entries, part 83.
696. gbbct84.seq - Bacterial sequence entries, part 84.
697. gbbct85.seq - Bacterial sequence entries, part 85.
698. gbbct86.seq - Bacterial sequence entries, part 86.
699. gbbct87.seq - Bacterial sequence entries, part 87.
700. gbbct88.seq - Bacterial sequence entries, part 88.
701. gbbct89.seq - Bacterial sequence entries, part 89.
702. gbbct9.seq - Bacterial sequence entries, part 9.
703. gbbct90.seq - Bacterial sequence entries, part 90.
704. gbbct91.seq - Bacterial sequence entries, part 91.
705. gbbct92.seq - Bacterial sequence entries, part 92.
706. gbbct93.seq - Bacterial sequence entries, part 93.
707. gbbct94.seq - Bacterial sequence entries, part 94.
708. gbbct95.seq - Bacterial sequence entries, part 95.
709. gbbct96.seq - Bacterial sequence entries, part 96.
710. gbbct97.seq - Bacterial sequence entries, part 97.
711. gbbct98.seq - Bacterial sequence entries, part 98.
712. gbbct99.seq - Bacterial sequence entries, part 99.
713. gbchg.txt - Accession numbers of entries updated since the previous release.
714. gbcon1.seq - Constructed sequence entries, part 1.
715. gbcon10.seq - Constructed sequence entries, part 10.
716. gbcon100.seq - Constructed sequence entries, part 100.
717. gbcon101.seq - Constructed sequence entries, part 101.
718. gbcon102.seq - Constructed sequence entries, part 102.
719. gbcon103.seq - Constructed sequence entries, part 103.
720. gbcon104.seq - Constructed sequence entries, part 104.
721. gbcon105.seq - Constructed sequence entries, part 105.
722. gbcon106.seq - Constructed sequence entries, part 106.
723. gbcon107.seq - Constructed sequence entries, part 107.
724. gbcon108.seq - Constructed sequence entries, part 108.
725. gbcon109.seq - Constructed sequence entries, part 109.
726. gbcon11.seq - Constructed sequence entries, part 11.
727. gbcon110.seq - Constructed sequence entries, part 110.
728. gbcon111.seq - Constructed sequence entries, part 111.
729. gbcon112.seq - Constructed sequence entries, part 112.
730. gbcon113.seq - Constructed sequence entries, part 113.
731. gbcon114.seq - Constructed sequence entries, part 114.
732. gbcon115.seq - Constructed sequence entries, part 115.
733. gbcon116.seq - Constructed sequence entries, part 116.
734. gbcon117.seq - Constructed sequence entries, part 117.
735. gbcon118.seq - Constructed sequence entries, part 118.
736. gbcon119.seq - Constructed sequence entries, part 119.
737. gbcon12.seq - Constructed sequence entries, part 12.
738. gbcon120.seq - Constructed sequence entries, part 120.
739. gbcon121.seq - Constructed sequence entries, part 121.
740. gbcon122.seq - Constructed sequence entries, part 122.
741. gbcon123.seq - Constructed sequence entries, part 123.
742. gbcon124.seq - Constructed sequence entries, part 124.
743. gbcon125.seq - Constructed sequence entries, part 125.
744. gbcon126.seq - Constructed sequence entries, part 126.
745. gbcon127.seq - Constructed sequence entries, part 127.
746. gbcon128.seq - Constructed sequence entries, part 128.
747. gbcon129.seq - Constructed sequence entries, part 129.
748. gbcon13.seq - Constructed sequence entries, part 13.
749. gbcon130.seq - Constructed sequence entries, part 130.
750. gbcon131.seq - Constructed sequence entries, part 131.
751. gbcon132.seq - Constructed sequence entries, part 132.
752. gbcon133.seq - Constructed sequence entries, part 133.
753. gbcon134.seq - Constructed sequence entries, part 134.
754. gbcon135.seq - Constructed sequence entries, part 135.
755. gbcon136.seq - Constructed sequence entries, part 136.
756. gbcon137.seq - Constructed sequence entries, part 137.
757. gbcon138.seq - Constructed sequence entries, part 138.
758. gbcon139.seq - Constructed sequence entries, part 139.
759. gbcon14.seq - Constructed sequence entries, part 14.
760. gbcon140.seq - Constructed sequence entries, part 140.
761. gbcon141.seq - Constructed sequence entries, part 141.
762. gbcon142.seq - Constructed sequence entries, part 142.
763. gbcon143.seq - Constructed sequence entries, part 143.
764. gbcon144.seq - Constructed sequence entries, part 144.
765. gbcon145.seq - Constructed sequence entries, part 145.
766. gbcon146.seq - Constructed sequence entries, part 146.
767. gbcon147.seq - Constructed sequence entries, part 147.
768. gbcon148.seq - Constructed sequence entries, part 148.
769. gbcon149.seq - Constructed sequence entries, part 149.
770. gbcon15.seq - Constructed sequence entries, part 15.
771. gbcon150.seq - Constructed sequence entries, part 150.
772. gbcon151.seq - Constructed sequence entries, part 151.
773. gbcon152.seq - Constructed sequence entries, part 152.
774. gbcon153.seq - Constructed sequence entries, part 153.
775. gbcon154.seq - Constructed sequence entries, part 154.
776. gbcon155.seq - Constructed sequence entries, part 155.
777. gbcon156.seq - Constructed sequence entries, part 156.
778. gbcon157.seq - Constructed sequence entries, part 157.
779. gbcon158.seq - Constructed sequence entries, part 158.
780. gbcon159.seq - Constructed sequence entries, part 159.
781. gbcon16.seq - Constructed sequence entries, part 16.
782. gbcon160.seq - Constructed sequence entries, part 160.
783. gbcon161.seq - Constructed sequence entries, part 161.
784. gbcon162.seq - Constructed sequence entries, part 162.
785. gbcon163.seq - Constructed sequence entries, part 163.
786. gbcon164.seq - Constructed sequence entries, part 164.
787. gbcon165.seq - Constructed sequence entries, part 165.
788. gbcon166.seq - Constructed sequence entries, part 166.
789. gbcon167.seq - Constructed sequence entries, part 167.
790. gbcon168.seq - Constructed sequence entries, part 168.
791. gbcon169.seq - Constructed sequence entries, part 169.
792. gbcon17.seq - Constructed sequence entries, part 17.
793. gbcon170.seq - Constructed sequence entries, part 170.
794. gbcon171.seq - Constructed sequence entries, part 171.
795. gbcon172.seq - Constructed sequence entries, part 172.
796. gbcon173.seq - Constructed sequence entries, part 173.
797. gbcon174.seq - Constructed sequence entries, part 174.
798. gbcon175.seq - Constructed sequence entries, part 175.
799. gbcon176.seq - Constructed sequence entries, part 176.
800. gbcon177.seq - Constructed sequence entries, part 177.
801. gbcon178.seq - Constructed sequence entries, part 178.
802. gbcon179.seq - Constructed sequence entries, part 179.
803. gbcon18.seq - Constructed sequence entries, part 18.
804. gbcon180.seq - Constructed sequence entries, part 180.
805. gbcon181.seq - Constructed sequence entries, part 181.
806. gbcon182.seq - Constructed sequence entries, part 182.
807. gbcon183.seq - Constructed sequence entries, part 183.
808. gbcon184.seq - Constructed sequence entries, part 184.
809. gbcon185.seq - Constructed sequence entries, part 185.
810. gbcon186.seq - Constructed sequence entries, part 186.
811. gbcon187.seq - Constructed sequence entries, part 187.
812. gbcon188.seq - Constructed sequence entries, part 188.
813. gbcon189.seq - Constructed sequence entries, part 189.
814. gbcon19.seq - Constructed sequence entries, part 19.
815. gbcon190.seq - Constructed sequence entries, part 190.
816. gbcon191.seq - Constructed sequence entries, part 191.
817. gbcon192.seq - Constructed sequence entries, part 192.
818. gbcon193.seq - Constructed sequence entries, part 193.
819. gbcon194.seq - Constructed sequence entries, part 194.
820. gbcon195.seq - Constructed sequence entries, part 195.
821. gbcon196.seq - Constructed sequence entries, part 196.
822. gbcon197.seq - Constructed sequence entries, part 197.
823. gbcon198.seq - Constructed sequence entries, part 198.
824. gbcon199.seq - Constructed sequence entries, part 199.
825. gbcon2.seq - Constructed sequence entries, part 2.
826. gbcon20.seq - Constructed sequence entries, part 20.
827. gbcon200.seq - Constructed sequence entries, part 200.
828. gbcon201.seq - Constructed sequence entries, part 201.
829. gbcon202.seq - Constructed sequence entries, part 202.
830. gbcon203.seq - Constructed sequence entries, part 203.
831. gbcon204.seq - Constructed sequence entries, part 204.
832. gbcon205.seq - Constructed sequence entries, part 205.
833. gbcon206.seq - Constructed sequence entries, part 206.
834. gbcon207.seq - Constructed sequence entries, part 207.
835. gbcon208.seq - Constructed sequence entries, part 208.
836. gbcon209.seq - Constructed sequence entries, part 209.
837. gbcon21.seq - Constructed sequence entries, part 21.
838. gbcon210.seq - Constructed sequence entries, part 210.
839. gbcon211.seq - Constructed sequence entries, part 211.
840. gbcon212.seq - Constructed sequence entries, part 212.
841. gbcon213.seq - Constructed sequence entries, part 213.
842. gbcon214.seq - Constructed sequence entries, part 214.
843. gbcon215.seq - Constructed sequence entries, part 215.
844. gbcon216.seq - Constructed sequence entries, part 216.
845. gbcon217.seq - Constructed sequence entries, part 217.
846. gbcon218.seq - Constructed sequence entries, part 218.
847. gbcon219.seq - Constructed sequence entries, part 219.
848. gbcon22.seq - Constructed sequence entries, part 22.
849. gbcon220.seq - Constructed sequence entries, part 220.
850. gbcon221.seq - Constructed sequence entries, part 221.
851. gbcon222.seq - Constructed sequence entries, part 222.
852. gbcon223.seq - Constructed sequence entries, part 223.
853. gbcon23.seq - Constructed sequence entries, part 23.
854. gbcon24.seq - Constructed sequence entries, part 24.
855. gbcon25.seq - Constructed sequence entries, part 25.
856. gbcon26.seq - Constructed sequence entries, part 26.
857. gbcon27.seq - Constructed sequence entries, part 27.
858. gbcon28.seq - Constructed sequence entries, part 28.
859. gbcon29.seq - Constructed sequence entries, part 29.
860. gbcon3.seq - Constructed sequence entries, part 3.
861. gbcon30.seq - Constructed sequence entries, part 30.
862. gbcon31.seq - Constructed sequence entries, part 31.
863. gbcon32.seq - Constructed sequence entries, part 32.
864. gbcon33.seq - Constructed sequence entries, part 33.
865. gbcon34.seq - Constructed sequence entries, part 34.
866. gbcon35.seq - Constructed sequence entries, part 35.
867. gbcon36.seq - Constructed sequence entries, part 36.
868. gbcon37.seq - Constructed sequence entries, part 37.
869. gbcon38.seq - Constructed sequence entries, part 38.
870. gbcon39.seq - Constructed sequence entries, part 39.
871. gbcon4.seq - Constructed sequence entries, part 4.
872. gbcon40.seq - Constructed sequence entries, part 40.
873. gbcon41.seq - Constructed sequence entries, part 41.
874. gbcon42.seq - Constructed sequence entries, part 42.
875. gbcon43.seq - Constructed sequence entries, part 43.
876. gbcon44.seq - Constructed sequence entries, part 44.
877. gbcon45.seq - Constructed sequence entries, part 45.
878. gbcon46.seq - Constructed sequence entries, part 46.
879. gbcon47.seq - Constructed sequence entries, part 47.
880. gbcon48.seq - Constructed sequence entries, part 48.
881. gbcon49.seq - Constructed sequence entries, part 49.
882. gbcon5.seq - Constructed sequence entries, part 5.
883. gbcon50.seq - Constructed sequence entries, part 50.
884. gbcon51.seq - Constructed sequence entries, part 51.
885. gbcon52.seq - Constructed sequence entries, part 52.
886. gbcon53.seq - Constructed sequence entries, part 53.
887. gbcon54.seq - Constructed sequence entries, part 54.
888. gbcon55.seq - Constructed sequence entries, part 55.
889. gbcon56.seq - Constructed sequence entries, part 56.
890. gbcon57.seq - Constructed sequence entries, part 57.
891. gbcon58.seq - Constructed sequence entries, part 58.
892. gbcon59.seq - Constructed sequence entries, part 59.
893. gbcon6.seq - Constructed sequence entries, part 6.
894. gbcon60.seq - Constructed sequence entries, part 60.
895. gbcon61.seq - Constructed sequence entries, part 61.
896. gbcon62.seq - Constructed sequence entries, part 62.
897. gbcon63.seq - Constructed sequence entries, part 63.
898. gbcon64.seq - Constructed sequence entries, part 64.
899. gbcon65.seq - Constructed sequence entries, part 65.
900. gbcon66.seq - Constructed sequence entries, part 66.
901. gbcon67.seq - Constructed sequence entries, part 67.
902. gbcon68.seq - Constructed sequence entries, part 68.
903. gbcon69.seq - Constructed sequence entries, part 69.
904. gbcon7.seq - Constructed sequence entries, part 7.
905. gbcon70.seq - Constructed sequence entries, part 70.
906. gbcon71.seq - Constructed sequence entries, part 71.
907. gbcon72.seq - Constructed sequence entries, part 72.
908. gbcon73.seq - Constructed sequence entries, part 73.
909. gbcon74.seq - Constructed sequence entries, part 74.
910. gbcon75.seq - Constructed sequence entries, part 75.
911. gbcon76.seq - Constructed sequence entries, part 76.
912. gbcon77.seq - Constructed sequence entries, part 77.
913. gbcon78.seq - Constructed sequence entries, part 78.
914. gbcon79.seq - Constructed sequence entries, part 79.
915. gbcon8.seq - Constructed sequence entries, part 8.
916. gbcon80.seq - Constructed sequence entries, part 80.
917. gbcon81.seq - Constructed sequence entries, part 81.
918. gbcon82.seq - Constructed sequence entries, part 82.
919. gbcon83.seq - Constructed sequence entries, part 83.
920. gbcon84.seq - Constructed sequence entries, part 84.
921. gbcon85.seq - Constructed sequence entries, part 85.
922. gbcon86.seq - Constructed sequence entries, part 86.
923. gbcon87.seq - Constructed sequence entries, part 87.
924. gbcon88.seq - Constructed sequence entries, part 88.
925. gbcon89.seq - Constructed sequence entries, part 89.
926. gbcon9.seq - Constructed sequence entries, part 9.
927. gbcon90.seq - Constructed sequence entries, part 90.
928. gbcon91.seq - Constructed sequence entries, part 91.
929. gbcon92.seq - Constructed sequence entries, part 92.
930. gbcon93.seq - Constructed sequence entries, part 93.
931. gbcon94.seq - Constructed sequence entries, part 94.
932. gbcon95.seq - Constructed sequence entries, part 95.
933. gbcon96.seq - Constructed sequence entries, part 96.
934. gbcon97.seq - Constructed sequence entries, part 97.
935. gbcon98.seq - Constructed sequence entries, part 98.
936. gbcon99.seq - Constructed sequence entries, part 99.
937. gbdel.txt - Accession numbers of entries deleted since the previous release.
938. gbenv1.seq - Environmental sampling sequence entries, part 1.
939. gbenv10.seq - Environmental sampling sequence entries, part 10.
940. gbenv11.seq - Environmental sampling sequence entries, part 11.
941. gbenv12.seq - Environmental sampling sequence entries, part 12.
942. gbenv13.seq - Environmental sampling sequence entries, part 13.
943. gbenv14.seq - Environmental sampling sequence entries, part 14.
944. gbenv15.seq - Environmental sampling sequence entries, part 15.
945. gbenv16.seq - Environmental sampling sequence entries, part 16.
946. gbenv17.seq - Environmental sampling sequence entries, part 17.
947. gbenv18.seq - Environmental sampling sequence entries, part 18.
948. gbenv19.seq - Environmental sampling sequence entries, part 19.
949. gbenv2.seq - Environmental sampling sequence entries, part 2.
950. gbenv20.seq - Environmental sampling sequence entries, part 20.
951. gbenv21.seq - Environmental sampling sequence entries, part 21.
952. gbenv22.seq - Environmental sampling sequence entries, part 22.
953. gbenv23.seq - Environmental sampling sequence entries, part 23.
954. gbenv24.seq - Environmental sampling sequence entries, part 24.
955. gbenv25.seq - Environmental sampling sequence entries, part 25.
956. gbenv26.seq - Environmental sampling sequence entries, part 26.
957. gbenv27.seq - Environmental sampling sequence entries, part 27.
958. gbenv28.seq - Environmental sampling sequence entries, part 28.
959. gbenv29.seq - Environmental sampling sequence entries, part 29.
960. gbenv3.seq - Environmental sampling sequence entries, part 3.
961. gbenv30.seq - Environmental sampling sequence entries, part 30.
962. gbenv31.seq - Environmental sampling sequence entries, part 31.
963. gbenv32.seq - Environmental sampling sequence entries, part 32.
964. gbenv33.seq - Environmental sampling sequence entries, part 33.
965. gbenv34.seq - Environmental sampling sequence entries, part 34.
966. gbenv35.seq - Environmental sampling sequence entries, part 35.
967. gbenv36.seq - Environmental sampling sequence entries, part 36.
968. gbenv37.seq - Environmental sampling sequence entries, part 37.
969. gbenv38.seq - Environmental sampling sequence entries, part 38.
970. gbenv39.seq - Environmental sampling sequence entries, part 39.
971. gbenv4.seq - Environmental sampling sequence entries, part 4.
972. gbenv40.seq - Environmental sampling sequence entries, part 40.
973. gbenv41.seq - Environmental sampling sequence entries, part 41.
974. gbenv42.seq - Environmental sampling sequence entries, part 42.
975. gbenv43.seq - Environmental sampling sequence entries, part 43.
976. gbenv44.seq - Environmental sampling sequence entries, part 44.
977. gbenv45.seq - Environmental sampling sequence entries, part 45.
978. gbenv46.seq - Environmental sampling sequence entries, part 46.
979. gbenv47.seq - Environmental sampling sequence entries, part 47.
980. gbenv48.seq - Environmental sampling sequence entries, part 48.
981. gbenv49.seq - Environmental sampling sequence entries, part 49.
982. gbenv5.seq - Environmental sampling sequence entries, part 5.
983. gbenv50.seq - Environmental sampling sequence entries, part 50.
984. gbenv51.seq - Environmental sampling sequence entries, part 51.
985. gbenv52.seq - Environmental sampling sequence entries, part 52.
986. gbenv53.seq - Environmental sampling sequence entries, part 53.
987. gbenv54.seq - Environmental sampling sequence entries, part 54.
988. gbenv55.seq - Environmental sampling sequence entries, part 55.
989. gbenv56.seq - Environmental sampling sequence entries, part 56.
990. gbenv57.seq - Environmental sampling sequence entries, part 57.
991. gbenv58.seq - Environmental sampling sequence entries, part 58.
992. gbenv59.seq - Environmental sampling sequence entries, part 59.
993. gbenv6.seq - Environmental sampling sequence entries, part 6.
994. gbenv60.seq - Environmental sampling sequence entries, part 60.
995. gbenv61.seq - Environmental sampling sequence entries, part 61.
996. gbenv62.seq - Environmental sampling sequence entries, part 62.
997. gbenv63.seq - Environmental sampling sequence entries, part 63.
998. gbenv64.seq - Environmental sampling sequence entries, part 64.
999. gbenv65.seq - Environmental sampling sequence entries, part 65.
1000. gbenv66.seq - Environmental sampling sequence entries, part 66.
1001. gbenv67.seq - Environmental sampling sequence entries, part 67.
1002. gbenv68.seq - Environmental sampling sequence entries, part 68.
1003. gbenv69.seq - Environmental sampling sequence entries, part 69.
1004. gbenv7.seq - Environmental sampling sequence entries, part 7.
1005. gbenv70.seq - Environmental sampling sequence entries, part 70.
1006. gbenv8.seq - Environmental sampling sequence entries, part 8.
1007. gbenv9.seq - Environmental sampling sequence entries, part 9.
1008. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
1009. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
1010. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
1011. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
1012. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
1013. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
1014. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
1015. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
1016. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
1017. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
1018. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
1019. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
1020. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
1021. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
1022. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
1023. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
1024. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
1025. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
1026. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
1027. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
1028. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
1029. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
1030. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
1031. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
1032. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
1033. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
1034. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
1035. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
1036. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
1037. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
1038. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
1039. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
1040. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
1041. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
1042. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
1043. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
1044. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
1045. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
1046. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
1047. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
1048. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
1049. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
1050. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
1051. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
1052. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
1053. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
1054. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
1055. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
1056. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
1057. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
1058. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
1059. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
1060. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
1061. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
1062. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
1063. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
1064. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
1065. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
1066. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
1067. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
1068. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
1069. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
1070. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
1071. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
1072. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
1073. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
1074. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
1075. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
1076. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
1077. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
1078. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
1079. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
1080. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
1081. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
1082. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
1083. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
1084. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
1085. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
1086. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
1087. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
1088. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
1089. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
1090. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
1091. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
1092. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
1093. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
1094. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
1095. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
1096. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
1097. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
1098. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
1099. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
1100. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
1101. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
1102. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
1103. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
1104. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
1105. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
1106. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
1107. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
1108. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
1109. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
1110. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
1111. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
1112. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
1113. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
1114. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
1115. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
1116. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
1117. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
1118. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
1119. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
1120. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
1121. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
1122. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
1123. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
1124. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
1125. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
1126. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
1127. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
1128. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
1129. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
1130. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
1131. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
1132. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
1133. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
1134. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
1135. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
1136. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
1137. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
1138. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
1139. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
1140. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
1141. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
1142. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
1143. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
1144. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
1145. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
1146. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
1147. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
1148. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
1149. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
1150. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
1151. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
1152. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
1153. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
1154. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
1155. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
1156. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
1157. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
1158. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
1159. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
1160. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
1161. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
1162. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
1163. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
1164. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
1165. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
1166. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
1167. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
1168. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
1169. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
1170. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
1171. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
1172. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
1173. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
1174. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
1175. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
1176. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
1177. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
1178. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
1179. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
1180. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
1181. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
1182. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
1183. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
1184. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
1185. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
1186. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
1187. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
1188. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
1189. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
1190. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
1191. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
1192. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
1193. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
1194. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
1195. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
1196. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
1197. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
1198. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
1199. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
1200. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
1201. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
1202. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
1203. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
1204. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
1205. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
1206. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
1207. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
1208. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
1209. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
1210. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
1211. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
1212. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
1213. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
1214. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
1215. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
1216. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
1217. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
1218. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
1219. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
1220. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
1221. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
1222. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
1223. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
1224. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
1225. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
1226. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
1227. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
1228. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
1229. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
1230. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
1231. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
1232. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
1233. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
1234. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
1235. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1236. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1237. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1238. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1239. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1240. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1241. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1242. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1243. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1244. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1245. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1246. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1247. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1248. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1249. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1250. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1251. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1252. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1253. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1254. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1255. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1256. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1257. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1258. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1259. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1260. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1261. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1262. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1263. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1264. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1265. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1266. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1267. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1268. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1269. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1270. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1271. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1272. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1273. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1274. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1275. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1276. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1277. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1278. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1279. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1280. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1281. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1282. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1283. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1284. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1285. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1286. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1287. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1288. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1289. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1290. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1291. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1292. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1293. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1294. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1295. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1296. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1297. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1298. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1299. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1300. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1301. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1302. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1303. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1304. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1305. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1306. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1307. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1308. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1309. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1310. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1311. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1312. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1313. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1314. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1315. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1316. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1317. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1318. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1319. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1320. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1321. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1322. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1323. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1324. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1325. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1326. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1327. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1328. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1329. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1330. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1331. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1332. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1333. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1334. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1335. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1336. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1337. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1338. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1339. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1340. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1341. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1342. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1343. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1344. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1345. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1346. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1347. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1348. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1349. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1350. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1351. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1352. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1353. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1354. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1355. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1356. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1357. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1358. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1359. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1360. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1361. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1362. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1363. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1364. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1365. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1366. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1367. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1368. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1369. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1370. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1371. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1372. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1373. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1374. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1375. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1376. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1377. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1378. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1379. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1380. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1381. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1382. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1383. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1384. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1385. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1386. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1387. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1388. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1389. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1390. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1391. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1392. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1393. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1394. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1395. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1396. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1397. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1398. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1399. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1400. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1401. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1402. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1403. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1404. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1405. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1406. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1407. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1408. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1409. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1410. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1411. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1412. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1413. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1414. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1415. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1416. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1417. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1418. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1419. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1420. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1421. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1422. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1423. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1424. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1425. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1426. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1427. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1428. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1429. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1430. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1431. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1432. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1433. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1434. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1435. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
1436. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
1437. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
1438. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
1439. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
1440. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
1441. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1442. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
1443. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
1444. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
1445. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
1446. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
1447. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
1448. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
1449. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
1450. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
1451. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
1452. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1453. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1454. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
1455. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
1456. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
1457. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
1458. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
1459. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
1460. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
1461. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
1462. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
1463. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
1464. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1465. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
1466. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
1467. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
1468. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
1469. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
1470. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
1471. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
1472. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
1473. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
1474. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
1475. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1476. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
1477. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
1478. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
1479. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
1480. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
1481. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
1482. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
1483. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
1484. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
1485. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
1486. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1487. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
1488. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
1489. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
1490. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
1491. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
1492. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
1493. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
1494. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
1495. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
1496. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
1497. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1498. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
1499. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
1500. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
1501. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
1502. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
1503. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
1504. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
1505. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
1506. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
1507. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
1508. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1509. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
1510. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
1511. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
1512. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
1513. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
1514. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
1515. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
1516. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
1517. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
1518. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
1519. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1520. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
1521. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
1522. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
1523. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
1524. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
1525. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
1526. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
1527. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
1528. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
1529. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
1530. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1531. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
1532. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
1533. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
1534. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
1535. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
1536. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
1537. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
1538. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1539. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1540. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1541. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1542. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1543. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1544. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1545. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1546. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1547. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1548. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1549. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1550. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1551. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1552. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1553. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1554. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1555. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1556. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1557. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1558. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1559. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1560. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1561. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1562. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1563. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1564. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1565. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1566. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1567. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1568. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1569. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1570. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1571. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1572. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1573. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1574. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1575. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1576. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1577. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1578. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1579. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1580. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1581. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1582. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1583. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1584. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1585. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1586. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1587. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1588. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1589. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1590. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1591. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1592. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1593. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1594. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1595. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1596. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1597. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1598. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1599. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1600. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1601. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1602. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1603. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1604. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1605. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1606. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1607. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1608. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1609. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1610. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1611. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1612. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1613. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1614. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1615. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1616. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1617. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1618. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1619. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1620. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1621. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1622. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1623. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1624. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1625. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1626. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1627. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1628. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1629. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1630. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1631. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1632. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1633. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1634. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1635. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1636. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1637. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1638. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1639. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1640. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1641. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1642. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1643. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1644. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1645. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1646. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1647. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1648. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1649. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1650. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1651. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1652. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1653. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1654. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1655. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1656. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1657. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1658. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1659. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1660. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1661. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1662. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1663. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1664. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1665. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1666. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1667. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1668. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1669. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1670. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1671. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1672. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1673. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1674. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1675. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1676. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1677. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1678. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1679. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1680. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1681. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1682. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1683. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1684. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1685. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1686. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1687. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1688. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1689. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1690. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1691. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1692. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1693. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1694. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1695. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1696. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1697. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1698. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1699. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1700. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1701. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1702. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1703. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1704. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1705. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1706. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1707. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1708. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1709. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1710. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1711. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1712. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1713. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1714. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1715. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1716. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1717. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1718. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1719. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1720. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1721. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1722. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1723. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1724. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1725. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1726. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1727. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1728. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1729. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1730. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1731. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1732. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1733. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1734. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1735. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1736. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1737. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1738. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1739. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1740. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1741. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1742. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1743. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1744. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1745. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1746. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1747. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1748. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1749. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1750. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1751. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1752. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1753. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1754. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1755. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1756. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1757. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1758. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1759. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1760. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1761. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1762. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1763. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1764. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1765. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1766. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1767. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1768. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1769. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1770. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1771. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1772. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1773. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1774. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1775. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1776. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1777. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1778. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1779. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1780. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1781. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1782. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1783. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1784. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1785. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1786. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1787. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1788. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1789. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1790. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1791. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1792. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1793. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1794. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1795. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1796. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1797. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1798. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1799. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1800. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1801. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1802. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1803. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1804. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1805. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1806. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1807. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1808. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1809. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1810. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1811. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1812. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1813. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1814. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1815. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1816. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1817. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1818. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1819. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1820. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1821. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1822. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1823. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1824. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1825. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1826. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1827. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1828. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1829. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1830. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1831. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1832. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1833. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1834. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1835. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1836. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1837. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1838. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1839. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1840. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1841. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1842. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1843. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1844. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1845. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1846. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1847. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1848. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1849. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1850. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1851. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1852. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1853. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1854. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1855. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1856. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1857. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1858. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1859. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1860. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1861. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1862. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1863. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1864. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1865. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1866. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1867. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1868. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1869. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1870. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1871. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1872. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1873. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1874. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1875. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1876. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1877. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1878. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1879. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1880. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1881. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1882. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1883. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1884. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1885. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1886. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1887. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1888. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1889. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1890. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1891. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1892. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1893. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1894. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1895. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1896. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1897. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1898. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1899. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1900. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1901. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1902. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1903. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1904. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1905. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1906. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1907. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1908. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1909. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1910. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1911. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1912. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1913. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1914. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1915. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1916. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1917. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1918. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1919. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1920. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1921. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1922. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1923. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1924. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1925. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1926. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1927. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1928. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1929. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1930. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1931. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1932. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1933. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1934. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1935. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1936. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1937. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1938. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1939. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1940. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1941. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1942. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1943. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1944. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1945. gbinv1.seq - Invertebrate sequence entries, part 1.
1946. gbinv10.seq - Invertebrate sequence entries, part 10.
1947. gbinv100.seq - Invertebrate sequence entries, part 100.
1948. gbinv101.seq - Invertebrate sequence entries, part 101.
1949. gbinv102.seq - Invertebrate sequence entries, part 102.
1950. gbinv103.seq - Invertebrate sequence entries, part 103.
1951. gbinv104.seq - Invertebrate sequence entries, part 104.
1952. gbinv105.seq - Invertebrate sequence entries, part 105.
1953. gbinv106.seq - Invertebrate sequence entries, part 106.
1954. gbinv107.seq - Invertebrate sequence entries, part 107.
1955. gbinv108.seq - Invertebrate sequence entries, part 108.
1956. gbinv109.seq - Invertebrate sequence entries, part 109.
1957. gbinv11.seq - Invertebrate sequence entries, part 11.
1958. gbinv110.seq - Invertebrate sequence entries, part 110.
1959. gbinv111.seq - Invertebrate sequence entries, part 111.
1960. gbinv112.seq - Invertebrate sequence entries, part 112.
1961. gbinv113.seq - Invertebrate sequence entries, part 113.
1962. gbinv114.seq - Invertebrate sequence entries, part 114.
1963. gbinv115.seq - Invertebrate sequence entries, part 115.
1964. gbinv116.seq - Invertebrate sequence entries, part 116.
1965. gbinv117.seq - Invertebrate sequence entries, part 117.
1966. gbinv118.seq - Invertebrate sequence entries, part 118.
1967. gbinv119.seq - Invertebrate sequence entries, part 119.
1968. gbinv12.seq - Invertebrate sequence entries, part 12.
1969. gbinv120.seq - Invertebrate sequence entries, part 120.
1970. gbinv121.seq - Invertebrate sequence entries, part 121.
1971. gbinv122.seq - Invertebrate sequence entries, part 122.
1972. gbinv123.seq - Invertebrate sequence entries, part 123.
1973. gbinv124.seq - Invertebrate sequence entries, part 124.
1974. gbinv125.seq - Invertebrate sequence entries, part 125.
1975. gbinv126.seq - Invertebrate sequence entries, part 126.
1976. gbinv127.seq - Invertebrate sequence entries, part 127.
1977. gbinv128.seq - Invertebrate sequence entries, part 128.
1978. gbinv129.seq - Invertebrate sequence entries, part 129.
1979. gbinv13.seq - Invertebrate sequence entries, part 13.
1980. gbinv130.seq - Invertebrate sequence entries, part 130.
1981. gbinv131.seq - Invertebrate sequence entries, part 131.
1982. gbinv132.seq - Invertebrate sequence entries, part 132.
1983. gbinv133.seq - Invertebrate sequence entries, part 133.
1984. gbinv134.seq - Invertebrate sequence entries, part 134.
1985. gbinv135.seq - Invertebrate sequence entries, part 135.
1986. gbinv136.seq - Invertebrate sequence entries, part 136.
1987. gbinv137.seq - Invertebrate sequence entries, part 137.
1988. gbinv138.seq - Invertebrate sequence entries, part 138.
1989. gbinv139.seq - Invertebrate sequence entries, part 139.
1990. gbinv14.seq - Invertebrate sequence entries, part 14.
1991. gbinv140.seq - Invertebrate sequence entries, part 140.
1992. gbinv141.seq - Invertebrate sequence entries, part 141.
1993. gbinv142.seq - Invertebrate sequence entries, part 142.
1994. gbinv143.seq - Invertebrate sequence entries, part 143.
1995. gbinv144.seq - Invertebrate sequence entries, part 144.
1996. gbinv145.seq - Invertebrate sequence entries, part 145.
1997. gbinv146.seq - Invertebrate sequence entries, part 146.
1998. gbinv147.seq - Invertebrate sequence entries, part 147.
1999. gbinv148.seq - Invertebrate sequence entries, part 148.
2000. gbinv149.seq - Invertebrate sequence entries, part 149.
2001. gbinv15.seq - Invertebrate sequence entries, part 15.
2002. gbinv150.seq - Invertebrate sequence entries, part 150.
2003. gbinv151.seq - Invertebrate sequence entries, part 151.
2004. gbinv152.seq - Invertebrate sequence entries, part 152.
2005. gbinv153.seq - Invertebrate sequence entries, part 153.
2006. gbinv154.seq - Invertebrate sequence entries, part 154.
2007. gbinv155.seq - Invertebrate sequence entries, part 155.
2008. gbinv156.seq - Invertebrate sequence entries, part 156.
2009. gbinv157.seq - Invertebrate sequence entries, part 157.
2010. gbinv158.seq - Invertebrate sequence entries, part 158.
2011. gbinv159.seq - Invertebrate sequence entries, part 159.
2012. gbinv16.seq - Invertebrate sequence entries, part 16.
2013. gbinv160.seq - Invertebrate sequence entries, part 160.
2014. gbinv161.seq - Invertebrate sequence entries, part 161.
2015. gbinv162.seq - Invertebrate sequence entries, part 162.
2016. gbinv163.seq - Invertebrate sequence entries, part 163.
2017. gbinv164.seq - Invertebrate sequence entries, part 164.
2018. gbinv165.seq - Invertebrate sequence entries, part 165.
2019. gbinv166.seq - Invertebrate sequence entries, part 166.
2020. gbinv167.seq - Invertebrate sequence entries, part 167.
2021. gbinv168.seq - Invertebrate sequence entries, part 168.
2022. gbinv169.seq - Invertebrate sequence entries, part 169.
2023. gbinv17.seq - Invertebrate sequence entries, part 17.
2024. gbinv170.seq - Invertebrate sequence entries, part 170.
2025. gbinv171.seq - Invertebrate sequence entries, part 171.
2026. gbinv172.seq - Invertebrate sequence entries, part 172.
2027. gbinv173.seq - Invertebrate sequence entries, part 173.
2028. gbinv174.seq - Invertebrate sequence entries, part 174.
2029. gbinv175.seq - Invertebrate sequence entries, part 175.
2030. gbinv176.seq - Invertebrate sequence entries, part 176.
2031. gbinv177.seq - Invertebrate sequence entries, part 177.
2032. gbinv178.seq - Invertebrate sequence entries, part 178.
2033. gbinv179.seq - Invertebrate sequence entries, part 179.
2034. gbinv18.seq - Invertebrate sequence entries, part 18.
2035. gbinv180.seq - Invertebrate sequence entries, part 180.
2036. gbinv181.seq - Invertebrate sequence entries, part 181.
2037. gbinv182.seq - Invertebrate sequence entries, part 182.
2038. gbinv183.seq - Invertebrate sequence entries, part 183.
2039. gbinv184.seq - Invertebrate sequence entries, part 184.
2040. gbinv185.seq - Invertebrate sequence entries, part 185.
2041. gbinv186.seq - Invertebrate sequence entries, part 186.
2042. gbinv187.seq - Invertebrate sequence entries, part 187.
2043. gbinv188.seq - Invertebrate sequence entries, part 188.
2044. gbinv189.seq - Invertebrate sequence entries, part 189.
2045. gbinv19.seq - Invertebrate sequence entries, part 19.
2046. gbinv190.seq - Invertebrate sequence entries, part 190.
2047. gbinv191.seq - Invertebrate sequence entries, part 191.
2048. gbinv192.seq - Invertebrate sequence entries, part 192.
2049. gbinv193.seq - Invertebrate sequence entries, part 193.
2050. gbinv194.seq - Invertebrate sequence entries, part 194.
2051. gbinv195.seq - Invertebrate sequence entries, part 195.
2052. gbinv196.seq - Invertebrate sequence entries, part 196.
2053. gbinv197.seq - Invertebrate sequence entries, part 197.
2054. gbinv198.seq - Invertebrate sequence entries, part 198.
2055. gbinv199.seq - Invertebrate sequence entries, part 199.
2056. gbinv2.seq - Invertebrate sequence entries, part 2.
2057. gbinv20.seq - Invertebrate sequence entries, part 20.
2058. gbinv200.seq - Invertebrate sequence entries, part 200.
2059. gbinv201.seq - Invertebrate sequence entries, part 201.
2060. gbinv202.seq - Invertebrate sequence entries, part 202.
2061. gbinv203.seq - Invertebrate sequence entries, part 203.
2062. gbinv204.seq - Invertebrate sequence entries, part 204.
2063. gbinv205.seq - Invertebrate sequence entries, part 205.
2064. gbinv206.seq - Invertebrate sequence entries, part 206.
2065. gbinv207.seq - Invertebrate sequence entries, part 207.
2066. gbinv208.seq - Invertebrate sequence entries, part 208.
2067. gbinv209.seq - Invertebrate sequence entries, part 209.
2068. gbinv21.seq - Invertebrate sequence entries, part 21.
2069. gbinv210.seq - Invertebrate sequence entries, part 210.
2070. gbinv211.seq - Invertebrate sequence entries, part 211.
2071. gbinv212.seq - Invertebrate sequence entries, part 212.
2072. gbinv213.seq - Invertebrate sequence entries, part 213.
2073. gbinv214.seq - Invertebrate sequence entries, part 214.
2074. gbinv215.seq - Invertebrate sequence entries, part 215.
2075. gbinv216.seq - Invertebrate sequence entries, part 216.
2076. gbinv217.seq - Invertebrate sequence entries, part 217.
2077. gbinv218.seq - Invertebrate sequence entries, part 218.
2078. gbinv219.seq - Invertebrate sequence entries, part 219.
2079. gbinv22.seq - Invertebrate sequence entries, part 22.
2080. gbinv220.seq - Invertebrate sequence entries, part 220.
2081. gbinv221.seq - Invertebrate sequence entries, part 221.
2082. gbinv222.seq - Invertebrate sequence entries, part 222.
2083. gbinv223.seq - Invertebrate sequence entries, part 223.
2084. gbinv224.seq - Invertebrate sequence entries, part 224.
2085. gbinv225.seq - Invertebrate sequence entries, part 225.
2086. gbinv226.seq - Invertebrate sequence entries, part 226.
2087. gbinv227.seq - Invertebrate sequence entries, part 227.
2088. gbinv228.seq - Invertebrate sequence entries, part 228.
2089. gbinv229.seq - Invertebrate sequence entries, part 229.
2090. gbinv23.seq - Invertebrate sequence entries, part 23.
2091. gbinv230.seq - Invertebrate sequence entries, part 230.
2092. gbinv231.seq - Invertebrate sequence entries, part 231.
2093. gbinv232.seq - Invertebrate sequence entries, part 232.
2094. gbinv233.seq - Invertebrate sequence entries, part 233.
2095. gbinv234.seq - Invertebrate sequence entries, part 234.
2096. gbinv235.seq - Invertebrate sequence entries, part 235.
2097. gbinv236.seq - Invertebrate sequence entries, part 236.
2098. gbinv237.seq - Invertebrate sequence entries, part 237.
2099. gbinv238.seq - Invertebrate sequence entries, part 238.
2100. gbinv239.seq - Invertebrate sequence entries, part 239.
2101. gbinv24.seq - Invertebrate sequence entries, part 24.
2102. gbinv240.seq - Invertebrate sequence entries, part 240.
2103. gbinv241.seq - Invertebrate sequence entries, part 241.
2104. gbinv242.seq - Invertebrate sequence entries, part 242.
2105. gbinv243.seq - Invertebrate sequence entries, part 243.
2106. gbinv244.seq - Invertebrate sequence entries, part 244.
2107. gbinv245.seq - Invertebrate sequence entries, part 245.
2108. gbinv246.seq - Invertebrate sequence entries, part 246.
2109. gbinv247.seq - Invertebrate sequence entries, part 247.
2110. gbinv248.seq - Invertebrate sequence entries, part 248.
2111. gbinv249.seq - Invertebrate sequence entries, part 249.
2112. gbinv25.seq - Invertebrate sequence entries, part 25.
2113. gbinv250.seq - Invertebrate sequence entries, part 250.
2114. gbinv251.seq - Invertebrate sequence entries, part 251.
2115. gbinv252.seq - Invertebrate sequence entries, part 252.
2116. gbinv253.seq - Invertebrate sequence entries, part 253.
2117. gbinv254.seq - Invertebrate sequence entries, part 254.
2118. gbinv255.seq - Invertebrate sequence entries, part 255.
2119. gbinv256.seq - Invertebrate sequence entries, part 256.
2120. gbinv257.seq - Invertebrate sequence entries, part 257.
2121. gbinv258.seq - Invertebrate sequence entries, part 258.
2122. gbinv259.seq - Invertebrate sequence entries, part 259.
2123. gbinv26.seq - Invertebrate sequence entries, part 26.
2124. gbinv260.seq - Invertebrate sequence entries, part 260.
2125. gbinv261.seq - Invertebrate sequence entries, part 261.
2126. gbinv262.seq - Invertebrate sequence entries, part 262.
2127. gbinv263.seq - Invertebrate sequence entries, part 263.
2128. gbinv264.seq - Invertebrate sequence entries, part 264.
2129. gbinv265.seq - Invertebrate sequence entries, part 265.
2130. gbinv266.seq - Invertebrate sequence entries, part 266.
2131. gbinv267.seq - Invertebrate sequence entries, part 267.
2132. gbinv268.seq - Invertebrate sequence entries, part 268.
2133. gbinv269.seq - Invertebrate sequence entries, part 269.
2134. gbinv27.seq - Invertebrate sequence entries, part 27.
2135. gbinv270.seq - Invertebrate sequence entries, part 270.
2136. gbinv271.seq - Invertebrate sequence entries, part 271.
2137. gbinv272.seq - Invertebrate sequence entries, part 272.
2138. gbinv273.seq - Invertebrate sequence entries, part 273.
2139. gbinv274.seq - Invertebrate sequence entries, part 274.
2140. gbinv275.seq - Invertebrate sequence entries, part 275.
2141. gbinv276.seq - Invertebrate sequence entries, part 276.
2142. gbinv277.seq - Invertebrate sequence entries, part 277.
2143. gbinv278.seq - Invertebrate sequence entries, part 278.
2144. gbinv279.seq - Invertebrate sequence entries, part 279.
2145. gbinv28.seq - Invertebrate sequence entries, part 28.
2146. gbinv280.seq - Invertebrate sequence entries, part 280.
2147. gbinv281.seq - Invertebrate sequence entries, part 281.
2148. gbinv282.seq - Invertebrate sequence entries, part 282.
2149. gbinv283.seq - Invertebrate sequence entries, part 283.
2150. gbinv284.seq - Invertebrate sequence entries, part 284.
2151. gbinv285.seq - Invertebrate sequence entries, part 285.
2152. gbinv286.seq - Invertebrate sequence entries, part 286.
2153. gbinv287.seq - Invertebrate sequence entries, part 287.
2154. gbinv288.seq - Invertebrate sequence entries, part 288.
2155. gbinv289.seq - Invertebrate sequence entries, part 289.
2156. gbinv29.seq - Invertebrate sequence entries, part 29.
2157. gbinv290.seq - Invertebrate sequence entries, part 290.
2158. gbinv291.seq - Invertebrate sequence entries, part 291.
2159. gbinv292.seq - Invertebrate sequence entries, part 292.
2160. gbinv293.seq - Invertebrate sequence entries, part 293.
2161. gbinv294.seq - Invertebrate sequence entries, part 294.
2162. gbinv295.seq - Invertebrate sequence entries, part 295.
2163. gbinv296.seq - Invertebrate sequence entries, part 296.
2164. gbinv297.seq - Invertebrate sequence entries, part 297.
2165. gbinv298.seq - Invertebrate sequence entries, part 298.
2166. gbinv299.seq - Invertebrate sequence entries, part 299.
2167. gbinv3.seq - Invertebrate sequence entries, part 3.
2168. gbinv30.seq - Invertebrate sequence entries, part 30.
2169. gbinv300.seq - Invertebrate sequence entries, part 300.
2170. gbinv301.seq - Invertebrate sequence entries, part 301.
2171. gbinv302.seq - Invertebrate sequence entries, part 302.
2172. gbinv303.seq - Invertebrate sequence entries, part 303.
2173. gbinv304.seq - Invertebrate sequence entries, part 304.
2174. gbinv305.seq - Invertebrate sequence entries, part 305.
2175. gbinv306.seq - Invertebrate sequence entries, part 306.
2176. gbinv307.seq - Invertebrate sequence entries, part 307.
2177. gbinv308.seq - Invertebrate sequence entries, part 308.
2178. gbinv309.seq - Invertebrate sequence entries, part 309.
2179. gbinv31.seq - Invertebrate sequence entries, part 31.
2180. gbinv310.seq - Invertebrate sequence entries, part 310.
2181. gbinv311.seq - Invertebrate sequence entries, part 311.
2182. gbinv312.seq - Invertebrate sequence entries, part 312.
2183. gbinv313.seq - Invertebrate sequence entries, part 313.
2184. gbinv314.seq - Invertebrate sequence entries, part 314.
2185. gbinv315.seq - Invertebrate sequence entries, part 315.
2186. gbinv316.seq - Invertebrate sequence entries, part 316.
2187. gbinv317.seq - Invertebrate sequence entries, part 317.
2188. gbinv318.seq - Invertebrate sequence entries, part 318.
2189. gbinv319.seq - Invertebrate sequence entries, part 319.
2190. gbinv32.seq - Invertebrate sequence entries, part 32.
2191. gbinv320.seq - Invertebrate sequence entries, part 320.
2192. gbinv321.seq - Invertebrate sequence entries, part 321.
2193. gbinv322.seq - Invertebrate sequence entries, part 322.
2194. gbinv323.seq - Invertebrate sequence entries, part 323.
2195. gbinv324.seq - Invertebrate sequence entries, part 324.
2196. gbinv325.seq - Invertebrate sequence entries, part 325.
2197. gbinv326.seq - Invertebrate sequence entries, part 326.
2198. gbinv327.seq - Invertebrate sequence entries, part 327.
2199. gbinv328.seq - Invertebrate sequence entries, part 328.
2200. gbinv329.seq - Invertebrate sequence entries, part 329.
2201. gbinv33.seq - Invertebrate sequence entries, part 33.
2202. gbinv330.seq - Invertebrate sequence entries, part 330.
2203. gbinv331.seq - Invertebrate sequence entries, part 331.
2204. gbinv332.seq - Invertebrate sequence entries, part 332.
2205. gbinv333.seq - Invertebrate sequence entries, part 333.
2206. gbinv334.seq - Invertebrate sequence entries, part 334.
2207. gbinv335.seq - Invertebrate sequence entries, part 335.
2208. gbinv336.seq - Invertebrate sequence entries, part 336.
2209. gbinv337.seq - Invertebrate sequence entries, part 337.
2210. gbinv338.seq - Invertebrate sequence entries, part 338.
2211. gbinv339.seq - Invertebrate sequence entries, part 339.
2212. gbinv34.seq - Invertebrate sequence entries, part 34.
2213. gbinv340.seq - Invertebrate sequence entries, part 340.
2214. gbinv341.seq - Invertebrate sequence entries, part 341.
2215. gbinv342.seq - Invertebrate sequence entries, part 342.
2216. gbinv343.seq - Invertebrate sequence entries, part 343.
2217. gbinv344.seq - Invertebrate sequence entries, part 344.
2218. gbinv345.seq - Invertebrate sequence entries, part 345.
2219. gbinv346.seq - Invertebrate sequence entries, part 346.
2220. gbinv347.seq - Invertebrate sequence entries, part 347.
2221. gbinv348.seq - Invertebrate sequence entries, part 348.
2222. gbinv349.seq - Invertebrate sequence entries, part 349.
2223. gbinv35.seq - Invertebrate sequence entries, part 35.
2224. gbinv350.seq - Invertebrate sequence entries, part 350.
2225. gbinv351.seq - Invertebrate sequence entries, part 351.
2226. gbinv352.seq - Invertebrate sequence entries, part 352.
2227. gbinv353.seq - Invertebrate sequence entries, part 353.
2228. gbinv354.seq - Invertebrate sequence entries, part 354.
2229. gbinv355.seq - Invertebrate sequence entries, part 355.
2230. gbinv356.seq - Invertebrate sequence entries, part 356.
2231. gbinv357.seq - Invertebrate sequence entries, part 357.
2232. gbinv358.seq - Invertebrate sequence entries, part 358.
2233. gbinv359.seq - Invertebrate sequence entries, part 359.
2234. gbinv36.seq - Invertebrate sequence entries, part 36.
2235. gbinv360.seq - Invertebrate sequence entries, part 360.
2236. gbinv361.seq - Invertebrate sequence entries, part 361.
2237. gbinv362.seq - Invertebrate sequence entries, part 362.
2238. gbinv363.seq - Invertebrate sequence entries, part 363.
2239. gbinv364.seq - Invertebrate sequence entries, part 364.
2240. gbinv365.seq - Invertebrate sequence entries, part 365.
2241. gbinv366.seq - Invertebrate sequence entries, part 366.
2242. gbinv367.seq - Invertebrate sequence entries, part 367.
2243. gbinv368.seq - Invertebrate sequence entries, part 368.
2244. gbinv369.seq - Invertebrate sequence entries, part 369.
2245. gbinv37.seq - Invertebrate sequence entries, part 37.
2246. gbinv370.seq - Invertebrate sequence entries, part 370.
2247. gbinv371.seq - Invertebrate sequence entries, part 371.
2248. gbinv372.seq - Invertebrate sequence entries, part 372.
2249. gbinv373.seq - Invertebrate sequence entries, part 373.
2250. gbinv374.seq - Invertebrate sequence entries, part 374.
2251. gbinv375.seq - Invertebrate sequence entries, part 375.
2252. gbinv376.seq - Invertebrate sequence entries, part 376.
2253. gbinv377.seq - Invertebrate sequence entries, part 377.
2254. gbinv378.seq - Invertebrate sequence entries, part 378.
2255. gbinv379.seq - Invertebrate sequence entries, part 379.
2256. gbinv38.seq - Invertebrate sequence entries, part 38.
2257. gbinv380.seq - Invertebrate sequence entries, part 380.
2258. gbinv381.seq - Invertebrate sequence entries, part 381.
2259. gbinv382.seq - Invertebrate sequence entries, part 382.
2260. gbinv383.seq - Invertebrate sequence entries, part 383.
2261. gbinv384.seq - Invertebrate sequence entries, part 384.
2262. gbinv385.seq - Invertebrate sequence entries, part 385.
2263. gbinv386.seq - Invertebrate sequence entries, part 386.
2264. gbinv387.seq - Invertebrate sequence entries, part 387.
2265. gbinv388.seq - Invertebrate sequence entries, part 388.
2266. gbinv389.seq - Invertebrate sequence entries, part 389.
2267. gbinv39.seq - Invertebrate sequence entries, part 39.
2268. gbinv390.seq - Invertebrate sequence entries, part 390.
2269. gbinv391.seq - Invertebrate sequence entries, part 391.
2270. gbinv392.seq - Invertebrate sequence entries, part 392.
2271. gbinv393.seq - Invertebrate sequence entries, part 393.
2272. gbinv394.seq - Invertebrate sequence entries, part 394.
2273. gbinv395.seq - Invertebrate sequence entries, part 395.
2274. gbinv396.seq - Invertebrate sequence entries, part 396.
2275. gbinv397.seq - Invertebrate sequence entries, part 397.
2276. gbinv398.seq - Invertebrate sequence entries, part 398.
2277. gbinv399.seq - Invertebrate sequence entries, part 399.
2278. gbinv4.seq - Invertebrate sequence entries, part 4.
2279. gbinv40.seq - Invertebrate sequence entries, part 40.
2280. gbinv400.seq - Invertebrate sequence entries, part 400.
2281. gbinv401.seq - Invertebrate sequence entries, part 401.
2282. gbinv402.seq - Invertebrate sequence entries, part 402.
2283. gbinv403.seq - Invertebrate sequence entries, part 403.
2284. gbinv404.seq - Invertebrate sequence entries, part 404.
2285. gbinv405.seq - Invertebrate sequence entries, part 405.
2286. gbinv406.seq - Invertebrate sequence entries, part 406.
2287. gbinv407.seq - Invertebrate sequence entries, part 407.
2288. gbinv408.seq - Invertebrate sequence entries, part 408.
2289. gbinv409.seq - Invertebrate sequence entries, part 409.
2290. gbinv41.seq - Invertebrate sequence entries, part 41.
2291. gbinv410.seq - Invertebrate sequence entries, part 410.
2292. gbinv411.seq - Invertebrate sequence entries, part 411.
2293. gbinv412.seq - Invertebrate sequence entries, part 412.
2294. gbinv413.seq - Invertebrate sequence entries, part 413.
2295. gbinv414.seq - Invertebrate sequence entries, part 414.
2296. gbinv415.seq - Invertebrate sequence entries, part 415.
2297. gbinv416.seq - Invertebrate sequence entries, part 416.
2298. gbinv417.seq - Invertebrate sequence entries, part 417.
2299. gbinv418.seq - Invertebrate sequence entries, part 418.
2300. gbinv419.seq - Invertebrate sequence entries, part 419.
2301. gbinv42.seq - Invertebrate sequence entries, part 42.
2302. gbinv420.seq - Invertebrate sequence entries, part 420.
2303. gbinv421.seq - Invertebrate sequence entries, part 421.
2304. gbinv422.seq - Invertebrate sequence entries, part 422.
2305. gbinv423.seq - Invertebrate sequence entries, part 423.
2306. gbinv424.seq - Invertebrate sequence entries, part 424.
2307. gbinv425.seq - Invertebrate sequence entries, part 425.
2308. gbinv426.seq - Invertebrate sequence entries, part 426.
2309. gbinv427.seq - Invertebrate sequence entries, part 427.
2310. gbinv428.seq - Invertebrate sequence entries, part 428.
2311. gbinv429.seq - Invertebrate sequence entries, part 429.
2312. gbinv43.seq - Invertebrate sequence entries, part 43.
2313. gbinv430.seq - Invertebrate sequence entries, part 430.
2314. gbinv431.seq - Invertebrate sequence entries, part 431.
2315. gbinv432.seq - Invertebrate sequence entries, part 432.
2316. gbinv433.seq - Invertebrate sequence entries, part 433.
2317. gbinv434.seq - Invertebrate sequence entries, part 434.
2318. gbinv435.seq - Invertebrate sequence entries, part 435.
2319. gbinv436.seq - Invertebrate sequence entries, part 436.
2320. gbinv437.seq - Invertebrate sequence entries, part 437.
2321. gbinv438.seq - Invertebrate sequence entries, part 438.
2322. gbinv439.seq - Invertebrate sequence entries, part 439.
2323. gbinv44.seq - Invertebrate sequence entries, part 44.
2324. gbinv440.seq - Invertebrate sequence entries, part 440.
2325. gbinv441.seq - Invertebrate sequence entries, part 441.
2326. gbinv442.seq - Invertebrate sequence entries, part 442.
2327. gbinv443.seq - Invertebrate sequence entries, part 443.
2328. gbinv444.seq - Invertebrate sequence entries, part 444.
2329. gbinv445.seq - Invertebrate sequence entries, part 445.
2330. gbinv446.seq - Invertebrate sequence entries, part 446.
2331. gbinv447.seq - Invertebrate sequence entries, part 447.
2332. gbinv448.seq - Invertebrate sequence entries, part 448.
2333. gbinv449.seq - Invertebrate sequence entries, part 449.
2334. gbinv45.seq - Invertebrate sequence entries, part 45.
2335. gbinv450.seq - Invertebrate sequence entries, part 450.
2336. gbinv451.seq - Invertebrate sequence entries, part 451.
2337. gbinv452.seq - Invertebrate sequence entries, part 452.
2338. gbinv453.seq - Invertebrate sequence entries, part 453.
2339. gbinv454.seq - Invertebrate sequence entries, part 454.
2340. gbinv455.seq - Invertebrate sequence entries, part 455.
2341. gbinv456.seq - Invertebrate sequence entries, part 456.
2342. gbinv457.seq - Invertebrate sequence entries, part 457.
2343. gbinv458.seq - Invertebrate sequence entries, part 458.
2344. gbinv459.seq - Invertebrate sequence entries, part 459.
2345. gbinv46.seq - Invertebrate sequence entries, part 46.
2346. gbinv460.seq - Invertebrate sequence entries, part 460.
2347. gbinv461.seq - Invertebrate sequence entries, part 461.
2348. gbinv462.seq - Invertebrate sequence entries, part 462.
2349. gbinv463.seq - Invertebrate sequence entries, part 463.
2350. gbinv464.seq - Invertebrate sequence entries, part 464.
2351. gbinv465.seq - Invertebrate sequence entries, part 465.
2352. gbinv466.seq - Invertebrate sequence entries, part 466.
2353. gbinv467.seq - Invertebrate sequence entries, part 467.
2354. gbinv468.seq - Invertebrate sequence entries, part 468.
2355. gbinv469.seq - Invertebrate sequence entries, part 469.
2356. gbinv47.seq - Invertebrate sequence entries, part 47.
2357. gbinv470.seq - Invertebrate sequence entries, part 470.
2358. gbinv471.seq - Invertebrate sequence entries, part 471.
2359. gbinv472.seq - Invertebrate sequence entries, part 472.
2360. gbinv473.seq - Invertebrate sequence entries, part 473.
2361. gbinv474.seq - Invertebrate sequence entries, part 474.
2362. gbinv475.seq - Invertebrate sequence entries, part 475.
2363. gbinv476.seq - Invertebrate sequence entries, part 476.
2364. gbinv477.seq - Invertebrate sequence entries, part 477.
2365. gbinv478.seq - Invertebrate sequence entries, part 478.
2366. gbinv479.seq - Invertebrate sequence entries, part 479.
2367. gbinv48.seq - Invertebrate sequence entries, part 48.
2368. gbinv480.seq - Invertebrate sequence entries, part 480.
2369. gbinv481.seq - Invertebrate sequence entries, part 481.
2370. gbinv482.seq - Invertebrate sequence entries, part 482.
2371. gbinv483.seq - Invertebrate sequence entries, part 483.
2372. gbinv484.seq - Invertebrate sequence entries, part 484.
2373. gbinv485.seq - Invertebrate sequence entries, part 485.
2374. gbinv486.seq - Invertebrate sequence entries, part 486.
2375. gbinv487.seq - Invertebrate sequence entries, part 487.
2376. gbinv488.seq - Invertebrate sequence entries, part 488.
2377. gbinv489.seq - Invertebrate sequence entries, part 489.
2378. gbinv49.seq - Invertebrate sequence entries, part 49.
2379. gbinv490.seq - Invertebrate sequence entries, part 490.
2380. gbinv491.seq - Invertebrate sequence entries, part 491.
2381. gbinv492.seq - Invertebrate sequence entries, part 492.
2382. gbinv493.seq - Invertebrate sequence entries, part 493.
2383. gbinv494.seq - Invertebrate sequence entries, part 494.
2384. gbinv495.seq - Invertebrate sequence entries, part 495.
2385. gbinv496.seq - Invertebrate sequence entries, part 496.
2386. gbinv497.seq - Invertebrate sequence entries, part 497.
2387. gbinv498.seq - Invertebrate sequence entries, part 498.
2388. gbinv499.seq - Invertebrate sequence entries, part 499.
2389. gbinv5.seq - Invertebrate sequence entries, part 5.
2390. gbinv50.seq - Invertebrate sequence entries, part 50.
2391. gbinv500.seq - Invertebrate sequence entries, part 500.
2392. gbinv501.seq - Invertebrate sequence entries, part 501.
2393. gbinv502.seq - Invertebrate sequence entries, part 502.
2394. gbinv503.seq - Invertebrate sequence entries, part 503.
2395. gbinv504.seq - Invertebrate sequence entries, part 504.
2396. gbinv505.seq - Invertebrate sequence entries, part 505.
2397. gbinv506.seq - Invertebrate sequence entries, part 506.
2398. gbinv507.seq - Invertebrate sequence entries, part 507.
2399. gbinv508.seq - Invertebrate sequence entries, part 508.
2400. gbinv509.seq - Invertebrate sequence entries, part 509.
2401. gbinv51.seq - Invertebrate sequence entries, part 51.
2402. gbinv510.seq - Invertebrate sequence entries, part 510.
2403. gbinv511.seq - Invertebrate sequence entries, part 511.
2404. gbinv512.seq - Invertebrate sequence entries, part 512.
2405. gbinv513.seq - Invertebrate sequence entries, part 513.
2406. gbinv514.seq - Invertebrate sequence entries, part 514.
2407. gbinv515.seq - Invertebrate sequence entries, part 515.
2408. gbinv516.seq - Invertebrate sequence entries, part 516.
2409. gbinv517.seq - Invertebrate sequence entries, part 517.
2410. gbinv518.seq - Invertebrate sequence entries, part 518.
2411. gbinv519.seq - Invertebrate sequence entries, part 519.
2412. gbinv52.seq - Invertebrate sequence entries, part 52.
2413. gbinv520.seq - Invertebrate sequence entries, part 520.
2414. gbinv521.seq - Invertebrate sequence entries, part 521.
2415. gbinv522.seq - Invertebrate sequence entries, part 522.
2416. gbinv523.seq - Invertebrate sequence entries, part 523.
2417. gbinv524.seq - Invertebrate sequence entries, part 524.
2418. gbinv525.seq - Invertebrate sequence entries, part 525.
2419. gbinv526.seq - Invertebrate sequence entries, part 526.
2420. gbinv527.seq - Invertebrate sequence entries, part 527.
2421. gbinv528.seq - Invertebrate sequence entries, part 528.
2422. gbinv529.seq - Invertebrate sequence entries, part 529.
2423. gbinv53.seq - Invertebrate sequence entries, part 53.
2424. gbinv530.seq - Invertebrate sequence entries, part 530.
2425. gbinv531.seq - Invertebrate sequence entries, part 531.
2426. gbinv532.seq - Invertebrate sequence entries, part 532.
2427. gbinv533.seq - Invertebrate sequence entries, part 533.
2428. gbinv534.seq - Invertebrate sequence entries, part 534.
2429. gbinv535.seq - Invertebrate sequence entries, part 535.
2430. gbinv536.seq - Invertebrate sequence entries, part 536.
2431. gbinv537.seq - Invertebrate sequence entries, part 537.
2432. gbinv538.seq - Invertebrate sequence entries, part 538.
2433. gbinv539.seq - Invertebrate sequence entries, part 539.
2434. gbinv54.seq - Invertebrate sequence entries, part 54.
2435. gbinv540.seq - Invertebrate sequence entries, part 540.
2436. gbinv541.seq - Invertebrate sequence entries, part 541.
2437. gbinv542.seq - Invertebrate sequence entries, part 542.
2438. gbinv543.seq - Invertebrate sequence entries, part 543.
2439. gbinv544.seq - Invertebrate sequence entries, part 544.
2440. gbinv545.seq - Invertebrate sequence entries, part 545.
2441. gbinv546.seq - Invertebrate sequence entries, part 546.
2442. gbinv547.seq - Invertebrate sequence entries, part 547.
2443. gbinv548.seq - Invertebrate sequence entries, part 548.
2444. gbinv549.seq - Invertebrate sequence entries, part 549.
2445. gbinv55.seq - Invertebrate sequence entries, part 55.
2446. gbinv550.seq - Invertebrate sequence entries, part 550.
2447. gbinv551.seq - Invertebrate sequence entries, part 551.
2448. gbinv552.seq - Invertebrate sequence entries, part 552.
2449. gbinv553.seq - Invertebrate sequence entries, part 553.
2450. gbinv554.seq - Invertebrate sequence entries, part 554.
2451. gbinv555.seq - Invertebrate sequence entries, part 555.
2452. gbinv556.seq - Invertebrate sequence entries, part 556.
2453. gbinv557.seq - Invertebrate sequence entries, part 557.
2454. gbinv558.seq - Invertebrate sequence entries, part 558.
2455. gbinv559.seq - Invertebrate sequence entries, part 559.
2456. gbinv56.seq - Invertebrate sequence entries, part 56.
2457. gbinv57.seq - Invertebrate sequence entries, part 57.
2458. gbinv58.seq - Invertebrate sequence entries, part 58.
2459. gbinv59.seq - Invertebrate sequence entries, part 59.
2460. gbinv6.seq - Invertebrate sequence entries, part 6.
2461. gbinv60.seq - Invertebrate sequence entries, part 60.
2462. gbinv61.seq - Invertebrate sequence entries, part 61.
2463. gbinv62.seq - Invertebrate sequence entries, part 62.
2464. gbinv63.seq - Invertebrate sequence entries, part 63.
2465. gbinv64.seq - Invertebrate sequence entries, part 64.
2466. gbinv65.seq - Invertebrate sequence entries, part 65.
2467. gbinv66.seq - Invertebrate sequence entries, part 66.
2468. gbinv67.seq - Invertebrate sequence entries, part 67.
2469. gbinv68.seq - Invertebrate sequence entries, part 68.
2470. gbinv69.seq - Invertebrate sequence entries, part 69.
2471. gbinv7.seq - Invertebrate sequence entries, part 7.
2472. gbinv70.seq - Invertebrate sequence entries, part 70.
2473. gbinv71.seq - Invertebrate sequence entries, part 71.
2474. gbinv72.seq - Invertebrate sequence entries, part 72.
2475. gbinv73.seq - Invertebrate sequence entries, part 73.
2476. gbinv74.seq - Invertebrate sequence entries, part 74.
2477. gbinv75.seq - Invertebrate sequence entries, part 75.
2478. gbinv76.seq - Invertebrate sequence entries, part 76.
2479. gbinv77.seq - Invertebrate sequence entries, part 77.
2480. gbinv78.seq - Invertebrate sequence entries, part 78.
2481. gbinv79.seq - Invertebrate sequence entries, part 79.
2482. gbinv8.seq - Invertebrate sequence entries, part 8.
2483. gbinv80.seq - Invertebrate sequence entries, part 80.
2484. gbinv81.seq - Invertebrate sequence entries, part 81.
2485. gbinv82.seq - Invertebrate sequence entries, part 82.
2486. gbinv83.seq - Invertebrate sequence entries, part 83.
2487. gbinv84.seq - Invertebrate sequence entries, part 84.
2488. gbinv85.seq - Invertebrate sequence entries, part 85.
2489. gbinv86.seq - Invertebrate sequence entries, part 86.
2490. gbinv87.seq - Invertebrate sequence entries, part 87.
2491. gbinv88.seq - Invertebrate sequence entries, part 88.
2492. gbinv89.seq - Invertebrate sequence entries, part 89.
2493. gbinv9.seq - Invertebrate sequence entries, part 9.
2494. gbinv90.seq - Invertebrate sequence entries, part 90.
2495. gbinv91.seq - Invertebrate sequence entries, part 91.
2496. gbinv92.seq - Invertebrate sequence entries, part 92.
2497. gbinv93.seq - Invertebrate sequence entries, part 93.
2498. gbinv94.seq - Invertebrate sequence entries, part 94.
2499. gbinv95.seq - Invertebrate sequence entries, part 95.
2500. gbinv96.seq - Invertebrate sequence entries, part 96.
2501. gbinv97.seq - Invertebrate sequence entries, part 97.
2502. gbinv98.seq - Invertebrate sequence entries, part 98.
2503. gbinv99.seq - Invertebrate sequence entries, part 99.
2504. gbmam1.seq - Other mammalian sequence entries, part 1.
2505. gbmam10.seq - Other mammalian sequence entries, part 10.
2506. gbmam100.seq - Other mammalian sequence entries, part 100.
2507. gbmam101.seq - Other mammalian sequence entries, part 101.
2508. gbmam102.seq - Other mammalian sequence entries, part 102.
2509. gbmam103.seq - Other mammalian sequence entries, part 103.
2510. gbmam104.seq - Other mammalian sequence entries, part 104.
2511. gbmam105.seq - Other mammalian sequence entries, part 105.
2512. gbmam106.seq - Other mammalian sequence entries, part 106.
2513. gbmam107.seq - Other mammalian sequence entries, part 107.
2514. gbmam108.seq - Other mammalian sequence entries, part 108.
2515. gbmam109.seq - Other mammalian sequence entries, part 109.
2516. gbmam11.seq - Other mammalian sequence entries, part 11.
2517. gbmam110.seq - Other mammalian sequence entries, part 110.
2518. gbmam111.seq - Other mammalian sequence entries, part 111.
2519. gbmam112.seq - Other mammalian sequence entries, part 112.
2520. gbmam113.seq - Other mammalian sequence entries, part 113.
2521. gbmam114.seq - Other mammalian sequence entries, part 114.
2522. gbmam115.seq - Other mammalian sequence entries, part 115.
2523. gbmam116.seq - Other mammalian sequence entries, part 116.
2524. gbmam117.seq - Other mammalian sequence entries, part 117.
2525. gbmam118.seq - Other mammalian sequence entries, part 118.
2526. gbmam119.seq - Other mammalian sequence entries, part 119.
2527. gbmam12.seq - Other mammalian sequence entries, part 12.
2528. gbmam120.seq - Other mammalian sequence entries, part 120.
2529. gbmam121.seq - Other mammalian sequence entries, part 121.
2530. gbmam122.seq - Other mammalian sequence entries, part 122.
2531. gbmam123.seq - Other mammalian sequence entries, part 123.
2532. gbmam124.seq - Other mammalian sequence entries, part 124.
2533. gbmam125.seq - Other mammalian sequence entries, part 125.
2534. gbmam13.seq - Other mammalian sequence entries, part 13.
2535. gbmam14.seq - Other mammalian sequence entries, part 14.
2536. gbmam15.seq - Other mammalian sequence entries, part 15.
2537. gbmam16.seq - Other mammalian sequence entries, part 16.
2538. gbmam17.seq - Other mammalian sequence entries, part 17.
2539. gbmam18.seq - Other mammalian sequence entries, part 18.
2540. gbmam19.seq - Other mammalian sequence entries, part 19.
2541. gbmam2.seq - Other mammalian sequence entries, part 2.
2542. gbmam20.seq - Other mammalian sequence entries, part 20.
2543. gbmam21.seq - Other mammalian sequence entries, part 21.
2544. gbmam22.seq - Other mammalian sequence entries, part 22.
2545. gbmam23.seq - Other mammalian sequence entries, part 23.
2546. gbmam24.seq - Other mammalian sequence entries, part 24.
2547. gbmam25.seq - Other mammalian sequence entries, part 25.
2548. gbmam26.seq - Other mammalian sequence entries, part 26.
2549. gbmam27.seq - Other mammalian sequence entries, part 27.
2550. gbmam28.seq - Other mammalian sequence entries, part 28.
2551. gbmam29.seq - Other mammalian sequence entries, part 29.
2552. gbmam3.seq - Other mammalian sequence entries, part 3.
2553. gbmam30.seq - Other mammalian sequence entries, part 30.
2554. gbmam31.seq - Other mammalian sequence entries, part 31.
2555. gbmam32.seq - Other mammalian sequence entries, part 32.
2556. gbmam33.seq - Other mammalian sequence entries, part 33.
2557. gbmam34.seq - Other mammalian sequence entries, part 34.
2558. gbmam35.seq - Other mammalian sequence entries, part 35.
2559. gbmam36.seq - Other mammalian sequence entries, part 36.
2560. gbmam37.seq - Other mammalian sequence entries, part 37.
2561. gbmam38.seq - Other mammalian sequence entries, part 38.
2562. gbmam39.seq - Other mammalian sequence entries, part 39.
2563. gbmam4.seq - Other mammalian sequence entries, part 4.
2564. gbmam40.seq - Other mammalian sequence entries, part 40.
2565. gbmam41.seq - Other mammalian sequence entries, part 41.
2566. gbmam42.seq - Other mammalian sequence entries, part 42.
2567. gbmam43.seq - Other mammalian sequence entries, part 43.
2568. gbmam44.seq - Other mammalian sequence entries, part 44.
2569. gbmam45.seq - Other mammalian sequence entries, part 45.
2570. gbmam46.seq - Other mammalian sequence entries, part 46.
2571. gbmam47.seq - Other mammalian sequence entries, part 47.
2572. gbmam48.seq - Other mammalian sequence entries, part 48.
2573. gbmam49.seq - Other mammalian sequence entries, part 49.
2574. gbmam5.seq - Other mammalian sequence entries, part 5.
2575. gbmam50.seq - Other mammalian sequence entries, part 50.
2576. gbmam51.seq - Other mammalian sequence entries, part 51.
2577. gbmam52.seq - Other mammalian sequence entries, part 52.
2578. gbmam53.seq - Other mammalian sequence entries, part 53.
2579. gbmam54.seq - Other mammalian sequence entries, part 54.
2580. gbmam55.seq - Other mammalian sequence entries, part 55.
2581. gbmam56.seq - Other mammalian sequence entries, part 56.
2582. gbmam57.seq - Other mammalian sequence entries, part 57.
2583. gbmam58.seq - Other mammalian sequence entries, part 58.
2584. gbmam59.seq - Other mammalian sequence entries, part 59.
2585. gbmam6.seq - Other mammalian sequence entries, part 6.
2586. gbmam60.seq - Other mammalian sequence entries, part 60.
2587. gbmam61.seq - Other mammalian sequence entries, part 61.
2588. gbmam62.seq - Other mammalian sequence entries, part 62.
2589. gbmam63.seq - Other mammalian sequence entries, part 63.
2590. gbmam64.seq - Other mammalian sequence entries, part 64.
2591. gbmam65.seq - Other mammalian sequence entries, part 65.
2592. gbmam66.seq - Other mammalian sequence entries, part 66.
2593. gbmam67.seq - Other mammalian sequence entries, part 67.
2594. gbmam68.seq - Other mammalian sequence entries, part 68.
2595. gbmam69.seq - Other mammalian sequence entries, part 69.
2596. gbmam7.seq - Other mammalian sequence entries, part 7.
2597. gbmam70.seq - Other mammalian sequence entries, part 70.
2598. gbmam71.seq - Other mammalian sequence entries, part 71.
2599. gbmam72.seq - Other mammalian sequence entries, part 72.
2600. gbmam73.seq - Other mammalian sequence entries, part 73.
2601. gbmam74.seq - Other mammalian sequence entries, part 74.
2602. gbmam75.seq - Other mammalian sequence entries, part 75.
2603. gbmam76.seq - Other mammalian sequence entries, part 76.
2604. gbmam77.seq - Other mammalian sequence entries, part 77.
2605. gbmam78.seq - Other mammalian sequence entries, part 78.
2606. gbmam79.seq - Other mammalian sequence entries, part 79.
2607. gbmam8.seq - Other mammalian sequence entries, part 8.
2608. gbmam80.seq - Other mammalian sequence entries, part 80.
2609. gbmam81.seq - Other mammalian sequence entries, part 81.
2610. gbmam82.seq - Other mammalian sequence entries, part 82.
2611. gbmam83.seq - Other mammalian sequence entries, part 83.
2612. gbmam84.seq - Other mammalian sequence entries, part 84.
2613. gbmam85.seq - Other mammalian sequence entries, part 85.
2614. gbmam86.seq - Other mammalian sequence entries, part 86.
2615. gbmam87.seq - Other mammalian sequence entries, part 87.
2616. gbmam88.seq - Other mammalian sequence entries, part 88.
2617. gbmam89.seq - Other mammalian sequence entries, part 89.
2618. gbmam9.seq - Other mammalian sequence entries, part 9.
2619. gbmam90.seq - Other mammalian sequence entries, part 90.
2620. gbmam91.seq - Other mammalian sequence entries, part 91.
2621. gbmam92.seq - Other mammalian sequence entries, part 92.
2622. gbmam93.seq - Other mammalian sequence entries, part 93.
2623. gbmam94.seq - Other mammalian sequence entries, part 94.
2624. gbmam95.seq - Other mammalian sequence entries, part 95.
2625. gbmam96.seq - Other mammalian sequence entries, part 96.
2626. gbmam97.seq - Other mammalian sequence entries, part 97.
2627. gbmam98.seq - Other mammalian sequence entries, part 98.
2628. gbmam99.seq - Other mammalian sequence entries, part 99.
2629. gbnew.txt - Accession numbers of entries new since the previous release.
2630. gbpat1.seq - Patent sequence entries, part 1.
2631. gbpat10.seq - Patent sequence entries, part 10.
2632. gbpat100.seq - Patent sequence entries, part 100.
2633. gbpat101.seq - Patent sequence entries, part 101.
2634. gbpat102.seq - Patent sequence entries, part 102.
2635. gbpat103.seq - Patent sequence entries, part 103.
2636. gbpat104.seq - Patent sequence entries, part 104.
2637. gbpat105.seq - Patent sequence entries, part 105.
2638. gbpat106.seq - Patent sequence entries, part 106.
2639. gbpat107.seq - Patent sequence entries, part 107.
2640. gbpat108.seq - Patent sequence entries, part 108.
2641. gbpat109.seq - Patent sequence entries, part 109.
2642. gbpat11.seq - Patent sequence entries, part 11.
2643. gbpat110.seq - Patent sequence entries, part 110.
2644. gbpat111.seq - Patent sequence entries, part 111.
2645. gbpat112.seq - Patent sequence entries, part 112.
2646. gbpat113.seq - Patent sequence entries, part 113.
2647. gbpat114.seq - Patent sequence entries, part 114.
2648. gbpat115.seq - Patent sequence entries, part 115.
2649. gbpat116.seq - Patent sequence entries, part 116.
2650. gbpat117.seq - Patent sequence entries, part 117.
2651. gbpat118.seq - Patent sequence entries, part 118.
2652. gbpat119.seq - Patent sequence entries, part 119.
2653. gbpat12.seq - Patent sequence entries, part 12.
2654. gbpat120.seq - Patent sequence entries, part 120.
2655. gbpat121.seq - Patent sequence entries, part 121.
2656. gbpat122.seq - Patent sequence entries, part 122.
2657. gbpat123.seq - Patent sequence entries, part 123.
2658. gbpat124.seq - Patent sequence entries, part 124.
2659. gbpat125.seq - Patent sequence entries, part 125.
2660. gbpat126.seq - Patent sequence entries, part 126.
2661. gbpat127.seq - Patent sequence entries, part 127.
2662. gbpat128.seq - Patent sequence entries, part 128.
2663. gbpat129.seq - Patent sequence entries, part 129.
2664. gbpat13.seq - Patent sequence entries, part 13.
2665. gbpat130.seq - Patent sequence entries, part 130.
2666. gbpat131.seq - Patent sequence entries, part 131.
2667. gbpat132.seq - Patent sequence entries, part 132.
2668. gbpat133.seq - Patent sequence entries, part 133.
2669. gbpat134.seq - Patent sequence entries, part 134.
2670. gbpat135.seq - Patent sequence entries, part 135.
2671. gbpat136.seq - Patent sequence entries, part 136.
2672. gbpat137.seq - Patent sequence entries, part 137.
2673. gbpat138.seq - Patent sequence entries, part 138.
2674. gbpat139.seq - Patent sequence entries, part 139.
2675. gbpat14.seq - Patent sequence entries, part 14.
2676. gbpat140.seq - Patent sequence entries, part 140.
2677. gbpat141.seq - Patent sequence entries, part 141.
2678. gbpat142.seq - Patent sequence entries, part 142.
2679. gbpat143.seq - Patent sequence entries, part 143.
2680. gbpat144.seq - Patent sequence entries, part 144.
2681. gbpat145.seq - Patent sequence entries, part 145.
2682. gbpat146.seq - Patent sequence entries, part 146.
2683. gbpat147.seq - Patent sequence entries, part 147.
2684. gbpat148.seq - Patent sequence entries, part 148.
2685. gbpat149.seq - Patent sequence entries, part 149.
2686. gbpat15.seq - Patent sequence entries, part 15.
2687. gbpat150.seq - Patent sequence entries, part 150.
2688. gbpat151.seq - Patent sequence entries, part 151.
2689. gbpat152.seq - Patent sequence entries, part 152.
2690. gbpat153.seq - Patent sequence entries, part 153.
2691. gbpat154.seq - Patent sequence entries, part 154.
2692. gbpat155.seq - Patent sequence entries, part 155.
2693. gbpat156.seq - Patent sequence entries, part 156.
2694. gbpat157.seq - Patent sequence entries, part 157.
2695. gbpat158.seq - Patent sequence entries, part 158.
2696. gbpat159.seq - Patent sequence entries, part 159.
2697. gbpat16.seq - Patent sequence entries, part 16.
2698. gbpat160.seq - Patent sequence entries, part 160.
2699. gbpat161.seq - Patent sequence entries, part 161.
2700. gbpat162.seq - Patent sequence entries, part 162.
2701. gbpat163.seq - Patent sequence entries, part 163.
2702. gbpat164.seq - Patent sequence entries, part 164.
2703. gbpat165.seq - Patent sequence entries, part 165.
2704. gbpat166.seq - Patent sequence entries, part 166.
2705. gbpat167.seq - Patent sequence entries, part 167.
2706. gbpat168.seq - Patent sequence entries, part 168.
2707. gbpat169.seq - Patent sequence entries, part 169.
2708. gbpat17.seq - Patent sequence entries, part 17.
2709. gbpat170.seq - Patent sequence entries, part 170.
2710. gbpat171.seq - Patent sequence entries, part 171.
2711. gbpat172.seq - Patent sequence entries, part 172.
2712. gbpat173.seq - Patent sequence entries, part 173.
2713. gbpat174.seq - Patent sequence entries, part 174.
2714. gbpat175.seq - Patent sequence entries, part 175.
2715. gbpat176.seq - Patent sequence entries, part 176.
2716. gbpat177.seq - Patent sequence entries, part 177.
2717. gbpat178.seq - Patent sequence entries, part 178.
2718. gbpat179.seq - Patent sequence entries, part 179.
2719. gbpat18.seq - Patent sequence entries, part 18.
2720. gbpat180.seq - Patent sequence entries, part 180.
2721. gbpat181.seq - Patent sequence entries, part 181.
2722. gbpat182.seq - Patent sequence entries, part 182.
2723. gbpat183.seq - Patent sequence entries, part 183.
2724. gbpat184.seq - Patent sequence entries, part 184.
2725. gbpat185.seq - Patent sequence entries, part 185.
2726. gbpat186.seq - Patent sequence entries, part 186.
2727. gbpat187.seq - Patent sequence entries, part 187.
2728. gbpat188.seq - Patent sequence entries, part 188.
2729. gbpat189.seq - Patent sequence entries, part 189.
2730. gbpat19.seq - Patent sequence entries, part 19.
2731. gbpat190.seq - Patent sequence entries, part 190.
2732. gbpat191.seq - Patent sequence entries, part 191.
2733. gbpat192.seq - Patent sequence entries, part 192.
2734. gbpat193.seq - Patent sequence entries, part 193.
2735. gbpat194.seq - Patent sequence entries, part 194.
2736. gbpat195.seq - Patent sequence entries, part 195.
2737. gbpat196.seq - Patent sequence entries, part 196.
2738. gbpat197.seq - Patent sequence entries, part 197.
2739. gbpat198.seq - Patent sequence entries, part 198.
2740. gbpat199.seq - Patent sequence entries, part 199.
2741. gbpat2.seq - Patent sequence entries, part 2.
2742. gbpat20.seq - Patent sequence entries, part 20.
2743. gbpat200.seq - Patent sequence entries, part 200.
2744. gbpat201.seq - Patent sequence entries, part 201.
2745. gbpat202.seq - Patent sequence entries, part 202.
2746. gbpat203.seq - Patent sequence entries, part 203.
2747. gbpat204.seq - Patent sequence entries, part 204.
2748. gbpat205.seq - Patent sequence entries, part 205.
2749. gbpat206.seq - Patent sequence entries, part 206.
2750. gbpat207.seq - Patent sequence entries, part 207.
2751. gbpat208.seq - Patent sequence entries, part 208.
2752. gbpat209.seq - Patent sequence entries, part 209.
2753. gbpat21.seq - Patent sequence entries, part 21.
2754. gbpat210.seq - Patent sequence entries, part 210.
2755. gbpat211.seq - Patent sequence entries, part 211.
2756. gbpat212.seq - Patent sequence entries, part 212.
2757. gbpat213.seq - Patent sequence entries, part 213.
2758. gbpat214.seq - Patent sequence entries, part 214.
2759. gbpat215.seq - Patent sequence entries, part 215.
2760. gbpat216.seq - Patent sequence entries, part 216.
2761. gbpat217.seq - Patent sequence entries, part 217.
2762. gbpat218.seq - Patent sequence entries, part 218.
2763. gbpat219.seq - Patent sequence entries, part 219.
2764. gbpat22.seq - Patent sequence entries, part 22.
2765. gbpat220.seq - Patent sequence entries, part 220.
2766. gbpat221.seq - Patent sequence entries, part 221.
2767. gbpat222.seq - Patent sequence entries, part 222.
2768. gbpat223.seq - Patent sequence entries, part 223.
2769. gbpat224.seq - Patent sequence entries, part 224.
2770. gbpat225.seq - Patent sequence entries, part 225.
2771. gbpat226.seq - Patent sequence entries, part 226.
2772. gbpat227.seq - Patent sequence entries, part 227.
2773. gbpat228.seq - Patent sequence entries, part 228.
2774. gbpat229.seq - Patent sequence entries, part 229.
2775. gbpat23.seq - Patent sequence entries, part 23.
2776. gbpat230.seq - Patent sequence entries, part 230.
2777. gbpat231.seq - Patent sequence entries, part 231.
2778. gbpat232.seq - Patent sequence entries, part 232.
2779. gbpat233.seq - Patent sequence entries, part 233.
2780. gbpat234.seq - Patent sequence entries, part 234.
2781. gbpat235.seq - Patent sequence entries, part 235.
2782. gbpat236.seq - Patent sequence entries, part 236.
2783. gbpat237.seq - Patent sequence entries, part 237.
2784. gbpat238.seq - Patent sequence entries, part 238.
2785. gbpat239.seq - Patent sequence entries, part 239.
2786. gbpat24.seq - Patent sequence entries, part 24.
2787. gbpat240.seq - Patent sequence entries, part 240.
2788. gbpat241.seq - Patent sequence entries, part 241.
2789. gbpat242.seq - Patent sequence entries, part 242.
2790. gbpat243.seq - Patent sequence entries, part 243.
2791. gbpat244.seq - Patent sequence entries, part 244.
2792. gbpat245.seq - Patent sequence entries, part 245.
2793. gbpat246.seq - Patent sequence entries, part 246.
2794. gbpat247.seq - Patent sequence entries, part 247.
2795. gbpat25.seq - Patent sequence entries, part 25.
2796. gbpat26.seq - Patent sequence entries, part 26.
2797. gbpat27.seq - Patent sequence entries, part 27.
2798. gbpat28.seq - Patent sequence entries, part 28.
2799. gbpat29.seq - Patent sequence entries, part 29.
2800. gbpat3.seq - Patent sequence entries, part 3.
2801. gbpat30.seq - Patent sequence entries, part 30.
2802. gbpat31.seq - Patent sequence entries, part 31.
2803. gbpat32.seq - Patent sequence entries, part 32.
2804. gbpat33.seq - Patent sequence entries, part 33.
2805. gbpat34.seq - Patent sequence entries, part 34.
2806. gbpat35.seq - Patent sequence entries, part 35.
2807. gbpat36.seq - Patent sequence entries, part 36.
2808. gbpat37.seq - Patent sequence entries, part 37.
2809. gbpat38.seq - Patent sequence entries, part 38.
2810. gbpat39.seq - Patent sequence entries, part 39.
2811. gbpat4.seq - Patent sequence entries, part 4.
2812. gbpat40.seq - Patent sequence entries, part 40.
2813. gbpat41.seq - Patent sequence entries, part 41.
2814. gbpat42.seq - Patent sequence entries, part 42.
2815. gbpat43.seq - Patent sequence entries, part 43.
2816. gbpat44.seq - Patent sequence entries, part 44.
2817. gbpat45.seq - Patent sequence entries, part 45.
2818. gbpat46.seq - Patent sequence entries, part 46.
2819. gbpat47.seq - Patent sequence entries, part 47.
2820. gbpat48.seq - Patent sequence entries, part 48.
2821. gbpat49.seq - Patent sequence entries, part 49.
2822. gbpat5.seq - Patent sequence entries, part 5.
2823. gbpat50.seq - Patent sequence entries, part 50.
2824. gbpat51.seq - Patent sequence entries, part 51.
2825. gbpat52.seq - Patent sequence entries, part 52.
2826. gbpat53.seq - Patent sequence entries, part 53.
2827. gbpat54.seq - Patent sequence entries, part 54.
2828. gbpat55.seq - Patent sequence entries, part 55.
2829. gbpat56.seq - Patent sequence entries, part 56.
2830. gbpat57.seq - Patent sequence entries, part 57.
2831. gbpat58.seq - Patent sequence entries, part 58.
2832. gbpat59.seq - Patent sequence entries, part 59.
2833. gbpat6.seq - Patent sequence entries, part 6.
2834. gbpat60.seq - Patent sequence entries, part 60.
2835. gbpat61.seq - Patent sequence entries, part 61.
2836. gbpat62.seq - Patent sequence entries, part 62.
2837. gbpat63.seq - Patent sequence entries, part 63.
2838. gbpat64.seq - Patent sequence entries, part 64.
2839. gbpat65.seq - Patent sequence entries, part 65.
2840. gbpat66.seq - Patent sequence entries, part 66.
2841. gbpat67.seq - Patent sequence entries, part 67.
2842. gbpat68.seq - Patent sequence entries, part 68.
2843. gbpat69.seq - Patent sequence entries, part 69.
2844. gbpat7.seq - Patent sequence entries, part 7.
2845. gbpat70.seq - Patent sequence entries, part 70.
2846. gbpat71.seq - Patent sequence entries, part 71.
2847. gbpat72.seq - Patent sequence entries, part 72.
2848. gbpat73.seq - Patent sequence entries, part 73.
2849. gbpat74.seq - Patent sequence entries, part 74.
2850. gbpat75.seq - Patent sequence entries, part 75.
2851. gbpat76.seq - Patent sequence entries, part 76.
2852. gbpat77.seq - Patent sequence entries, part 77.
2853. gbpat78.seq - Patent sequence entries, part 78.
2854. gbpat79.seq - Patent sequence entries, part 79.
2855. gbpat8.seq - Patent sequence entries, part 8.
2856. gbpat80.seq - Patent sequence entries, part 80.
2857. gbpat81.seq - Patent sequence entries, part 81.
2858. gbpat82.seq - Patent sequence entries, part 82.
2859. gbpat83.seq - Patent sequence entries, part 83.
2860. gbpat84.seq - Patent sequence entries, part 84.
2861. gbpat85.seq - Patent sequence entries, part 85.
2862. gbpat86.seq - Patent sequence entries, part 86.
2863. gbpat87.seq - Patent sequence entries, part 87.
2864. gbpat88.seq - Patent sequence entries, part 88.
2865. gbpat89.seq - Patent sequence entries, part 89.
2866. gbpat9.seq - Patent sequence entries, part 9.
2867. gbpat90.seq - Patent sequence entries, part 90.
2868. gbpat91.seq - Patent sequence entries, part 91.
2869. gbpat92.seq - Patent sequence entries, part 92.
2870. gbpat93.seq - Patent sequence entries, part 93.
2871. gbpat94.seq - Patent sequence entries, part 94.
2872. gbpat95.seq - Patent sequence entries, part 95.
2873. gbpat96.seq - Patent sequence entries, part 96.
2874. gbpat97.seq - Patent sequence entries, part 97.
2875. gbpat98.seq - Patent sequence entries, part 98.
2876. gbpat99.seq - Patent sequence entries, part 99.
2877. gbphg1.seq - Phage sequence entries, part 1.
2878. gbphg2.seq - Phage sequence entries, part 2.
2879. gbphg3.seq - Phage sequence entries, part 3.
2880. gbphg4.seq - Phage sequence entries, part 4.
2881. gbphg5.seq - Phage sequence entries, part 5.
2882. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2883. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2884. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2885. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2886. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2887. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2888. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2889. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2890. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2891. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2892. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2893. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2894. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2895. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2896. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2897. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2898. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2899. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2900. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2901. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2902. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2903. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2904. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2905. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2906. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2907. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2908. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2909. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2910. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2911. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2912. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2913. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2914. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2915. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2916. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2917. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2918. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2919. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2920. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2921. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2922. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2923. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2924. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2925. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2926. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2927. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2928. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2929. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2930. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2931. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2932. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2933. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2934. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
2935. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
2936. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
2937. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
2938. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2939. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
2940. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
2941. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
2942. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
2943. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
2944. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
2945. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
2946. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
2947. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
2948. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
2949. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2950. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
2951. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
2952. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
2953. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
2954. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
2955. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
2956. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
2957. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
2958. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
2959. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
2960. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2961. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
2962. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
2963. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
2964. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
2965. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
2966. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
2967. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
2968. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
2969. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
2970. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
2971. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2972. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
2973. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
2974. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
2975. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
2976. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
2977. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
2978. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
2979. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
2980. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
2981. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
2982. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2983. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
2984. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
2985. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
2986. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
2987. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
2988. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
2989. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
2990. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
2991. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
2992. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
2993. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2994. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2995. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
2996. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
2997. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
2998. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
2999. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
3000. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
3001. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
3002. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
3003. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
3004. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
3005. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
3006. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
3007. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
3008. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
3009. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
3010. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
3011. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
3012. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
3013. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
3014. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
3015. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
3016. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
3017. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
3018. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
3019. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
3020. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
3021. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
3022. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
3023. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
3024. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
3025. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
3026. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
3027. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
3028. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
3029. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
3030. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
3031. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
3032. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
3033. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
3034. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
3035. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
3036. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
3037. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
3038. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
3039. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
3040. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
3041. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
3042. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
3043. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
3044. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
3045. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
3046. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
3047. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
3048. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
3049. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
3050. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
3051. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
3052. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
3053. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
3054. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
3055. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
3056. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
3057. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
3058. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
3059. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
3060. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
3061. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
3062. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
3063. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
3064. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
3065. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
3066. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
3067. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
3068. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
3069. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
3070. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
3071. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
3072. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
3073. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
3074. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
3075. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
3076. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
3077. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
3078. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
3079. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
3080. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
3081. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
3082. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
3083. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
3084. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
3085. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
3086. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
3087. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
3088. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
3089. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
3090. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
3091. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
3092. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
3093. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
3094. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
3095. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
3096. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
3097. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
3098. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
3099. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
3100. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
3101. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
3102. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
3103. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
3104. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
3105. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
3106. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
3107. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
3108. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
3109. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
3110. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
3111. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
3112. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
3113. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
3114. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
3115. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
3116. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
3117. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
3118. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
3119. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
3120. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
3121. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
3122. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
3123. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
3124. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
3125. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
3126. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
3127. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
3128. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
3129. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
3130. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
3131. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
3132. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
3133. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
3134. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
3135. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
3136. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
3137. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
3138. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
3139. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
3140. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
3141. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
3142. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
3143. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
3144. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
3145. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
3146. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
3147. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
3148. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
3149. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
3150. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
3151. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
3152. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
3153. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
3154. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
3155. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
3156. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
3157. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
3158. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
3159. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
3160. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
3161. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
3162. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
3163. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
3164. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
3165. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
3166. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
3167. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
3168. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
3169. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
3170. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
3171. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
3172. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
3173. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
3174. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
3175. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
3176. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
3177. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
3178. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
3179. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
3180. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
3181. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
3182. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
3183. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
3184. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
3185. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
3186. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
3187. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
3188. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
3189. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
3190. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
3191. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
3192. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
3193. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
3194. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
3195. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
3196. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
3197. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
3198. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
3199. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
3200. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
3201. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
3202. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
3203. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
3204. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
3205. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
3206. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
3207. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
3208. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
3209. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
3210. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
3211. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
3212. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
3213. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
3214. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
3215. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
3216. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
3217. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
3218. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
3219. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
3220. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
3221. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
3222. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
3223. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
3224. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
3225. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
3226. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
3227. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
3228. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
3229. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
3230. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
3231. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
3232. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
3233. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
3234. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
3235. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
3236. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
3237. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
3238. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
3239. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
3240. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
3241. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
3242. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
3243. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
3244. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
3245. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
3246. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
3247. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
3248. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
3249. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
3250. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
3251. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
3252. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
3253. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
3254. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
3255. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
3256. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
3257. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
3258. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
3259. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
3260. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
3261. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
3262. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
3263. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
3264. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
3265. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
3266. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
3267. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
3268. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
3269. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
3270. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
3271. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
3272. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
3273. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
3274. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
3275. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
3276. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
3277. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
3278. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
3279. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
3280. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
3281. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
3282. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
3283. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
3284. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
3285. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
3286. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
3287. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
3288. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
3289. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
3290. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
3291. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
3292. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
3293. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
3294. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
3295. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
3296. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
3297. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
3298. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
3299. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
3300. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
3301. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
3302. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
3303. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
3304. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
3305. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
3306. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
3307. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
3308. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
3309. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
3310. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
3311. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
3312. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
3313. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
3314. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
3315. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
3316. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
3317. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
3318. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
3319. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
3320. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
3321. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
3322. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
3323. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
3324. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
3325. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
3326. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
3327. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
3328. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
3329. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
3330. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
3331. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
3332. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
3333. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
3334. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
3335. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
3336. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
3337. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
3338. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
3339. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
3340. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
3341. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
3342. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
3343. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
3344. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
3345. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
3346. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
3347. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
3348. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
3349. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
3350. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
3351. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
3352. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
3353. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
3354. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
3355. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
3356. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
3357. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
3358. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
3359. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
3360. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
3361. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
3362. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
3363. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
3364. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
3365. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
3366. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
3367. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
3368. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
3369. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
3370. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
3371. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
3372. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
3373. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
3374. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
3375. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
3376. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
3377. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
3378. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
3379. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
3380. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548.
3381. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549.
3382. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
3383. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550.
3384. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551.
3385. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552.
3386. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553.
3387. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554.
3388. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555.
3389. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556.
3390. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557.
3391. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558.
3392. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559.
3393. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
3394. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560.
3395. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561.
3396. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562.
3397. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563.
3398. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564.
3399. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565.
3400. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566.
3401. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567.
3402. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568.
3403. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569.
3404. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
3405. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570.
3406. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571.
3407. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572.
3408. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573.
3409. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574.
3410. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575.
3411. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576.
3412. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577.
3413. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578.
3414. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579.
3415. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
3416. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580.
3417. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581.
3418. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582.
3419. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583.
3420. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584.
3421. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585.
3422. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586.
3423. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587.
3424. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588.
3425. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589.
3426. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
3427. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590.
3428. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591.
3429. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592.
3430. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593.
3431. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594.
3432. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595.
3433. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596.
3434. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597.
3435. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598.
3436. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599.
3437. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
3438. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
3439. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600.
3440. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601.
3441. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602.
3442. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603.
3443. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604.
3444. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605.
3445. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606.
3446. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607.
3447. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608.
3448. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609.
3449. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
3450. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610.
3451. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611.
3452. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612.
3453. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613.
3454. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614.
3455. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615.
3456. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616.
3457. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617.
3458. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618.
3459. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619.
3460. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
3461. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620.
3462. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621.
3463. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622.
3464. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623.
3465. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624.
3466. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625.
3467. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626.
3468. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627.
3469. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628.
3470. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629.
3471. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
3472. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630.
3473. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631.
3474. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632.
3475. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633.
3476. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634.
3477. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635.
3478. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636.
3479. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637.
3480. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638.
3481. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639.
3482. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
3483. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640.
3484. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641.
3485. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642.
3486. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643.
3487. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644.
3488. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645.
3489. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646.
3490. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647.
3491. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648.
3492. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649.
3493. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
3494. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650.
3495. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651.
3496. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652.
3497. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653.
3498. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654.
3499. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655.
3500. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656.
3501. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657.
3502. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658.
3503. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659.
3504. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
3505. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660.
3506. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661.
3507. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662.
3508. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663.
3509. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664.
3510. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665.
3511. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666.
3512. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667.
3513. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668.
3514. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669.
3515. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
3516. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670.
3517. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671.
3518. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672.
3519. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673.
3520. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674.
3521. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675.
3522. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676.
3523. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677.
3524. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678.
3525. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679.
3526. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
3527. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680.
3528. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681.
3529. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682.
3530. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683.
3531. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684.
3532. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685.
3533. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686.
3534. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687.
3535. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688.
3536. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689.
3537. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
3538. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690.
3539. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691.
3540. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692.
3541. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693.
3542. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694.
3543. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695.
3544. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696.
3545. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697.
3546. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698.
3547. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699.
3548. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
3549. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
3550. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700.
3551. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701.
3552. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702.
3553. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703.
3554. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704.
3555. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705.
3556. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706.
3557. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707.
3558. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708.
3559. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709.
3560. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
3561. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710.
3562. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711.
3563. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712.
3564. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713.
3565. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714.
3566. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715.
3567. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716.
3568. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717.
3569. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718.
3570. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719.
3571. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
3572. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720.
3573. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721.
3574. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722.
3575. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723.
3576. gbpln724.seq - Plant sequence entries (including fungi and algae), part 724.
3577. gbpln725.seq - Plant sequence entries (including fungi and algae), part 725.
3578. gbpln726.seq - Plant sequence entries (including fungi and algae), part 726.
3579. gbpln727.seq - Plant sequence entries (including fungi and algae), part 727.
3580. gbpln728.seq - Plant sequence entries (including fungi and algae), part 728.
3581. gbpln729.seq - Plant sequence entries (including fungi and algae), part 729.
3582. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
3583. gbpln730.seq - Plant sequence entries (including fungi and algae), part 730.
3584. gbpln731.seq - Plant sequence entries (including fungi and algae), part 731.
3585. gbpln732.seq - Plant sequence entries (including fungi and algae), part 732.
3586. gbpln733.seq - Plant sequence entries (including fungi and algae), part 733.
3587. gbpln734.seq - Plant sequence entries (including fungi and algae), part 734.
3588. gbpln735.seq - Plant sequence entries (including fungi and algae), part 735.
3589. gbpln736.seq - Plant sequence entries (including fungi and algae), part 736.
3590. gbpln737.seq - Plant sequence entries (including fungi and algae), part 737.
3591. gbpln738.seq - Plant sequence entries (including fungi and algae), part 738.
3592. gbpln739.seq - Plant sequence entries (including fungi and algae), part 739.
3593. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
3594. gbpln740.seq - Plant sequence entries (including fungi and algae), part 740.
3595. gbpln741.seq - Plant sequence entries (including fungi and algae), part 741.
3596. gbpln742.seq - Plant sequence entries (including fungi and algae), part 742.
3597. gbpln743.seq - Plant sequence entries (including fungi and algae), part 743.
3598. gbpln744.seq - Plant sequence entries (including fungi and algae), part 744.
3599. gbpln745.seq - Plant sequence entries (including fungi and algae), part 745.
3600. gbpln746.seq - Plant sequence entries (including fungi and algae), part 746.
3601. gbpln747.seq - Plant sequence entries (including fungi and algae), part 747.
3602. gbpln748.seq - Plant sequence entries (including fungi and algae), part 748.
3603. gbpln749.seq - Plant sequence entries (including fungi and algae), part 749.
3604. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
3605. gbpln750.seq - Plant sequence entries (including fungi and algae), part 750.
3606. gbpln751.seq - Plant sequence entries (including fungi and algae), part 751.
3607. gbpln752.seq - Plant sequence entries (including fungi and algae), part 752.
3608. gbpln753.seq - Plant sequence entries (including fungi and algae), part 753.
3609. gbpln754.seq - Plant sequence entries (including fungi and algae), part 754.
3610. gbpln755.seq - Plant sequence entries (including fungi and algae), part 755.
3611. gbpln756.seq - Plant sequence entries (including fungi and algae), part 756.
3612. gbpln757.seq - Plant sequence entries (including fungi and algae), part 757.
3613. gbpln758.seq - Plant sequence entries (including fungi and algae), part 758.
3614. gbpln759.seq - Plant sequence entries (including fungi and algae), part 759.
3615. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
3616. gbpln760.seq - Plant sequence entries (including fungi and algae), part 760.
3617. gbpln761.seq - Plant sequence entries (including fungi and algae), part 761.
3618. gbpln762.seq - Plant sequence entries (including fungi and algae), part 762.
3619. gbpln763.seq - Plant sequence entries (including fungi and algae), part 763.
3620. gbpln764.seq - Plant sequence entries (including fungi and algae), part 764.
3621. gbpln765.seq - Plant sequence entries (including fungi and algae), part 765.
3622. gbpln766.seq - Plant sequence entries (including fungi and algae), part 766.
3623. gbpln767.seq - Plant sequence entries (including fungi and algae), part 767.
3624. gbpln768.seq - Plant sequence entries (including fungi and algae), part 768.
3625. gbpln769.seq - Plant sequence entries (including fungi and algae), part 769.
3626. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
3627. gbpln770.seq - Plant sequence entries (including fungi and algae), part 770.
3628. gbpln771.seq - Plant sequence entries (including fungi and algae), part 771.
3629. gbpln772.seq - Plant sequence entries (including fungi and algae), part 772.
3630. gbpln773.seq - Plant sequence entries (including fungi and algae), part 773.
3631. gbpln774.seq - Plant sequence entries (including fungi and algae), part 774.
3632. gbpln775.seq - Plant sequence entries (including fungi and algae), part 775.
3633. gbpln776.seq - Plant sequence entries (including fungi and algae), part 776.
3634. gbpln777.seq - Plant sequence entries (including fungi and algae), part 777.
3635. gbpln778.seq - Plant sequence entries (including fungi and algae), part 778.
3636. gbpln779.seq - Plant sequence entries (including fungi and algae), part 779.
3637. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
3638. gbpln780.seq - Plant sequence entries (including fungi and algae), part 780.
3639. gbpln781.seq - Plant sequence entries (including fungi and algae), part 781.
3640. gbpln782.seq - Plant sequence entries (including fungi and algae), part 782.
3641. gbpln783.seq - Plant sequence entries (including fungi and algae), part 783.
3642. gbpln784.seq - Plant sequence entries (including fungi and algae), part 784.
3643. gbpln785.seq - Plant sequence entries (including fungi and algae), part 785.
3644. gbpln786.seq - Plant sequence entries (including fungi and algae), part 786.
3645. gbpln787.seq - Plant sequence entries (including fungi and algae), part 787.
3646. gbpln788.seq - Plant sequence entries (including fungi and algae), part 788.
3647. gbpln789.seq - Plant sequence entries (including fungi and algae), part 789.
3648. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
3649. gbpln790.seq - Plant sequence entries (including fungi and algae), part 790.
3650. gbpln791.seq - Plant sequence entries (including fungi and algae), part 791.
3651. gbpln792.seq - Plant sequence entries (including fungi and algae), part 792.
3652. gbpln793.seq - Plant sequence entries (including fungi and algae), part 793.
3653. gbpln794.seq - Plant sequence entries (including fungi and algae), part 794.
3654. gbpln795.seq - Plant sequence entries (including fungi and algae), part 795.
3655. gbpln796.seq - Plant sequence entries (including fungi and algae), part 796.
3656. gbpln797.seq - Plant sequence entries (including fungi and algae), part 797.
3657. gbpln798.seq - Plant sequence entries (including fungi and algae), part 798.
3658. gbpln799.seq - Plant sequence entries (including fungi and algae), part 799.
3659. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
3660. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
3661. gbpln800.seq - Plant sequence entries (including fungi and algae), part 800.
3662. gbpln801.seq - Plant sequence entries (including fungi and algae), part 801.
3663. gbpln802.seq - Plant sequence entries (including fungi and algae), part 802.
3664. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
3665. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
3666. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
3667. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
3668. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
3669. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
3670. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
3671. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
3672. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
3673. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
3674. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
3675. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
3676. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
3677. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
3678. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
3679. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
3680. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
3681. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
3682. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
3683. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
3684. gbpri1.seq - Primate sequence entries, part 1.
3685. gbpri10.seq - Primate sequence entries, part 10.
3686. gbpri11.seq - Primate sequence entries, part 11.
3687. gbpri12.seq - Primate sequence entries, part 12.
3688. gbpri13.seq - Primate sequence entries, part 13.
3689. gbpri14.seq - Primate sequence entries, part 14.
3690. gbpri15.seq - Primate sequence entries, part 15.
3691. gbpri16.seq - Primate sequence entries, part 16.
3692. gbpri17.seq - Primate sequence entries, part 17.
3693. gbpri18.seq - Primate sequence entries, part 18.
3694. gbpri19.seq - Primate sequence entries, part 19.
3695. gbpri2.seq - Primate sequence entries, part 2.
3696. gbpri20.seq - Primate sequence entries, part 20.
3697. gbpri21.seq - Primate sequence entries, part 21.
3698. gbpri22.seq - Primate sequence entries, part 22.
3699. gbpri23.seq - Primate sequence entries, part 23.
3700. gbpri24.seq - Primate sequence entries, part 24.
3701. gbpri25.seq - Primate sequence entries, part 25.
3702. gbpri26.seq - Primate sequence entries, part 26.
3703. gbpri27.seq - Primate sequence entries, part 27.
3704. gbpri28.seq - Primate sequence entries, part 28.
3705. gbpri29.seq - Primate sequence entries, part 29.
3706. gbpri3.seq - Primate sequence entries, part 3.
3707. gbpri30.seq - Primate sequence entries, part 30.
3708. gbpri31.seq - Primate sequence entries, part 31.
3709. gbpri32.seq - Primate sequence entries, part 32.
3710. gbpri33.seq - Primate sequence entries, part 33.
3711. gbpri34.seq - Primate sequence entries, part 34.
3712. gbpri35.seq - Primate sequence entries, part 35.
3713. gbpri36.seq - Primate sequence entries, part 36.
3714. gbpri37.seq - Primate sequence entries, part 37.
3715. gbpri38.seq - Primate sequence entries, part 38.
3716. gbpri39.seq - Primate sequence entries, part 39.
3717. gbpri4.seq - Primate sequence entries, part 4.
3718. gbpri40.seq - Primate sequence entries, part 40.
3719. gbpri41.seq - Primate sequence entries, part 41.
3720. gbpri42.seq - Primate sequence entries, part 42.
3721. gbpri43.seq - Primate sequence entries, part 43.
3722. gbpri44.seq - Primate sequence entries, part 44.
3723. gbpri45.seq - Primate sequence entries, part 45.
3724. gbpri46.seq - Primate sequence entries, part 46.
3725. gbpri47.seq - Primate sequence entries, part 47.
3726. gbpri48.seq - Primate sequence entries, part 48.
3727. gbpri49.seq - Primate sequence entries, part 49.
3728. gbpri5.seq - Primate sequence entries, part 5.
3729. gbpri50.seq - Primate sequence entries, part 50.
3730. gbpri51.seq - Primate sequence entries, part 51.
3731. gbpri52.seq - Primate sequence entries, part 52.
3732. gbpri53.seq - Primate sequence entries, part 53.
3733. gbpri54.seq - Primate sequence entries, part 54.
3734. gbpri55.seq - Primate sequence entries, part 55.
3735. gbpri56.seq - Primate sequence entries, part 56.
3736. gbpri6.seq - Primate sequence entries, part 6.
3737. gbpri7.seq - Primate sequence entries, part 7.
3738. gbpri8.seq - Primate sequence entries, part 8.
3739. gbpri9.seq - Primate sequence entries, part 9.
3740. gbrel.txt - Release notes (this document).
3741. gbrod1.seq - Rodent sequence entries, part 1.
3742. gbrod10.seq - Rodent sequence entries, part 10.
3743. gbrod11.seq - Rodent sequence entries, part 11.
3744. gbrod12.seq - Rodent sequence entries, part 12.
3745. gbrod13.seq - Rodent sequence entries, part 13.
3746. gbrod14.seq - Rodent sequence entries, part 14.
3747. gbrod15.seq - Rodent sequence entries, part 15.
3748. gbrod16.seq - Rodent sequence entries, part 16.
3749. gbrod17.seq - Rodent sequence entries, part 17.
3750. gbrod18.seq - Rodent sequence entries, part 18.
3751. gbrod19.seq - Rodent sequence entries, part 19.
3752. gbrod2.seq - Rodent sequence entries, part 2.
3753. gbrod20.seq - Rodent sequence entries, part 20.
3754. gbrod21.seq - Rodent sequence entries, part 21.
3755. gbrod22.seq - Rodent sequence entries, part 22.
3756. gbrod23.seq - Rodent sequence entries, part 23.
3757. gbrod24.seq - Rodent sequence entries, part 24.
3758. gbrod25.seq - Rodent sequence entries, part 25.
3759. gbrod26.seq - Rodent sequence entries, part 26.
3760. gbrod27.seq - Rodent sequence entries, part 27.
3761. gbrod28.seq - Rodent sequence entries, part 28.
3762. gbrod29.seq - Rodent sequence entries, part 29.
3763. gbrod3.seq - Rodent sequence entries, part 3.
3764. gbrod30.seq - Rodent sequence entries, part 30.
3765. gbrod31.seq - Rodent sequence entries, part 31.
3766. gbrod32.seq - Rodent sequence entries, part 32.
3767. gbrod33.seq - Rodent sequence entries, part 33.
3768. gbrod34.seq - Rodent sequence entries, part 34.
3769. gbrod35.seq - Rodent sequence entries, part 35.
3770. gbrod36.seq - Rodent sequence entries, part 36.
3771. gbrod37.seq - Rodent sequence entries, part 37.
3772. gbrod38.seq - Rodent sequence entries, part 38.
3773. gbrod39.seq - Rodent sequence entries, part 39.
3774. gbrod4.seq - Rodent sequence entries, part 4.
3775. gbrod40.seq - Rodent sequence entries, part 40.
3776. gbrod41.seq - Rodent sequence entries, part 41.
3777. gbrod42.seq - Rodent sequence entries, part 42.
3778. gbrod43.seq - Rodent sequence entries, part 43.
3779. gbrod44.seq - Rodent sequence entries, part 44.
3780. gbrod45.seq - Rodent sequence entries, part 45.
3781. gbrod46.seq - Rodent sequence entries, part 46.
3782. gbrod47.seq - Rodent sequence entries, part 47.
3783. gbrod48.seq - Rodent sequence entries, part 48.
3784. gbrod49.seq - Rodent sequence entries, part 49.
3785. gbrod5.seq - Rodent sequence entries, part 5.
3786. gbrod50.seq - Rodent sequence entries, part 50.
3787. gbrod51.seq - Rodent sequence entries, part 51.
3788. gbrod52.seq - Rodent sequence entries, part 52.
3789. gbrod53.seq - Rodent sequence entries, part 53.
3790. gbrod54.seq - Rodent sequence entries, part 54.
3791. gbrod55.seq - Rodent sequence entries, part 55.
3792. gbrod56.seq - Rodent sequence entries, part 56.
3793. gbrod57.seq - Rodent sequence entries, part 57.
3794. gbrod58.seq - Rodent sequence entries, part 58.
3795. gbrod59.seq - Rodent sequence entries, part 59.
3796. gbrod6.seq - Rodent sequence entries, part 6.
3797. gbrod60.seq - Rodent sequence entries, part 60.
3798. gbrod61.seq - Rodent sequence entries, part 61.
3799. gbrod62.seq - Rodent sequence entries, part 62.
3800. gbrod63.seq - Rodent sequence entries, part 63.
3801. gbrod64.seq - Rodent sequence entries, part 64.
3802. gbrod65.seq - Rodent sequence entries, part 65.
3803. gbrod66.seq - Rodent sequence entries, part 66.
3804. gbrod67.seq - Rodent sequence entries, part 67.
3805. gbrod68.seq - Rodent sequence entries, part 68.
3806. gbrod69.seq - Rodent sequence entries, part 69.
3807. gbrod7.seq - Rodent sequence entries, part 7.
3808. gbrod70.seq - Rodent sequence entries, part 70.
3809. gbrod71.seq - Rodent sequence entries, part 71.
3810. gbrod72.seq - Rodent sequence entries, part 72.
3811. gbrod73.seq - Rodent sequence entries, part 73.
3812. gbrod74.seq - Rodent sequence entries, part 74.
3813. gbrod75.seq - Rodent sequence entries, part 75.
3814. gbrod76.seq - Rodent sequence entries, part 76.
3815. gbrod77.seq - Rodent sequence entries, part 77.
3816. gbrod8.seq - Rodent sequence entries, part 8.
3817. gbrod9.seq - Rodent sequence entries, part 9.
3818. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
3819. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
3820. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
3821. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
3822. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
3823. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
3824. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
3825. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
3826. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
3827. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
3828. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
3829. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
3830. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
3831. gbsyn11.seq - Synthetic and chimeric sequence entries, part 11.
3832. gbsyn12.seq - Synthetic and chimeric sequence entries, part 12.
3833. gbsyn13.seq - Synthetic and chimeric sequence entries, part 13.
3834. gbsyn14.seq - Synthetic and chimeric sequence entries, part 14.
3835. gbsyn15.seq - Synthetic and chimeric sequence entries, part 15.
3836. gbsyn16.seq - Synthetic and chimeric sequence entries, part 16.
3837. gbsyn17.seq - Synthetic and chimeric sequence entries, part 17.
3838. gbsyn18.seq - Synthetic and chimeric sequence entries, part 18.
3839. gbsyn19.seq - Synthetic and chimeric sequence entries, part 19.
3840. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
3841. gbsyn20.seq - Synthetic and chimeric sequence entries, part 20.
3842. gbsyn21.seq - Synthetic and chimeric sequence entries, part 21.
3843. gbsyn22.seq - Synthetic and chimeric sequence entries, part 22.
3844. gbsyn23.seq - Synthetic and chimeric sequence entries, part 23.
3845. gbsyn24.seq - Synthetic and chimeric sequence entries, part 24.
3846. gbsyn25.seq - Synthetic and chimeric sequence entries, part 25.
3847. gbsyn26.seq - Synthetic and chimeric sequence entries, part 26.
3848. gbsyn27.seq - Synthetic and chimeric sequence entries, part 27.
3849. gbsyn28.seq - Synthetic and chimeric sequence entries, part 28.
3850. gbsyn29.seq - Synthetic and chimeric sequence entries, part 29.
3851. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
3852. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
3853. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
3854. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
3855. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
3856. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
3857. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
3858. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
3859. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
3860. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
3861. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
3862. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
3863. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
3864. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
3865. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
3866. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
3867. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
3868. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
3869. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
3870. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
3871. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
3872. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
3873. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
3874. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
3875. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
3876. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
3877. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
3878. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
3879. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
3880. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
3881. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
3882. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
3883. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
3884. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
3885. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
3886. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
3887. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
3888. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
3889. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
3890. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
3891. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
3892. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
3893. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
3894. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
3895. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
3896. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
3897. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
3898. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
3899. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
3900. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
3901. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
3902. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
3903. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
3904. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
3905. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
3906. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
3907. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
3908. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
3909. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
3910. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
3911. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
3912. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
3913. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
3914. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
3915. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
3916. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
3917. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
3918. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
3919. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
3920. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
3921. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
3922. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
3923. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
3924. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
3925. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
3926. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
3927. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
3928. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
3929. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
3930. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
3931. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
3932. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
3933. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
3934. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
3935. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
3936. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
3937. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
3938. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
3939. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
3940. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
3941. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
3942. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
3943. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
3944. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
3945. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
3946. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
3947. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
3948. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
3949. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
3950. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
3951. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
3952. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
3953. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
3954. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
3955. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
3956. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
3957. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
3958. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
3959. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
3960. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
3961. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
3962. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
3963. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
3964. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
3965. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
3966. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
3967. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
3968. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
3969. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
3970. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
3971. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
3972. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
3973. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
3974. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
3975. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
3976. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
3977. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
3978. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
3979. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
3980. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
3981. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
3982. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
3983. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
3984. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
3985. gbuna1.seq - Unannotated sequence entries, part 1.
3986. gbvrl1.seq - Viral sequence entries, part 1.
3987. gbvrl10.seq - Viral sequence entries, part 10.
3988. gbvrl100.seq - Viral sequence entries, part 100.
3989. gbvrl101.seq - Viral sequence entries, part 101.
3990. gbvrl102.seq - Viral sequence entries, part 102.
3991. gbvrl103.seq - Viral sequence entries, part 103.
3992. gbvrl104.seq - Viral sequence entries, part 104.
3993. gbvrl105.seq - Viral sequence entries, part 105.
3994. gbvrl106.seq - Viral sequence entries, part 106.
3995. gbvrl107.seq - Viral sequence entries, part 107.
3996. gbvrl108.seq - Viral sequence entries, part 108.
3997. gbvrl109.seq - Viral sequence entries, part 109.
3998. gbvrl11.seq - Viral sequence entries, part 11.
3999. gbvrl110.seq - Viral sequence entries, part 110.
4000. gbvrl111.seq - Viral sequence entries, part 111.
4001. gbvrl112.seq - Viral sequence entries, part 112.
4002. gbvrl113.seq - Viral sequence entries, part 113.
4003. gbvrl114.seq - Viral sequence entries, part 114.
4004. gbvrl115.seq - Viral sequence entries, part 115.
4005. gbvrl116.seq - Viral sequence entries, part 116.
4006. gbvrl117.seq - Viral sequence entries, part 117.
4007. gbvrl118.seq - Viral sequence entries, part 118.
4008. gbvrl119.seq - Viral sequence entries, part 119.
4009. gbvrl12.seq - Viral sequence entries, part 12.
4010. gbvrl120.seq - Viral sequence entries, part 120.
4011. gbvrl121.seq - Viral sequence entries, part 121.
4012. gbvrl122.seq - Viral sequence entries, part 122.
4013. gbvrl123.seq - Viral sequence entries, part 123.
4014. gbvrl124.seq - Viral sequence entries, part 124.
4015. gbvrl125.seq - Viral sequence entries, part 125.
4016. gbvrl126.seq - Viral sequence entries, part 126.
4017. gbvrl127.seq - Viral sequence entries, part 127.
4018. gbvrl128.seq - Viral sequence entries, part 128.
4019. gbvrl129.seq - Viral sequence entries, part 129.
4020. gbvrl13.seq - Viral sequence entries, part 13.
4021. gbvrl130.seq - Viral sequence entries, part 130.
4022. gbvrl131.seq - Viral sequence entries, part 131.
4023. gbvrl132.seq - Viral sequence entries, part 132.
4024. gbvrl133.seq - Viral sequence entries, part 133.
4025. gbvrl134.seq - Viral sequence entries, part 134.
4026. gbvrl135.seq - Viral sequence entries, part 135.
4027. gbvrl136.seq - Viral sequence entries, part 136.
4028. gbvrl137.seq - Viral sequence entries, part 137.
4029. gbvrl138.seq - Viral sequence entries, part 138.
4030. gbvrl139.seq - Viral sequence entries, part 139.
4031. gbvrl14.seq - Viral sequence entries, part 14.
4032. gbvrl140.seq - Viral sequence entries, part 140.
4033. gbvrl141.seq - Viral sequence entries, part 141.
4034. gbvrl142.seq - Viral sequence entries, part 142.
4035. gbvrl143.seq - Viral sequence entries, part 143.
4036. gbvrl144.seq - Viral sequence entries, part 144.
4037. gbvrl145.seq - Viral sequence entries, part 145.
4038. gbvrl146.seq - Viral sequence entries, part 146.
4039. gbvrl147.seq - Viral sequence entries, part 147.
4040. gbvrl148.seq - Viral sequence entries, part 148.
4041. gbvrl149.seq - Viral sequence entries, part 149.
4042. gbvrl15.seq - Viral sequence entries, part 15.
4043. gbvrl150.seq - Viral sequence entries, part 150.
4044. gbvrl151.seq - Viral sequence entries, part 151.
4045. gbvrl152.seq - Viral sequence entries, part 152.
4046. gbvrl153.seq - Viral sequence entries, part 153.
4047. gbvrl154.seq - Viral sequence entries, part 154.
4048. gbvrl155.seq - Viral sequence entries, part 155.
4049. gbvrl156.seq - Viral sequence entries, part 156.
4050. gbvrl157.seq - Viral sequence entries, part 157.
4051. gbvrl158.seq - Viral sequence entries, part 158.
4052. gbvrl159.seq - Viral sequence entries, part 159.
4053. gbvrl16.seq - Viral sequence entries, part 16.
4054. gbvrl160.seq - Viral sequence entries, part 160.
4055. gbvrl161.seq - Viral sequence entries, part 161.
4056. gbvrl162.seq - Viral sequence entries, part 162.
4057. gbvrl163.seq - Viral sequence entries, part 163.
4058. gbvrl164.seq - Viral sequence entries, part 164.
4059. gbvrl165.seq - Viral sequence entries, part 165.
4060. gbvrl166.seq - Viral sequence entries, part 166.
4061. gbvrl167.seq - Viral sequence entries, part 167.
4062. gbvrl168.seq - Viral sequence entries, part 168.
4063. gbvrl169.seq - Viral sequence entries, part 169.
4064. gbvrl17.seq - Viral sequence entries, part 17.
4065. gbvrl170.seq - Viral sequence entries, part 170.
4066. gbvrl171.seq - Viral sequence entries, part 171.
4067. gbvrl172.seq - Viral sequence entries, part 172.
4068. gbvrl173.seq - Viral sequence entries, part 173.
4069. gbvrl174.seq - Viral sequence entries, part 174.
4070. gbvrl175.seq - Viral sequence entries, part 175.
4071. gbvrl176.seq - Viral sequence entries, part 176.
4072. gbvrl177.seq - Viral sequence entries, part 177.
4073. gbvrl178.seq - Viral sequence entries, part 178.
4074. gbvrl179.seq - Viral sequence entries, part 179.
4075. gbvrl18.seq - Viral sequence entries, part 18.
4076. gbvrl180.seq - Viral sequence entries, part 180.
4077. gbvrl181.seq - Viral sequence entries, part 181.
4078. gbvrl182.seq - Viral sequence entries, part 182.
4079. gbvrl183.seq - Viral sequence entries, part 183.
4080. gbvrl184.seq - Viral sequence entries, part 184.
4081. gbvrl185.seq - Viral sequence entries, part 185.
4082. gbvrl186.seq - Viral sequence entries, part 186.
4083. gbvrl187.seq - Viral sequence entries, part 187.
4084. gbvrl188.seq - Viral sequence entries, part 188.
4085. gbvrl189.seq - Viral sequence entries, part 189.
4086. gbvrl19.seq - Viral sequence entries, part 19.
4087. gbvrl190.seq - Viral sequence entries, part 190.
4088. gbvrl191.seq - Viral sequence entries, part 191.
4089. gbvrl192.seq - Viral sequence entries, part 192.
4090. gbvrl193.seq - Viral sequence entries, part 193.
4091. gbvrl194.seq - Viral sequence entries, part 194.
4092. gbvrl195.seq - Viral sequence entries, part 195.
4093. gbvrl196.seq - Viral sequence entries, part 196.
4094. gbvrl197.seq - Viral sequence entries, part 197.
4095. gbvrl198.seq - Viral sequence entries, part 198.
4096. gbvrl199.seq - Viral sequence entries, part 199.
4097. gbvrl2.seq - Viral sequence entries, part 2.
4098. gbvrl20.seq - Viral sequence entries, part 20.
4099. gbvrl200.seq - Viral sequence entries, part 200.
4100. gbvrl201.seq - Viral sequence entries, part 201.
4101. gbvrl202.seq - Viral sequence entries, part 202.
4102. gbvrl203.seq - Viral sequence entries, part 203.
4103. gbvrl204.seq - Viral sequence entries, part 204.
4104. gbvrl205.seq - Viral sequence entries, part 205.
4105. gbvrl206.seq - Viral sequence entries, part 206.
4106. gbvrl207.seq - Viral sequence entries, part 207.
4107. gbvrl208.seq - Viral sequence entries, part 208.
4108. gbvrl209.seq - Viral sequence entries, part 209.
4109. gbvrl21.seq - Viral sequence entries, part 21.
4110. gbvrl210.seq - Viral sequence entries, part 210.
4111. gbvrl211.seq - Viral sequence entries, part 211.
4112. gbvrl212.seq - Viral sequence entries, part 212.
4113. gbvrl213.seq - Viral sequence entries, part 213.
4114. gbvrl214.seq - Viral sequence entries, part 214.
4115. gbvrl215.seq - Viral sequence entries, part 215.
4116. gbvrl216.seq - Viral sequence entries, part 216.
4117. gbvrl217.seq - Viral sequence entries, part 217.
4118. gbvrl218.seq - Viral sequence entries, part 218.
4119. gbvrl219.seq - Viral sequence entries, part 219.
4120. gbvrl22.seq - Viral sequence entries, part 22.
4121. gbvrl220.seq - Viral sequence entries, part 220.
4122. gbvrl221.seq - Viral sequence entries, part 221.
4123. gbvrl222.seq - Viral sequence entries, part 222.
4124. gbvrl223.seq - Viral sequence entries, part 223.
4125. gbvrl224.seq - Viral sequence entries, part 224.
4126. gbvrl225.seq - Viral sequence entries, part 225.
4127. gbvrl226.seq - Viral sequence entries, part 226.
4128. gbvrl227.seq - Viral sequence entries, part 227.
4129. gbvrl228.seq - Viral sequence entries, part 228.
4130. gbvrl229.seq - Viral sequence entries, part 229.
4131. gbvrl23.seq - Viral sequence entries, part 23.
4132. gbvrl230.seq - Viral sequence entries, part 230.
4133. gbvrl231.seq - Viral sequence entries, part 231.
4134. gbvrl232.seq - Viral sequence entries, part 232.
4135. gbvrl233.seq - Viral sequence entries, part 233.
4136. gbvrl234.seq - Viral sequence entries, part 234.
4137. gbvrl235.seq - Viral sequence entries, part 235.
4138. gbvrl236.seq - Viral sequence entries, part 236.
4139. gbvrl237.seq - Viral sequence entries, part 237.
4140. gbvrl238.seq - Viral sequence entries, part 238.
4141. gbvrl239.seq - Viral sequence entries, part 239.
4142. gbvrl24.seq - Viral sequence entries, part 24.
4143. gbvrl240.seq - Viral sequence entries, part 240.
4144. gbvrl241.seq - Viral sequence entries, part 241.
4145. gbvrl242.seq - Viral sequence entries, part 242.
4146. gbvrl243.seq - Viral sequence entries, part 243.
4147. gbvrl244.seq - Viral sequence entries, part 244.
4148. gbvrl245.seq - Viral sequence entries, part 245.
4149. gbvrl246.seq - Viral sequence entries, part 246.
4150. gbvrl247.seq - Viral sequence entries, part 247.
4151. gbvrl248.seq - Viral sequence entries, part 248.
4152. gbvrl249.seq - Viral sequence entries, part 249.
4153. gbvrl25.seq - Viral sequence entries, part 25.
4154. gbvrl250.seq - Viral sequence entries, part 250.
4155. gbvrl251.seq - Viral sequence entries, part 251.
4156. gbvrl252.seq - Viral sequence entries, part 252.
4157. gbvrl253.seq - Viral sequence entries, part 253.
4158. gbvrl254.seq - Viral sequence entries, part 254.
4159. gbvrl255.seq - Viral sequence entries, part 255.
4160. gbvrl256.seq - Viral sequence entries, part 256.
4161. gbvrl257.seq - Viral sequence entries, part 257.
4162. gbvrl258.seq - Viral sequence entries, part 258.
4163. gbvrl259.seq - Viral sequence entries, part 259.
4164. gbvrl26.seq - Viral sequence entries, part 26.
4165. gbvrl260.seq - Viral sequence entries, part 260.
4166. gbvrl261.seq - Viral sequence entries, part 261.
4167. gbvrl262.seq - Viral sequence entries, part 262.
4168. gbvrl263.seq - Viral sequence entries, part 263.
4169. gbvrl264.seq - Viral sequence entries, part 264.
4170. gbvrl265.seq - Viral sequence entries, part 265.
4171. gbvrl266.seq - Viral sequence entries, part 266.
4172. gbvrl267.seq - Viral sequence entries, part 267.
4173. gbvrl268.seq - Viral sequence entries, part 268.
4174. gbvrl269.seq - Viral sequence entries, part 269.
4175. gbvrl27.seq - Viral sequence entries, part 27.
4176. gbvrl270.seq - Viral sequence entries, part 270.
4177. gbvrl271.seq - Viral sequence entries, part 271.
4178. gbvrl272.seq - Viral sequence entries, part 272.
4179. gbvrl273.seq - Viral sequence entries, part 273.
4180. gbvrl274.seq - Viral sequence entries, part 274.
4181. gbvrl275.seq - Viral sequence entries, part 275.
4182. gbvrl276.seq - Viral sequence entries, part 276.
4183. gbvrl277.seq - Viral sequence entries, part 277.
4184. gbvrl278.seq - Viral sequence entries, part 278.
4185. gbvrl279.seq - Viral sequence entries, part 279.
4186. gbvrl28.seq - Viral sequence entries, part 28.
4187. gbvrl280.seq - Viral sequence entries, part 280.
4188. gbvrl281.seq - Viral sequence entries, part 281.
4189. gbvrl282.seq - Viral sequence entries, part 282.
4190. gbvrl283.seq - Viral sequence entries, part 283.
4191. gbvrl284.seq - Viral sequence entries, part 284.
4192. gbvrl285.seq - Viral sequence entries, part 285.
4193. gbvrl286.seq - Viral sequence entries, part 286.
4194. gbvrl287.seq - Viral sequence entries, part 287.
4195. gbvrl288.seq - Viral sequence entries, part 288.
4196. gbvrl289.seq - Viral sequence entries, part 289.
4197. gbvrl29.seq - Viral sequence entries, part 29.
4198. gbvrl290.seq - Viral sequence entries, part 290.
4199. gbvrl291.seq - Viral sequence entries, part 291.
4200. gbvrl292.seq - Viral sequence entries, part 292.
4201. gbvrl293.seq - Viral sequence entries, part 293.
4202. gbvrl294.seq - Viral sequence entries, part 294.
4203. gbvrl295.seq - Viral sequence entries, part 295.
4204. gbvrl296.seq - Viral sequence entries, part 296.
4205. gbvrl297.seq - Viral sequence entries, part 297.
4206. gbvrl298.seq - Viral sequence entries, part 298.
4207. gbvrl299.seq - Viral sequence entries, part 299.
4208. gbvrl3.seq - Viral sequence entries, part 3.
4209. gbvrl30.seq - Viral sequence entries, part 30.
4210. gbvrl300.seq - Viral sequence entries, part 300.
4211. gbvrl301.seq - Viral sequence entries, part 301.
4212. gbvrl302.seq - Viral sequence entries, part 302.
4213. gbvrl303.seq - Viral sequence entries, part 303.
4214. gbvrl304.seq - Viral sequence entries, part 304.
4215. gbvrl305.seq - Viral sequence entries, part 305.
4216. gbvrl306.seq - Viral sequence entries, part 306.
4217. gbvrl307.seq - Viral sequence entries, part 307.
4218. gbvrl308.seq - Viral sequence entries, part 308.
4219. gbvrl309.seq - Viral sequence entries, part 309.
4220. gbvrl31.seq - Viral sequence entries, part 31.
4221. gbvrl310.seq - Viral sequence entries, part 310.
4222. gbvrl311.seq - Viral sequence entries, part 311.
4223. gbvrl312.seq - Viral sequence entries, part 312.
4224. gbvrl313.seq - Viral sequence entries, part 313.
4225. gbvrl314.seq - Viral sequence entries, part 314.
4226. gbvrl315.seq - Viral sequence entries, part 315.
4227. gbvrl316.seq - Viral sequence entries, part 316.
4228. gbvrl317.seq - Viral sequence entries, part 317.
4229. gbvrl318.seq - Viral sequence entries, part 318.
4230. gbvrl319.seq - Viral sequence entries, part 319.
4231. gbvrl32.seq - Viral sequence entries, part 32.
4232. gbvrl320.seq - Viral sequence entries, part 320.
4233. gbvrl321.seq - Viral sequence entries, part 321.
4234. gbvrl322.seq - Viral sequence entries, part 322.
4235. gbvrl323.seq - Viral sequence entries, part 323.
4236. gbvrl324.seq - Viral sequence entries, part 324.
4237. gbvrl325.seq - Viral sequence entries, part 325.
4238. gbvrl326.seq - Viral sequence entries, part 326.
4239. gbvrl327.seq - Viral sequence entries, part 327.
4240. gbvrl328.seq - Viral sequence entries, part 328.
4241. gbvrl329.seq - Viral sequence entries, part 329.
4242. gbvrl33.seq - Viral sequence entries, part 33.
4243. gbvrl330.seq - Viral sequence entries, part 330.
4244. gbvrl331.seq - Viral sequence entries, part 331.
4245. gbvrl332.seq - Viral sequence entries, part 332.
4246. gbvrl333.seq - Viral sequence entries, part 333.
4247. gbvrl334.seq - Viral sequence entries, part 334.
4248. gbvrl335.seq - Viral sequence entries, part 335.
4249. gbvrl336.seq - Viral sequence entries, part 336.
4250. gbvrl337.seq - Viral sequence entries, part 337.
4251. gbvrl338.seq - Viral sequence entries, part 338.
4252. gbvrl339.seq - Viral sequence entries, part 339.
4253. gbvrl34.seq - Viral sequence entries, part 34.
4254. gbvrl340.seq - Viral sequence entries, part 340.
4255. gbvrl341.seq - Viral sequence entries, part 341.
4256. gbvrl342.seq - Viral sequence entries, part 342.
4257. gbvrl343.seq - Viral sequence entries, part 343.
4258. gbvrl344.seq - Viral sequence entries, part 344.
4259. gbvrl345.seq - Viral sequence entries, part 345.
4260. gbvrl346.seq - Viral sequence entries, part 346.
4261. gbvrl347.seq - Viral sequence entries, part 347.
4262. gbvrl348.seq - Viral sequence entries, part 348.
4263. gbvrl349.seq - Viral sequence entries, part 349.
4264. gbvrl35.seq - Viral sequence entries, part 35.
4265. gbvrl350.seq - Viral sequence entries, part 350.
4266. gbvrl351.seq - Viral sequence entries, part 351.
4267. gbvrl352.seq - Viral sequence entries, part 352.
4268. gbvrl353.seq - Viral sequence entries, part 353.
4269. gbvrl354.seq - Viral sequence entries, part 354.
4270. gbvrl355.seq - Viral sequence entries, part 355.
4271. gbvrl356.seq - Viral sequence entries, part 356.
4272. gbvrl357.seq - Viral sequence entries, part 357.
4273. gbvrl358.seq - Viral sequence entries, part 358.
4274. gbvrl359.seq - Viral sequence entries, part 359.
4275. gbvrl36.seq - Viral sequence entries, part 36.
4276. gbvrl360.seq - Viral sequence entries, part 360.
4277. gbvrl361.seq - Viral sequence entries, part 361.
4278. gbvrl362.seq - Viral sequence entries, part 362.
4279. gbvrl363.seq - Viral sequence entries, part 363.
4280. gbvrl364.seq - Viral sequence entries, part 364.
4281. gbvrl365.seq - Viral sequence entries, part 365.
4282. gbvrl366.seq - Viral sequence entries, part 366.
4283. gbvrl367.seq - Viral sequence entries, part 367.
4284. gbvrl368.seq - Viral sequence entries, part 368.
4285. gbvrl369.seq - Viral sequence entries, part 369.
4286. gbvrl37.seq - Viral sequence entries, part 37.
4287. gbvrl370.seq - Viral sequence entries, part 370.
4288. gbvrl371.seq - Viral sequence entries, part 371.
4289. gbvrl372.seq - Viral sequence entries, part 372.
4290. gbvrl373.seq - Viral sequence entries, part 373.
4291. gbvrl374.seq - Viral sequence entries, part 374.
4292. gbvrl375.seq - Viral sequence entries, part 375.
4293. gbvrl376.seq - Viral sequence entries, part 376.
4294. gbvrl377.seq - Viral sequence entries, part 377.
4295. gbvrl378.seq - Viral sequence entries, part 378.
4296. gbvrl379.seq - Viral sequence entries, part 379.
4297. gbvrl38.seq - Viral sequence entries, part 38.
4298. gbvrl380.seq - Viral sequence entries, part 380.
4299. gbvrl381.seq - Viral sequence entries, part 381.
4300. gbvrl382.seq - Viral sequence entries, part 382.
4301. gbvrl383.seq - Viral sequence entries, part 383.
4302. gbvrl384.seq - Viral sequence entries, part 384.
4303. gbvrl385.seq - Viral sequence entries, part 385.
4304. gbvrl386.seq - Viral sequence entries, part 386.
4305. gbvrl387.seq - Viral sequence entries, part 387.
4306. gbvrl388.seq - Viral sequence entries, part 388.
4307. gbvrl389.seq - Viral sequence entries, part 389.
4308. gbvrl39.seq - Viral sequence entries, part 39.
4309. gbvrl390.seq - Viral sequence entries, part 390.
4310. gbvrl391.seq - Viral sequence entries, part 391.
4311. gbvrl392.seq - Viral sequence entries, part 392.
4312. gbvrl393.seq - Viral sequence entries, part 393.
4313. gbvrl394.seq - Viral sequence entries, part 394.
4314. gbvrl395.seq - Viral sequence entries, part 395.
4315. gbvrl396.seq - Viral sequence entries, part 396.
4316. gbvrl397.seq - Viral sequence entries, part 397.
4317. gbvrl398.seq - Viral sequence entries, part 398.
4318. gbvrl399.seq - Viral sequence entries, part 399.
4319. gbvrl4.seq - Viral sequence entries, part 4.
4320. gbvrl40.seq - Viral sequence entries, part 40.
4321. gbvrl400.seq - Viral sequence entries, part 400.
4322. gbvrl401.seq - Viral sequence entries, part 401.
4323. gbvrl402.seq - Viral sequence entries, part 402.
4324. gbvrl403.seq - Viral sequence entries, part 403.
4325. gbvrl404.seq - Viral sequence entries, part 404.
4326. gbvrl405.seq - Viral sequence entries, part 405.
4327. gbvrl406.seq - Viral sequence entries, part 406.
4328. gbvrl407.seq - Viral sequence entries, part 407.
4329. gbvrl408.seq - Viral sequence entries, part 408.
4330. gbvrl409.seq - Viral sequence entries, part 409.
4331. gbvrl41.seq - Viral sequence entries, part 41.
4332. gbvrl410.seq - Viral sequence entries, part 410.
4333. gbvrl411.seq - Viral sequence entries, part 411.
4334. gbvrl412.seq - Viral sequence entries, part 412.
4335. gbvrl413.seq - Viral sequence entries, part 413.
4336. gbvrl414.seq - Viral sequence entries, part 414.
4337. gbvrl415.seq - Viral sequence entries, part 415.
4338. gbvrl416.seq - Viral sequence entries, part 416.
4339. gbvrl417.seq - Viral sequence entries, part 417.
4340. gbvrl418.seq - Viral sequence entries, part 418.
4341. gbvrl419.seq - Viral sequence entries, part 419.
4342. gbvrl42.seq - Viral sequence entries, part 42.
4343. gbvrl420.seq - Viral sequence entries, part 420.
4344. gbvrl421.seq - Viral sequence entries, part 421.
4345. gbvrl422.seq - Viral sequence entries, part 422.
4346. gbvrl423.seq - Viral sequence entries, part 423.
4347. gbvrl424.seq - Viral sequence entries, part 424.
4348. gbvrl425.seq - Viral sequence entries, part 425.
4349. gbvrl426.seq - Viral sequence entries, part 426.
4350. gbvrl427.seq - Viral sequence entries, part 427.
4351. gbvrl428.seq - Viral sequence entries, part 428.
4352. gbvrl429.seq - Viral sequence entries, part 429.
4353. gbvrl43.seq - Viral sequence entries, part 43.
4354. gbvrl430.seq - Viral sequence entries, part 430.
4355. gbvrl431.seq - Viral sequence entries, part 431.
4356. gbvrl432.seq - Viral sequence entries, part 432.
4357. gbvrl433.seq - Viral sequence entries, part 433.
4358. gbvrl434.seq - Viral sequence entries, part 434.
4359. gbvrl435.seq - Viral sequence entries, part 435.
4360. gbvrl436.seq - Viral sequence entries, part 436.
4361. gbvrl437.seq - Viral sequence entries, part 437.
4362. gbvrl438.seq - Viral sequence entries, part 438.
4363. gbvrl439.seq - Viral sequence entries, part 439.
4364. gbvrl44.seq - Viral sequence entries, part 44.
4365. gbvrl440.seq - Viral sequence entries, part 440.
4366. gbvrl441.seq - Viral sequence entries, part 441.
4367. gbvrl442.seq - Viral sequence entries, part 442.
4368. gbvrl443.seq - Viral sequence entries, part 443.
4369. gbvrl444.seq - Viral sequence entries, part 444.
4370. gbvrl445.seq - Viral sequence entries, part 445.
4371. gbvrl446.seq - Viral sequence entries, part 446.
4372. gbvrl447.seq - Viral sequence entries, part 447.
4373. gbvrl448.seq - Viral sequence entries, part 448.
4374. gbvrl449.seq - Viral sequence entries, part 449.
4375. gbvrl45.seq - Viral sequence entries, part 45.
4376. gbvrl450.seq - Viral sequence entries, part 450.
4377. gbvrl451.seq - Viral sequence entries, part 451.
4378. gbvrl452.seq - Viral sequence entries, part 452.
4379. gbvrl453.seq - Viral sequence entries, part 453.
4380. gbvrl454.seq - Viral sequence entries, part 454.
4381. gbvrl455.seq - Viral sequence entries, part 455.
4382. gbvrl456.seq - Viral sequence entries, part 456.
4383. gbvrl457.seq - Viral sequence entries, part 457.
4384. gbvrl458.seq - Viral sequence entries, part 458.
4385. gbvrl459.seq - Viral sequence entries, part 459.
4386. gbvrl46.seq - Viral sequence entries, part 46.
4387. gbvrl460.seq - Viral sequence entries, part 460.
4388. gbvrl461.seq - Viral sequence entries, part 461.
4389. gbvrl462.seq - Viral sequence entries, part 462.
4390. gbvrl463.seq - Viral sequence entries, part 463.
4391. gbvrl464.seq - Viral sequence entries, part 464.
4392. gbvrl465.seq - Viral sequence entries, part 465.
4393. gbvrl466.seq - Viral sequence entries, part 466.
4394. gbvrl467.seq - Viral sequence entries, part 467.
4395. gbvrl468.seq - Viral sequence entries, part 468.
4396. gbvrl469.seq - Viral sequence entries, part 469.
4397. gbvrl47.seq - Viral sequence entries, part 47.
4398. gbvrl470.seq - Viral sequence entries, part 470.
4399. gbvrl471.seq - Viral sequence entries, part 471.
4400. gbvrl472.seq - Viral sequence entries, part 472.
4401. gbvrl473.seq - Viral sequence entries, part 473.
4402. gbvrl474.seq - Viral sequence entries, part 474.
4403. gbvrl475.seq - Viral sequence entries, part 475.
4404. gbvrl476.seq - Viral sequence entries, part 476.
4405. gbvrl477.seq - Viral sequence entries, part 477.
4406. gbvrl478.seq - Viral sequence entries, part 478.
4407. gbvrl479.seq - Viral sequence entries, part 479.
4408. gbvrl48.seq - Viral sequence entries, part 48.
4409. gbvrl480.seq - Viral sequence entries, part 480.
4410. gbvrl481.seq - Viral sequence entries, part 481.
4411. gbvrl482.seq - Viral sequence entries, part 482.
4412. gbvrl483.seq - Viral sequence entries, part 483.
4413. gbvrl484.seq - Viral sequence entries, part 484.
4414. gbvrl485.seq - Viral sequence entries, part 485.
4415. gbvrl486.seq - Viral sequence entries, part 486.
4416. gbvrl487.seq - Viral sequence entries, part 487.
4417. gbvrl488.seq - Viral sequence entries, part 488.
4418. gbvrl489.seq - Viral sequence entries, part 489.
4419. gbvrl49.seq - Viral sequence entries, part 49.
4420. gbvrl490.seq - Viral sequence entries, part 490.
4421. gbvrl491.seq - Viral sequence entries, part 491.
4422. gbvrl492.seq - Viral sequence entries, part 492.
4423. gbvrl493.seq - Viral sequence entries, part 493.
4424. gbvrl494.seq - Viral sequence entries, part 494.
4425. gbvrl495.seq - Viral sequence entries, part 495.
4426. gbvrl496.seq - Viral sequence entries, part 496.
4427. gbvrl497.seq - Viral sequence entries, part 497.
4428. gbvrl498.seq - Viral sequence entries, part 498.
4429. gbvrl499.seq - Viral sequence entries, part 499.
4430. gbvrl5.seq - Viral sequence entries, part 5.
4431. gbvrl50.seq - Viral sequence entries, part 50.
4432. gbvrl500.seq - Viral sequence entries, part 500.
4433. gbvrl501.seq - Viral sequence entries, part 501.
4434. gbvrl502.seq - Viral sequence entries, part 502.
4435. gbvrl503.seq - Viral sequence entries, part 503.
4436. gbvrl504.seq - Viral sequence entries, part 504.
4437. gbvrl505.seq - Viral sequence entries, part 505.
4438. gbvrl506.seq - Viral sequence entries, part 506.
4439. gbvrl507.seq - Viral sequence entries, part 507.
4440. gbvrl508.seq - Viral sequence entries, part 508.
4441. gbvrl509.seq - Viral sequence entries, part 509.
4442. gbvrl51.seq - Viral sequence entries, part 51.
4443. gbvrl510.seq - Viral sequence entries, part 510.
4444. gbvrl511.seq - Viral sequence entries, part 511.
4445. gbvrl512.seq - Viral sequence entries, part 512.
4446. gbvrl513.seq - Viral sequence entries, part 513.
4447. gbvrl514.seq - Viral sequence entries, part 514.
4448. gbvrl515.seq - Viral sequence entries, part 515.
4449. gbvrl516.seq - Viral sequence entries, part 516.
4450. gbvrl517.seq - Viral sequence entries, part 517.
4451. gbvrl518.seq - Viral sequence entries, part 518.
4452. gbvrl519.seq - Viral sequence entries, part 519.
4453. gbvrl52.seq - Viral sequence entries, part 52.
4454. gbvrl520.seq - Viral sequence entries, part 520.
4455. gbvrl521.seq - Viral sequence entries, part 521.
4456. gbvrl522.seq - Viral sequence entries, part 522.
4457. gbvrl523.seq - Viral sequence entries, part 523.
4458. gbvrl524.seq - Viral sequence entries, part 524.
4459. gbvrl525.seq - Viral sequence entries, part 525.
4460. gbvrl53.seq - Viral sequence entries, part 53.
4461. gbvrl54.seq - Viral sequence entries, part 54.
4462. gbvrl55.seq - Viral sequence entries, part 55.
4463. gbvrl56.seq - Viral sequence entries, part 56.
4464. gbvrl57.seq - Viral sequence entries, part 57.
4465. gbvrl58.seq - Viral sequence entries, part 58.
4466. gbvrl59.seq - Viral sequence entries, part 59.
4467. gbvrl6.seq - Viral sequence entries, part 6.
4468. gbvrl60.seq - Viral sequence entries, part 60.
4469. gbvrl61.seq - Viral sequence entries, part 61.
4470. gbvrl62.seq - Viral sequence entries, part 62.
4471. gbvrl63.seq - Viral sequence entries, part 63.
4472. gbvrl64.seq - Viral sequence entries, part 64.
4473. gbvrl65.seq - Viral sequence entries, part 65.
4474. gbvrl66.seq - Viral sequence entries, part 66.
4475. gbvrl67.seq - Viral sequence entries, part 67.
4476. gbvrl68.seq - Viral sequence entries, part 68.
4477. gbvrl69.seq - Viral sequence entries, part 69.
4478. gbvrl7.seq - Viral sequence entries, part 7.
4479. gbvrl70.seq - Viral sequence entries, part 70.
4480. gbvrl71.seq - Viral sequence entries, part 71.
4481. gbvrl72.seq - Viral sequence entries, part 72.
4482. gbvrl73.seq - Viral sequence entries, part 73.
4483. gbvrl74.seq - Viral sequence entries, part 74.
4484. gbvrl75.seq - Viral sequence entries, part 75.
4485. gbvrl76.seq - Viral sequence entries, part 76.
4486. gbvrl77.seq - Viral sequence entries, part 77.
4487. gbvrl78.seq - Viral sequence entries, part 78.
4488. gbvrl79.seq - Viral sequence entries, part 79.
4489. gbvrl8.seq - Viral sequence entries, part 8.
4490. gbvrl80.seq - Viral sequence entries, part 80.
4491. gbvrl81.seq - Viral sequence entries, part 81.
4492. gbvrl82.seq - Viral sequence entries, part 82.
4493. gbvrl83.seq - Viral sequence entries, part 83.
4494. gbvrl84.seq - Viral sequence entries, part 84.
4495. gbvrl85.seq - Viral sequence entries, part 85.
4496. gbvrl86.seq - Viral sequence entries, part 86.
4497. gbvrl87.seq - Viral sequence entries, part 87.
4498. gbvrl88.seq - Viral sequence entries, part 88.
4499. gbvrl89.seq - Viral sequence entries, part 89.
4500. gbvrl9.seq - Viral sequence entries, part 9.
4501. gbvrl90.seq - Viral sequence entries, part 90.
4502. gbvrl91.seq - Viral sequence entries, part 91.
4503. gbvrl92.seq - Viral sequence entries, part 92.
4504. gbvrl93.seq - Viral sequence entries, part 93.
4505. gbvrl94.seq - Viral sequence entries, part 94.
4506. gbvrl95.seq - Viral sequence entries, part 95.
4507. gbvrl96.seq - Viral sequence entries, part 96.
4508. gbvrl97.seq - Viral sequence entries, part 97.
4509. gbvrl98.seq - Viral sequence entries, part 98.
4510. gbvrl99.seq - Viral sequence entries, part 99.
4511. gbvrt1.seq - Other vertebrate sequence entries, part 1.
4512. gbvrt10.seq - Other vertebrate sequence entries, part 10.
4513. gbvrt100.seq - Other vertebrate sequence entries, part 100.
4514. gbvrt101.seq - Other vertebrate sequence entries, part 101.
4515. gbvrt102.seq - Other vertebrate sequence entries, part 102.
4516. gbvrt103.seq - Other vertebrate sequence entries, part 103.
4517. gbvrt104.seq - Other vertebrate sequence entries, part 104.
4518. gbvrt105.seq - Other vertebrate sequence entries, part 105.
4519. gbvrt106.seq - Other vertebrate sequence entries, part 106.
4520. gbvrt107.seq - Other vertebrate sequence entries, part 107.
4521. gbvrt108.seq - Other vertebrate sequence entries, part 108.
4522. gbvrt109.seq - Other vertebrate sequence entries, part 109.
4523. gbvrt11.seq - Other vertebrate sequence entries, part 11.
4524. gbvrt110.seq - Other vertebrate sequence entries, part 110.
4525. gbvrt111.seq - Other vertebrate sequence entries, part 111.
4526. gbvrt112.seq - Other vertebrate sequence entries, part 112.
4527. gbvrt113.seq - Other vertebrate sequence entries, part 113.
4528. gbvrt114.seq - Other vertebrate sequence entries, part 114.
4529. gbvrt115.seq - Other vertebrate sequence entries, part 115.
4530. gbvrt116.seq - Other vertebrate sequence entries, part 116.
4531. gbvrt117.seq - Other vertebrate sequence entries, part 117.
4532. gbvrt118.seq - Other vertebrate sequence entries, part 118.
4533. gbvrt119.seq - Other vertebrate sequence entries, part 119.
4534. gbvrt12.seq - Other vertebrate sequence entries, part 12.
4535. gbvrt120.seq - Other vertebrate sequence entries, part 120.
4536. gbvrt121.seq - Other vertebrate sequence entries, part 121.
4537. gbvrt122.seq - Other vertebrate sequence entries, part 122.
4538. gbvrt123.seq - Other vertebrate sequence entries, part 123.
4539. gbvrt124.seq - Other vertebrate sequence entries, part 124.
4540. gbvrt125.seq - Other vertebrate sequence entries, part 125.
4541. gbvrt126.seq - Other vertebrate sequence entries, part 126.
4542. gbvrt127.seq - Other vertebrate sequence entries, part 127.
4543. gbvrt128.seq - Other vertebrate sequence entries, part 128.
4544. gbvrt129.seq - Other vertebrate sequence entries, part 129.
4545. gbvrt13.seq - Other vertebrate sequence entries, part 13.
4546. gbvrt130.seq - Other vertebrate sequence entries, part 130.
4547. gbvrt131.seq - Other vertebrate sequence entries, part 131.
4548. gbvrt132.seq - Other vertebrate sequence entries, part 132.
4549. gbvrt133.seq - Other vertebrate sequence entries, part 133.
4550. gbvrt134.seq - Other vertebrate sequence entries, part 134.
4551. gbvrt135.seq - Other vertebrate sequence entries, part 135.
4552. gbvrt136.seq - Other vertebrate sequence entries, part 136.
4553. gbvrt137.seq - Other vertebrate sequence entries, part 137.
4554. gbvrt138.seq - Other vertebrate sequence entries, part 138.
4555. gbvrt139.seq - Other vertebrate sequence entries, part 139.
4556. gbvrt14.seq - Other vertebrate sequence entries, part 14.
4557. gbvrt140.seq - Other vertebrate sequence entries, part 140.
4558. gbvrt141.seq - Other vertebrate sequence entries, part 141.
4559. gbvrt142.seq - Other vertebrate sequence entries, part 142.
4560. gbvrt143.seq - Other vertebrate sequence entries, part 143.
4561. gbvrt144.seq - Other vertebrate sequence entries, part 144.
4562. gbvrt145.seq - Other vertebrate sequence entries, part 145.
4563. gbvrt146.seq - Other vertebrate sequence entries, part 146.
4564. gbvrt147.seq - Other vertebrate sequence entries, part 147.
4565. gbvrt148.seq - Other vertebrate sequence entries, part 148.
4566. gbvrt149.seq - Other vertebrate sequence entries, part 149.
4567. gbvrt15.seq - Other vertebrate sequence entries, part 15.
4568. gbvrt150.seq - Other vertebrate sequence entries, part 150.
4569. gbvrt151.seq - Other vertebrate sequence entries, part 151.
4570. gbvrt152.seq - Other vertebrate sequence entries, part 152.
4571. gbvrt153.seq - Other vertebrate sequence entries, part 153.
4572. gbvrt154.seq - Other vertebrate sequence entries, part 154.
4573. gbvrt155.seq - Other vertebrate sequence entries, part 155.
4574. gbvrt156.seq - Other vertebrate sequence entries, part 156.
4575. gbvrt157.seq - Other vertebrate sequence entries, part 157.
4576. gbvrt158.seq - Other vertebrate sequence entries, part 158.
4577. gbvrt159.seq - Other vertebrate sequence entries, part 159.
4578. gbvrt16.seq - Other vertebrate sequence entries, part 16.
4579. gbvrt160.seq - Other vertebrate sequence entries, part 160.
4580. gbvrt161.seq - Other vertebrate sequence entries, part 161.
4581. gbvrt162.seq - Other vertebrate sequence entries, part 162.
4582. gbvrt163.seq - Other vertebrate sequence entries, part 163.
4583. gbvrt164.seq - Other vertebrate sequence entries, part 164.
4584. gbvrt165.seq - Other vertebrate sequence entries, part 165.
4585. gbvrt166.seq - Other vertebrate sequence entries, part 166.
4586. gbvrt167.seq - Other vertebrate sequence entries, part 167.
4587. gbvrt168.seq - Other vertebrate sequence entries, part 168.
4588. gbvrt169.seq - Other vertebrate sequence entries, part 169.
4589. gbvrt17.seq - Other vertebrate sequence entries, part 17.
4590. gbvrt170.seq - Other vertebrate sequence entries, part 170.
4591. gbvrt171.seq - Other vertebrate sequence entries, part 171.
4592. gbvrt172.seq - Other vertebrate sequence entries, part 172.
4593. gbvrt173.seq - Other vertebrate sequence entries, part 173.
4594. gbvrt174.seq - Other vertebrate sequence entries, part 174.
4595. gbvrt175.seq - Other vertebrate sequence entries, part 175.
4596. gbvrt176.seq - Other vertebrate sequence entries, part 176.
4597. gbvrt177.seq - Other vertebrate sequence entries, part 177.
4598. gbvrt178.seq - Other vertebrate sequence entries, part 178.
4599. gbvrt179.seq - Other vertebrate sequence entries, part 179.
4600. gbvrt18.seq - Other vertebrate sequence entries, part 18.
4601. gbvrt180.seq - Other vertebrate sequence entries, part 180.
4602. gbvrt181.seq - Other vertebrate sequence entries, part 181.
4603. gbvrt182.seq - Other vertebrate sequence entries, part 182.
4604. gbvrt183.seq - Other vertebrate sequence entries, part 183.
4605. gbvrt184.seq - Other vertebrate sequence entries, part 184.
4606. gbvrt185.seq - Other vertebrate sequence entries, part 185.
4607. gbvrt186.seq - Other vertebrate sequence entries, part 186.
4608. gbvrt187.seq - Other vertebrate sequence entries, part 187.
4609. gbvrt188.seq - Other vertebrate sequence entries, part 188.
4610. gbvrt189.seq - Other vertebrate sequence entries, part 189.
4611. gbvrt19.seq - Other vertebrate sequence entries, part 19.
4612. gbvrt190.seq - Other vertebrate sequence entries, part 190.
4613. gbvrt191.seq - Other vertebrate sequence entries, part 191.
4614. gbvrt192.seq - Other vertebrate sequence entries, part 192.
4615. gbvrt193.seq - Other vertebrate sequence entries, part 193.
4616. gbvrt194.seq - Other vertebrate sequence entries, part 194.
4617. gbvrt195.seq - Other vertebrate sequence entries, part 195.
4618. gbvrt196.seq - Other vertebrate sequence entries, part 196.
4619. gbvrt197.seq - Other vertebrate sequence entries, part 197.
4620. gbvrt198.seq - Other vertebrate sequence entries, part 198.
4621. gbvrt199.seq - Other vertebrate sequence entries, part 199.
4622. gbvrt2.seq - Other vertebrate sequence entries, part 2.
4623. gbvrt20.seq - Other vertebrate sequence entries, part 20.
4624. gbvrt200.seq - Other vertebrate sequence entries, part 200.
4625. gbvrt201.seq - Other vertebrate sequence entries, part 201.
4626. gbvrt202.seq - Other vertebrate sequence entries, part 202.
4627. gbvrt203.seq - Other vertebrate sequence entries, part 203.
4628. gbvrt204.seq - Other vertebrate sequence entries, part 204.
4629. gbvrt205.seq - Other vertebrate sequence entries, part 205.
4630. gbvrt206.seq - Other vertebrate sequence entries, part 206.
4631. gbvrt207.seq - Other vertebrate sequence entries, part 207.
4632. gbvrt208.seq - Other vertebrate sequence entries, part 208.
4633. gbvrt209.seq - Other vertebrate sequence entries, part 209.
4634. gbvrt21.seq - Other vertebrate sequence entries, part 21.
4635. gbvrt210.seq - Other vertebrate sequence entries, part 210.
4636. gbvrt211.seq - Other vertebrate sequence entries, part 211.
4637. gbvrt212.seq - Other vertebrate sequence entries, part 212.
4638. gbvrt213.seq - Other vertebrate sequence entries, part 213.
4639. gbvrt214.seq - Other vertebrate sequence entries, part 214.
4640. gbvrt215.seq - Other vertebrate sequence entries, part 215.
4641. gbvrt216.seq - Other vertebrate sequence entries, part 216.
4642. gbvrt217.seq - Other vertebrate sequence entries, part 217.
4643. gbvrt218.seq - Other vertebrate sequence entries, part 218.
4644. gbvrt219.seq - Other vertebrate sequence entries, part 219.
4645. gbvrt22.seq - Other vertebrate sequence entries, part 22.
4646. gbvrt220.seq - Other vertebrate sequence entries, part 220.
4647. gbvrt221.seq - Other vertebrate sequence entries, part 221.
4648. gbvrt222.seq - Other vertebrate sequence entries, part 222.
4649. gbvrt223.seq - Other vertebrate sequence entries, part 223.
4650. gbvrt224.seq - Other vertebrate sequence entries, part 224.
4651. gbvrt225.seq - Other vertebrate sequence entries, part 225.
4652. gbvrt226.seq - Other vertebrate sequence entries, part 226.
4653. gbvrt227.seq - Other vertebrate sequence entries, part 227.
4654. gbvrt228.seq - Other vertebrate sequence entries, part 228.
4655. gbvrt229.seq - Other vertebrate sequence entries, part 229.
4656. gbvrt23.seq - Other vertebrate sequence entries, part 23.
4657. gbvrt230.seq - Other vertebrate sequence entries, part 230.
4658. gbvrt231.seq - Other vertebrate sequence entries, part 231.
4659. gbvrt232.seq - Other vertebrate sequence entries, part 232.
4660. gbvrt233.seq - Other vertebrate sequence entries, part 233.
4661. gbvrt234.seq - Other vertebrate sequence entries, part 234.
4662. gbvrt235.seq - Other vertebrate sequence entries, part 235.
4663. gbvrt236.seq - Other vertebrate sequence entries, part 236.
4664. gbvrt237.seq - Other vertebrate sequence entries, part 237.
4665. gbvrt238.seq - Other vertebrate sequence entries, part 238.
4666. gbvrt239.seq - Other vertebrate sequence entries, part 239.
4667. gbvrt24.seq - Other vertebrate sequence entries, part 24.
4668. gbvrt240.seq - Other vertebrate sequence entries, part 240.
4669. gbvrt241.seq - Other vertebrate sequence entries, part 241.
4670. gbvrt242.seq - Other vertebrate sequence entries, part 242.
4671. gbvrt243.seq - Other vertebrate sequence entries, part 243.
4672. gbvrt244.seq - Other vertebrate sequence entries, part 244.
4673. gbvrt245.seq - Other vertebrate sequence entries, part 245.
4674. gbvrt246.seq - Other vertebrate sequence entries, part 246.
4675. gbvrt247.seq - Other vertebrate sequence entries, part 247.
4676. gbvrt248.seq - Other vertebrate sequence entries, part 248.
4677. gbvrt249.seq - Other vertebrate sequence entries, part 249.
4678. gbvrt25.seq - Other vertebrate sequence entries, part 25.
4679. gbvrt250.seq - Other vertebrate sequence entries, part 250.
4680. gbvrt251.seq - Other vertebrate sequence entries, part 251.
4681. gbvrt252.seq - Other vertebrate sequence entries, part 252.
4682. gbvrt253.seq - Other vertebrate sequence entries, part 253.
4683. gbvrt254.seq - Other vertebrate sequence entries, part 254.
4684. gbvrt255.seq - Other vertebrate sequence entries, part 255.
4685. gbvrt256.seq - Other vertebrate sequence entries, part 256.
4686. gbvrt257.seq - Other vertebrate sequence entries, part 257.
4687. gbvrt258.seq - Other vertebrate sequence entries, part 258.
4688. gbvrt259.seq - Other vertebrate sequence entries, part 259.
4689. gbvrt26.seq - Other vertebrate sequence entries, part 26.
4690. gbvrt260.seq - Other vertebrate sequence entries, part 260.
4691. gbvrt261.seq - Other vertebrate sequence entries, part 261.
4692. gbvrt262.seq - Other vertebrate sequence entries, part 262.
4693. gbvrt263.seq - Other vertebrate sequence entries, part 263.
4694. gbvrt264.seq - Other vertebrate sequence entries, part 264.
4695. gbvrt265.seq - Other vertebrate sequence entries, part 265.
4696. gbvrt266.seq - Other vertebrate sequence entries, part 266.
4697. gbvrt267.seq - Other vertebrate sequence entries, part 267.
4698. gbvrt268.seq - Other vertebrate sequence entries, part 268.
4699. gbvrt269.seq - Other vertebrate sequence entries, part 269.
4700. gbvrt27.seq - Other vertebrate sequence entries, part 27.
4701. gbvrt270.seq - Other vertebrate sequence entries, part 270.
4702. gbvrt271.seq - Other vertebrate sequence entries, part 271.
4703. gbvrt272.seq - Other vertebrate sequence entries, part 272.
4704. gbvrt273.seq - Other vertebrate sequence entries, part 273.
4705. gbvrt274.seq - Other vertebrate sequence entries, part 274.
4706. gbvrt275.seq - Other vertebrate sequence entries, part 275.
4707. gbvrt276.seq - Other vertebrate sequence entries, part 276.
4708. gbvrt277.seq - Other vertebrate sequence entries, part 277.
4709. gbvrt278.seq - Other vertebrate sequence entries, part 278.
4710. gbvrt279.seq - Other vertebrate sequence entries, part 279.
4711. gbvrt28.seq - Other vertebrate sequence entries, part 28.
4712. gbvrt280.seq - Other vertebrate sequence entries, part 280.
4713. gbvrt281.seq - Other vertebrate sequence entries, part 281.
4714. gbvrt282.seq - Other vertebrate sequence entries, part 282.
4715. gbvrt283.seq - Other vertebrate sequence entries, part 283.
4716. gbvrt284.seq - Other vertebrate sequence entries, part 284.
4717. gbvrt285.seq - Other vertebrate sequence entries, part 285.
4718. gbvrt286.seq - Other vertebrate sequence entries, part 286.
4719. gbvrt287.seq - Other vertebrate sequence entries, part 287.
4720. gbvrt288.seq - Other vertebrate sequence entries, part 288.
4721. gbvrt289.seq - Other vertebrate sequence entries, part 289.
4722. gbvrt29.seq - Other vertebrate sequence entries, part 29.
4723. gbvrt290.seq - Other vertebrate sequence entries, part 290.
4724. gbvrt291.seq - Other vertebrate sequence entries, part 291.
4725. gbvrt292.seq - Other vertebrate sequence entries, part 292.
4726. gbvrt3.seq - Other vertebrate sequence entries, part 3.
4727. gbvrt30.seq - Other vertebrate sequence entries, part 30.
4728. gbvrt31.seq - Other vertebrate sequence entries, part 31.
4729. gbvrt32.seq - Other vertebrate sequence entries, part 32.
4730. gbvrt33.seq - Other vertebrate sequence entries, part 33.
4731. gbvrt34.seq - Other vertebrate sequence entries, part 34.
4732. gbvrt35.seq - Other vertebrate sequence entries, part 35.
4733. gbvrt36.seq - Other vertebrate sequence entries, part 36.
4734. gbvrt37.seq - Other vertebrate sequence entries, part 37.
4735. gbvrt38.seq - Other vertebrate sequence entries, part 38.
4736. gbvrt39.seq - Other vertebrate sequence entries, part 39.
4737. gbvrt4.seq - Other vertebrate sequence entries, part 4.
4738. gbvrt40.seq - Other vertebrate sequence entries, part 40.
4739. gbvrt41.seq - Other vertebrate sequence entries, part 41.
4740. gbvrt42.seq - Other vertebrate sequence entries, part 42.
4741. gbvrt43.seq - Other vertebrate sequence entries, part 43.
4742. gbvrt44.seq - Other vertebrate sequence entries, part 44.
4743. gbvrt45.seq - Other vertebrate sequence entries, part 45.
4744. gbvrt46.seq - Other vertebrate sequence entries, part 46.
4745. gbvrt47.seq - Other vertebrate sequence entries, part 47.
4746. gbvrt48.seq - Other vertebrate sequence entries, part 48.
4747. gbvrt49.seq - Other vertebrate sequence entries, part 49.
4748. gbvrt5.seq - Other vertebrate sequence entries, part 5.
4749. gbvrt50.seq - Other vertebrate sequence entries, part 50.
4750. gbvrt51.seq - Other vertebrate sequence entries, part 51.
4751. gbvrt52.seq - Other vertebrate sequence entries, part 52.
4752. gbvrt53.seq - Other vertebrate sequence entries, part 53.
4753. gbvrt54.seq - Other vertebrate sequence entries, part 54.
4754. gbvrt55.seq - Other vertebrate sequence entries, part 55.
4755. gbvrt56.seq - Other vertebrate sequence entries, part 56.
4756. gbvrt57.seq - Other vertebrate sequence entries, part 57.
4757. gbvrt58.seq - Other vertebrate sequence entries, part 58.
4758. gbvrt59.seq - Other vertebrate sequence entries, part 59.
4759. gbvrt6.seq - Other vertebrate sequence entries, part 6.
4760. gbvrt60.seq - Other vertebrate sequence entries, part 60.
4761. gbvrt61.seq - Other vertebrate sequence entries, part 61.
4762. gbvrt62.seq - Other vertebrate sequence entries, part 62.
4763. gbvrt63.seq - Other vertebrate sequence entries, part 63.
4764. gbvrt64.seq - Other vertebrate sequence entries, part 64.
4765. gbvrt65.seq - Other vertebrate sequence entries, part 65.
4766. gbvrt66.seq - Other vertebrate sequence entries, part 66.
4767. gbvrt67.seq - Other vertebrate sequence entries, part 67.
4768. gbvrt68.seq - Other vertebrate sequence entries, part 68.
4769. gbvrt69.seq - Other vertebrate sequence entries, part 69.
4770. gbvrt7.seq - Other vertebrate sequence entries, part 7.
4771. gbvrt70.seq - Other vertebrate sequence entries, part 70.
4772. gbvrt71.seq - Other vertebrate sequence entries, part 71.
4773. gbvrt72.seq - Other vertebrate sequence entries, part 72.
4774. gbvrt73.seq - Other vertebrate sequence entries, part 73.
4775. gbvrt74.seq - Other vertebrate sequence entries, part 74.
4776. gbvrt75.seq - Other vertebrate sequence entries, part 75.
4777. gbvrt76.seq - Other vertebrate sequence entries, part 76.
4778. gbvrt77.seq - Other vertebrate sequence entries, part 77.
4779. gbvrt78.seq - Other vertebrate sequence entries, part 78.
4780. gbvrt79.seq - Other vertebrate sequence entries, part 79.
4781. gbvrt8.seq - Other vertebrate sequence entries, part 8.
4782. gbvrt80.seq - Other vertebrate sequence entries, part 80.
4783. gbvrt81.seq - Other vertebrate sequence entries, part 81.
4784. gbvrt82.seq - Other vertebrate sequence entries, part 82.
4785. gbvrt83.seq - Other vertebrate sequence entries, part 83.
4786. gbvrt84.seq - Other vertebrate sequence entries, part 84.
4787. gbvrt85.seq - Other vertebrate sequence entries, part 85.
4788. gbvrt86.seq - Other vertebrate sequence entries, part 86.
4789. gbvrt87.seq - Other vertebrate sequence entries, part 87.
4790. gbvrt88.seq - Other vertebrate sequence entries, part 88.
4791. gbvrt89.seq - Other vertebrate sequence entries, part 89.
4792. gbvrt9.seq - Other vertebrate sequence entries, part 9.
4793. gbvrt90.seq - Other vertebrate sequence entries, part 90.
4794. gbvrt91.seq - Other vertebrate sequence entries, part 91.
4795. gbvrt92.seq - Other vertebrate sequence entries, part 92.
4796. gbvrt93.seq - Other vertebrate sequence entries, part 93.
4797. gbvrt94.seq - Other vertebrate sequence entries, part 94.
4798. gbvrt95.seq - Other vertebrate sequence entries, part 95.
4799. gbvrt96.seq - Other vertebrate sequence entries, part 96.
4800. gbvrt97.seq - Other vertebrate sequence entries, part 97.
4801. gbvrt98.seq - Other vertebrate sequence entries, part 98.
4802. gbvrt99.seq - Other vertebrate sequence entries, part 99.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 248.0 flatfiles require roughly 2251 GB, including
the sequence files and the *.txt files.
The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
499478998 gbbct1.seq
497004745 gbbct10.seq
74937926 gbbct100.seq
489628391 gbbct101.seq
499324473 gbbct102.seq
499932034 gbbct103.seq
389028332 gbbct104.seq
499874269 gbbct105.seq
498124521 gbbct106.seq
499293117 gbbct107.seq
491408562 gbbct108.seq
13752576 gbbct109.seq
498137588 gbbct11.seq
493589519 gbbct110.seq
494745780 gbbct111.seq
495417216 gbbct112.seq
491069911 gbbct113.seq
195549944 gbbct114.seq
494137385 gbbct115.seq
492532931 gbbct116.seq
493222811 gbbct117.seq
497237663 gbbct118.seq
99480538 gbbct119.seq
498756219 gbbct12.seq
499011110 gbbct120.seq
494100520 gbbct121.seq
498830491 gbbct122.seq
333298049 gbbct123.seq
490711205 gbbct124.seq
498618689 gbbct125.seq
499996757 gbbct126.seq
426872035 gbbct127.seq
491477031 gbbct128.seq
489083762 gbbct129.seq
27848759 gbbct13.seq
487156903 gbbct130.seq
498576633 gbbct131.seq
490823058 gbbct132.seq
488628571 gbbct133.seq
425698518 gbbct134.seq
498287445 gbbct135.seq
489448234 gbbct136.seq
499734983 gbbct137.seq
461302620 gbbct138.seq
495776348 gbbct139.seq
499888611 gbbct14.seq
493829933 gbbct140.seq
491661683 gbbct141.seq
498685400 gbbct142.seq
499806778 gbbct143.seq
147979463 gbbct144.seq
496897361 gbbct145.seq
494839032 gbbct146.seq
493252206 gbbct147.seq
494976101 gbbct148.seq
404787633 gbbct149.seq
496455524 gbbct15.seq
489367744 gbbct150.seq
490447394 gbbct151.seq
498396226 gbbct152.seq
497204778 gbbct153.seq
492635657 gbbct154.seq
341077097 gbbct155.seq
497656051 gbbct156.seq
494967775 gbbct157.seq
496952242 gbbct158.seq
489043020 gbbct159.seq
496650137 gbbct16.seq
493287598 gbbct160.seq
496053153 gbbct161.seq
159717960 gbbct162.seq
494734495 gbbct163.seq
491514187 gbbct164.seq
495160282 gbbct165.seq
475148668 gbbct166.seq
497456612 gbbct167.seq
493190726 gbbct168.seq
492199014 gbbct169.seq
492249072 gbbct17.seq
491123486 gbbct170.seq
493968697 gbbct171.seq
489221514 gbbct172.seq
497866922 gbbct173.seq
496180293 gbbct174.seq
195291545 gbbct175.seq
493675547 gbbct176.seq
491173977 gbbct177.seq
499375552 gbbct178.seq
273476305 gbbct179.seq
10689912 gbbct18.seq
495006064 gbbct180.seq
495933135 gbbct181.seq
489790270 gbbct182.seq
303707273 gbbct183.seq
499226172 gbbct184.seq
489059042 gbbct185.seq
495425204 gbbct186.seq
496022194 gbbct187.seq
67162085 gbbct188.seq
498036958 gbbct189.seq
498898071 gbbct19.seq
497779672 gbbct190.seq
496083279 gbbct191.seq
496491597 gbbct192.seq
499747602 gbbct193.seq
192261499 gbbct194.seq
498767719 gbbct195.seq
497238546 gbbct196.seq
493963072 gbbct197.seq
497330862 gbbct198.seq
275862693 gbbct199.seq
497213764 gbbct2.seq
499310721 gbbct20.seq
495095466 gbbct200.seq
495972090 gbbct201.seq
496079793 gbbct202.seq
493223865 gbbct203.seq
246412484 gbbct204.seq
499817125 gbbct205.seq
497426652 gbbct206.seq
497029443 gbbct207.seq
497534154 gbbct208.seq
440230503 gbbct209.seq
499430673 gbbct21.seq
499900363 gbbct210.seq
496011665 gbbct211.seq
481293430 gbbct212.seq
496168649 gbbct213.seq
495262662 gbbct214.seq
499946585 gbbct215.seq
318928688 gbbct216.seq
497109800 gbbct217.seq
493797255 gbbct218.seq
496714951 gbbct219.seq
494264055 gbbct22.seq
378276833 gbbct220.seq
484833405 gbbct221.seq
495646240 gbbct222.seq
499615391 gbbct223.seq
497011357 gbbct224.seq
228371709 gbbct225.seq
493989285 gbbct226.seq
489510950 gbbct227.seq
488962685 gbbct228.seq
173357142 gbbct229.seq
65823472 gbbct23.seq
493892752 gbbct230.seq
496232012 gbbct231.seq
493073830 gbbct232.seq
498684952 gbbct233.seq
155788816 gbbct234.seq
494063240 gbbct235.seq
488280966 gbbct236.seq
489824993 gbbct237.seq
489986916 gbbct238.seq
145652078 gbbct239.seq
492477673 gbbct24.seq
483160992 gbbct240.seq
496790746 gbbct241.seq
489571157 gbbct242.seq
446057509 gbbct243.seq
492194050 gbbct244.seq
487559671 gbbct245.seq
492444662 gbbct246.seq
457216164 gbbct247.seq
498159131 gbbct248.seq
490705855 gbbct249.seq
490124448 gbbct25.seq
496101834 gbbct250.seq
492720735 gbbct251.seq
495668957 gbbct252.seq
131796901 gbbct253.seq
491982954 gbbct254.seq
488305898 gbbct255.seq
484960307 gbbct256.seq
448261547 gbbct257.seq
496470398 gbbct258.seq
495798367 gbbct259.seq
498214424 gbbct26.seq
499577858 gbbct260.seq
453757074 gbbct261.seq
496061144 gbbct262.seq
499419753 gbbct263.seq
488828521 gbbct264.seq
496557659 gbbct265.seq
496529312 gbbct266.seq
497206737 gbbct267.seq
157062373 gbbct268.seq
491163330 gbbct269.seq
495528265 gbbct27.seq
488410874 gbbct270.seq
497409210 gbbct271.seq
495127551 gbbct272.seq
24400806 gbbct273.seq
497188943 gbbct274.seq
496648193 gbbct275.seq
496913794 gbbct276.seq
458244617 gbbct277.seq
495338382 gbbct278.seq
499422429 gbbct279.seq
497901242 gbbct28.seq
499643473 gbbct280.seq
486051845 gbbct281.seq
492091616 gbbct282.seq
495399599 gbbct283.seq
497541984 gbbct284.seq
492916272 gbbct285.seq
487661820 gbbct286.seq
490839824 gbbct287.seq
497467051 gbbct288.seq
487108270 gbbct289.seq
20405696 gbbct29.seq
494472446 gbbct290.seq
495455471 gbbct291.seq
337003586 gbbct292.seq
497758369 gbbct293.seq
491215955 gbbct294.seq
487093195 gbbct295.seq
491127905 gbbct296.seq
402161257 gbbct297.seq
498731834 gbbct298.seq
495864117 gbbct299.seq
301518313 gbbct3.seq
497340582 gbbct30.seq
496227294 gbbct300.seq
496935556 gbbct301.seq
387482718 gbbct302.seq
494855900 gbbct303.seq
494741773 gbbct304.seq
499982911 gbbct305.seq
489769451 gbbct306.seq
413163748 gbbct307.seq
498785516 gbbct308.seq
497116220 gbbct309.seq
497861790 gbbct31.seq
488501940 gbbct310.seq
497889072 gbbct311.seq
389356020 gbbct312.seq
491217130 gbbct313.seq
497116182 gbbct314.seq
498125971 gbbct315.seq
495462729 gbbct316.seq
493195921 gbbct317.seq
88117703 gbbct318.seq
497529597 gbbct319.seq
492727160 gbbct32.seq
493930388 gbbct320.seq
499359813 gbbct321.seq
496244309 gbbct322.seq
232180401 gbbct323.seq
495595039 gbbct324.seq
498470895 gbbct325.seq
495995380 gbbct326.seq
494542487 gbbct327.seq
407613790 gbbct328.seq
490874808 gbbct329.seq
479354592 gbbct33.seq
488242668 gbbct330.seq
490121906 gbbct331.seq
496681004 gbbct332.seq
497851062 gbbct333.seq
493154164 gbbct334.seq
495429985 gbbct335.seq
233839616 gbbct336.seq
488777213 gbbct337.seq
496209438 gbbct338.seq
492688396 gbbct339.seq
489873765 gbbct34.seq
495896876 gbbct340.seq
492154990 gbbct341.seq
498314294 gbbct342.seq
238514722 gbbct343.seq
493830838 gbbct344.seq
499980156 gbbct345.seq
485947589 gbbct346.seq
496449672 gbbct347.seq
419496243 gbbct348.seq
497565168 gbbct349.seq
491201588 gbbct35.seq
499825695 gbbct350.seq
490104324 gbbct351.seq
486817399 gbbct352.seq
499878797 gbbct353.seq
499536085 gbbct354.seq
499233483 gbbct355.seq
13382587 gbbct356.seq
488618187 gbbct357.seq
498839555 gbbct358.seq
492625131 gbbct359.seq
494484033 gbbct36.seq
499914343 gbbct360.seq
176072357 gbbct361.seq
498413370 gbbct362.seq
491907967 gbbct363.seq
491453671 gbbct364.seq
499238005 gbbct365.seq
158616063 gbbct366.seq
492034209 gbbct367.seq
496396078 gbbct368.seq
492762682 gbbct369.seq
497206590 gbbct37.seq
491367474 gbbct370.seq
499845033 gbbct371.seq
490758057 gbbct372.seq
105767116 gbbct373.seq
497084779 gbbct374.seq
496693764 gbbct375.seq
493695474 gbbct376.seq
496893135 gbbct377.seq
499374119 gbbct378.seq
495200194 gbbct379.seq
498358153 gbbct38.seq
314935149 gbbct380.seq
490502803 gbbct381.seq
498185487 gbbct382.seq
493195420 gbbct383.seq
498844009 gbbct384.seq
497204335 gbbct385.seq
175983756 gbbct386.seq
495693430 gbbct387.seq
497428139 gbbct388.seq
499387319 gbbct389.seq
466956304 gbbct39.seq
493199135 gbbct390.seq
489018350 gbbct391.seq
411886055 gbbct392.seq
496813791 gbbct393.seq
491384339 gbbct394.seq
496516498 gbbct395.seq
497674189 gbbct396.seq
498223300 gbbct397.seq
498650891 gbbct398.seq
422281629 gbbct399.seq
394685495 gbbct4.seq
21429847 gbbct40.seq
491413692 gbbct400.seq
493169100 gbbct401.seq
499686643 gbbct402.seq
495287765 gbbct403.seq
142636038 gbbct404.seq
484011539 gbbct405.seq
494094195 gbbct406.seq
498211901 gbbct407.seq
499938269 gbbct408.seq
369655143 gbbct409.seq
38682590 gbbct41.seq
499135589 gbbct410.seq
492109484 gbbct411.seq
497368632 gbbct412.seq
494601911 gbbct413.seq
229066322 gbbct414.seq
493594449 gbbct415.seq
494281458 gbbct416.seq
498280592 gbbct417.seq
482274761 gbbct418.seq
167689344 gbbct419.seq
499614645 gbbct42.seq
499863872 gbbct420.seq
493319433 gbbct421.seq
499971747 gbbct422.seq
499955479 gbbct423.seq
46260690 gbbct424.seq
494159569 gbbct425.seq
494444916 gbbct426.seq
493696745 gbbct427.seq
499965064 gbbct428.seq
27014534 gbbct429.seq
495920445 gbbct43.seq
493426836 gbbct430.seq
490784357 gbbct431.seq
495844042 gbbct432.seq
498701121 gbbct433.seq
492912661 gbbct434.seq
257203594 gbbct435.seq
490604125 gbbct436.seq
491191408 gbbct437.seq
494654305 gbbct438.seq
499754568 gbbct439.seq
497800139 gbbct44.seq
498751763 gbbct440.seq
148613665 gbbct441.seq
492174978 gbbct442.seq
498588273 gbbct443.seq
498854596 gbbct444.seq
487676073 gbbct445.seq
491036302 gbbct446.seq
498928120 gbbct447.seq
306307828 gbbct448.seq
494893698 gbbct449.seq
446397884 gbbct45.seq
483767795 gbbct450.seq
492577513 gbbct451.seq
497506374 gbbct452.seq
491066945 gbbct453.seq
495293792 gbbct454.seq
162776930 gbbct455.seq
488324528 gbbct456.seq
497533793 gbbct457.seq
493548787 gbbct458.seq
499403536 gbbct459.seq
497462802 gbbct46.seq
490776009 gbbct460.seq
457647469 gbbct461.seq
494298101 gbbct462.seq
493347926 gbbct463.seq
495710628 gbbct464.seq
492474458 gbbct465.seq
190485650 gbbct466.seq
498483690 gbbct467.seq
496494588 gbbct468.seq
492081176 gbbct469.seq
491184233 gbbct47.seq
496522224 gbbct470.seq
495971917 gbbct471.seq
496934600 gbbct472.seq
399199567 gbbct473.seq
490780906 gbbct474.seq
493678508 gbbct475.seq
497322448 gbbct476.seq
493964970 gbbct477.seq
497709677 gbbct478.seq
489077508 gbbct479.seq
499082686 gbbct48.seq
109786043 gbbct480.seq
495589325 gbbct481.seq
497518821 gbbct482.seq
491394911 gbbct483.seq
490670340 gbbct484.seq
497775025 gbbct485.seq
498511812 gbbct486.seq
63890886 gbbct487.seq
496015231 gbbct488.seq
499516485 gbbct489.seq
495738613 gbbct49.seq
495032489 gbbct490.seq
492976707 gbbct491.seq
495204591 gbbct492.seq
493945832 gbbct493.seq
207708860 gbbct494.seq
499275429 gbbct495.seq
490304096 gbbct496.seq
499424558 gbbct497.seq
494645405 gbbct498.seq
499386008 gbbct499.seq
459672018 gbbct5.seq
488459920 gbbct50.seq
375367001 gbbct500.seq
491823172 gbbct501.seq
492584746 gbbct502.seq
497516022 gbbct503.seq
494271120 gbbct504.seq
497980983 gbbct505.seq
175385117 gbbct506.seq
499357622 gbbct507.seq
494394440 gbbct508.seq
497342649 gbbct509.seq
274679492 gbbct51.seq
493148254 gbbct510.seq
406849087 gbbct511.seq
495965444 gbbct512.seq
499511881 gbbct513.seq
494415951 gbbct514.seq
498713696 gbbct515.seq
496416905 gbbct516.seq
469943625 gbbct517.seq
491893030 gbbct518.seq
491537787 gbbct519.seq
496359066 gbbct52.seq
499990592 gbbct520.seq
497117061 gbbct521.seq
495006357 gbbct522.seq
198106453 gbbct523.seq
495822179 gbbct524.seq
499521439 gbbct525.seq
489921944 gbbct526.seq
489755676 gbbct527.seq
423184097 gbbct528.seq
496453380 gbbct529.seq
491310655 gbbct53.seq
494326945 gbbct530.seq
489535715 gbbct531.seq
495462451 gbbct532.seq
470912196 gbbct533.seq
490976195 gbbct534.seq
496482683 gbbct535.seq
492554926 gbbct536.seq
491128682 gbbct537.seq
499799016 gbbct538.seq
125505947 gbbct539.seq
499896972 gbbct54.seq
495434558 gbbct540.seq
494508277 gbbct541.seq
497078766 gbbct542.seq
495057872 gbbct543.seq
479445765 gbbct544.seq
495750934 gbbct545.seq
497647088 gbbct546.seq
497799668 gbbct547.seq
493971634 gbbct548.seq
496142271 gbbct549.seq
492176911 gbbct55.seq
497728601 gbbct550.seq
488679967 gbbct551.seq
492109864 gbbct552.seq
490358708 gbbct553.seq
494960100 gbbct554.seq
76990686 gbbct555.seq
493726846 gbbct556.seq
493978691 gbbct557.seq
494828539 gbbct558.seq
488055946 gbbct559.seq
494853970 gbbct56.seq
496151091 gbbct560.seq
373855095 gbbct561.seq
488191490 gbbct562.seq
496989960 gbbct563.seq
493256034 gbbct564.seq
495639972 gbbct565.seq
494762143 gbbct566.seq
366100436 gbbct567.seq
489172735 gbbct568.seq
498326173 gbbct569.seq
356563193 gbbct57.seq
496422113 gbbct570.seq
497467265 gbbct571.seq
496409224 gbbct572.seq
361749526 gbbct573.seq
488171879 gbbct574.seq
491120539 gbbct575.seq
488472938 gbbct576.seq
496209238 gbbct577.seq
182757383 gbbct578.seq
498905770 gbbct579.seq
499974754 gbbct58.seq
498305618 gbbct580.seq
496665586 gbbct581.seq
499830033 gbbct582.seq
494660715 gbbct583.seq
492693017 gbbct584.seq
158758819 gbbct585.seq
498514155 gbbct586.seq
494927313 gbbct587.seq
496705662 gbbct588.seq
493829469 gbbct589.seq
492293589 gbbct59.seq
142328461 gbbct590.seq
494999428 gbbct591.seq
499749266 gbbct592.seq
494490596 gbbct593.seq
498054199 gbbct594.seq
495622051 gbbct595.seq
491261993 gbbct596.seq
499221836 gbbct597.seq
144370508 gbbct598.seq
490566066 gbbct599.seq
102235830 gbbct6.seq
489450444 gbbct60.seq
492703981 gbbct600.seq
494744132 gbbct601.seq
498340285 gbbct602.seq
491962009 gbbct603.seq
496625360 gbbct604.seq
493623611 gbbct605.seq
263472048 gbbct606.seq
492621112 gbbct607.seq
499142780 gbbct608.seq
495751248 gbbct609.seq
497371679 gbbct61.seq
499324761 gbbct610.seq
499899392 gbbct611.seq
495074785 gbbct612.seq
499576383 gbbct613.seq
146720419 gbbct614.seq
488090505 gbbct615.seq
496669465 gbbct616.seq
498228336 gbbct617.seq
498253881 gbbct618.seq
236858005 gbbct619.seq
499930603 gbbct62.seq
489374489 gbbct620.seq
499410534 gbbct621.seq
497853415 gbbct622.seq
498722148 gbbct623.seq
127256571 gbbct624.seq
497758819 gbbct625.seq
496033117 gbbct626.seq
493947651 gbbct627.seq
496406547 gbbct628.seq
238732756 gbbct629.seq
495181079 gbbct63.seq
494536036 gbbct630.seq
494027987 gbbct631.seq
499979201 gbbct632.seq
493572327 gbbct633.seq
499142829 gbbct634.seq
262953620 gbbct635.seq
305795546 gbbct636.seq
6890819 gbbct637.seq
14169496 gbbct638.seq
22801994 gbbct639.seq
112142515 gbbct64.seq
44504046 gbbct640.seq
86645459 gbbct641.seq
168589719 gbbct642.seq
499998449 gbbct643.seq
492936914 gbbct644.seq
499489201 gbbct645.seq
499961050 gbbct646.seq
498209253 gbbct647.seq
499998693 gbbct648.seq
131084234 gbbct649.seq
494608169 gbbct65.seq
493495357 gbbct650.seq
499363511 gbbct651.seq
484378227 gbbct652.seq
499999720 gbbct653.seq
219012109 gbbct654.seq
499998890 gbbct655.seq
291200954 gbbct656.seq
499998693 gbbct657.seq
85759267 gbbct658.seq
499998904 gbbct659.seq
499071741 gbbct66.seq
125663525 gbbct660.seq
499996833 gbbct661.seq
44341676 gbbct662.seq
146576327 gbbct663.seq
499859867 gbbct664.seq
499654328 gbbct665.seq
9302560 gbbct666.seq
497122362 gbbct667.seq
489940795 gbbct668.seq
493050111 gbbct669.seq
496563905 gbbct67.seq
497933335 gbbct670.seq
497254622 gbbct671.seq
488464412 gbbct672.seq
305471094 gbbct673.seq
495496654 gbbct674.seq
498006132 gbbct675.seq
498175408 gbbct676.seq
168613522 gbbct677.seq
472462062 gbbct678.seq
497339549 gbbct679.seq
497568426 gbbct68.seq
497110038 gbbct680.seq
499752407 gbbct681.seq
126535020 gbbct682.seq
487532545 gbbct683.seq
498131032 gbbct684.seq
496359051 gbbct685.seq
379404234 gbbct686.seq
498499361 gbbct687.seq
497461802 gbbct688.seq
491674471 gbbct689.seq
499752669 gbbct69.seq
325905521 gbbct690.seq
496306965 gbbct691.seq
497541981 gbbct692.seq
499054686 gbbct693.seq
243473915 gbbct694.seq
492631758 gbbct695.seq
496920939 gbbct696.seq
498726137 gbbct697.seq
498560081 gbbct698.seq
105689392 gbbct699.seq
282441699 gbbct7.seq
490382532 gbbct70.seq
496401198 gbbct700.seq
489823080 gbbct701.seq
498850944 gbbct702.seq
457165868 gbbct703.seq
51245620 gbbct704.seq
107907395 gbbct705.seq
499999613 gbbct706.seq
499999244 gbbct707.seq
390992457 gbbct708.seq
499998674 gbbct709.seq
257413073 gbbct71.seq
499998390 gbbct710.seq
498628392 gbbct711.seq
160274097 gbbct712.seq
499969440 gbbct72.seq
495194025 gbbct73.seq
486287671 gbbct74.seq
493007420 gbbct75.seq
475857766 gbbct76.seq
490138241 gbbct77.seq
485838920 gbbct78.seq
497985787 gbbct79.seq
493057223 gbbct8.seq
498937173 gbbct80.seq
306897238 gbbct81.seq
491474356 gbbct82.seq
494314105 gbbct83.seq
495820065 gbbct84.seq
498720264 gbbct85.seq
499103639 gbbct86.seq
261686782 gbbct87.seq
498131291 gbbct88.seq
499519594 gbbct89.seq
493342204 gbbct9.seq
498962881 gbbct90.seq
488108543 gbbct91.seq
397950786 gbbct92.seq
498261726 gbbct93.seq
492775826 gbbct94.seq
495523591 gbbct95.seq
300972601 gbbct96.seq
499886591 gbbct97.seq
495464938 gbbct98.seq
496856797 gbbct99.seq
831341 gbchg.txt
499860958 gbcon1.seq
498781762 gbcon10.seq
499998424 gbcon100.seq
499996530 gbcon101.seq
169780025 gbcon102.seq
498576120 gbcon103.seq
497575212 gbcon104.seq
499989129 gbcon105.seq
499900339 gbcon106.seq
298259760 gbcon107.seq
499956041 gbcon108.seq
499999027 gbcon109.seq
499862033 gbcon11.seq
303071293 gbcon110.seq
500000243 gbcon111.seq
499998613 gbcon112.seq
132681847 gbcon113.seq
499987403 gbcon114.seq
499995634 gbcon115.seq
499996921 gbcon116.seq
277244895 gbcon117.seq
499999876 gbcon118.seq
499999395 gbcon119.seq
498670252 gbcon12.seq
222253215 gbcon120.seq
45836617 gbcon121.seq
499997550 gbcon122.seq
499999703 gbcon123.seq
447041410 gbcon124.seq
499999192 gbcon125.seq
499999272 gbcon126.seq
499997076 gbcon127.seq
198112926 gbcon128.seq
499995599 gbcon129.seq
499489114 gbcon13.seq
499998760 gbcon130.seq
238758219 gbcon131.seq
499998528 gbcon132.seq
467678642 gbcon133.seq
499998130 gbcon134.seq
499998058 gbcon135.seq
260380073 gbcon136.seq
499998802 gbcon137.seq
499997841 gbcon138.seq
498181496 gbcon139.seq
496523489 gbcon14.seq
499999617 gbcon140.seq
499996334 gbcon141.seq
179609408 gbcon142.seq
499998561 gbcon143.seq
499997527 gbcon144.seq
23249966 gbcon145.seq
499889958 gbcon146.seq
499998608 gbcon147.seq
410833577 gbcon148.seq
499999604 gbcon149.seq
498684986 gbcon15.seq
499987779 gbcon150.seq
378623858 gbcon151.seq
499997936 gbcon152.seq
499960976 gbcon153.seq
264940632 gbcon154.seq
499997218 gbcon155.seq
499999328 gbcon156.seq
78099525 gbcon157.seq
500000141 gbcon158.seq
499799225 gbcon159.seq
499934626 gbcon16.seq
499994670 gbcon160.seq
143068769 gbcon161.seq
499830763 gbcon162.seq
499975648 gbcon163.seq
499972444 gbcon164.seq
336312117 gbcon165.seq
499996424 gbcon166.seq
499999419 gbcon167.seq
399264564 gbcon168.seq
499998956 gbcon169.seq
496611735 gbcon17.seq
499998687 gbcon170.seq
500000036 gbcon171.seq
272435741 gbcon172.seq
499999711 gbcon173.seq
499998667 gbcon174.seq
499706789 gbcon175.seq
499998512 gbcon176.seq
154981079 gbcon177.seq
499999305 gbcon178.seq
499997963 gbcon179.seq
497309090 gbcon18.seq
138651009 gbcon180.seq
499992979 gbcon181.seq
499998867 gbcon182.seq
499999258 gbcon183.seq
303257133 gbcon184.seq
499992303 gbcon185.seq
499993912 gbcon186.seq
474669064 gbcon187.seq
499998676 gbcon188.seq
499983543 gbcon189.seq
414471362 gbcon19.seq
397782244 gbcon190.seq
499964971 gbcon191.seq
499997535 gbcon192.seq
499997904 gbcon193.seq
138825089 gbcon194.seq
499998392 gbcon195.seq
499998372 gbcon196.seq
37871910 gbcon197.seq
499997011 gbcon198.seq
499999819 gbcon199.seq
499998374 gbcon2.seq
499999541 gbcon20.seq
499993488 gbcon200.seq
500000115 gbcon201.seq
499886090 gbcon202.seq
276533109 gbcon203.seq
499999940 gbcon204.seq
484917663 gbcon205.seq
499993738 gbcon206.seq
499997498 gbcon207.seq
486872465 gbcon208.seq
499999183 gbcon209.seq
499997735 gbcon21.seq
499995492 gbcon210.seq
499997150 gbcon211.seq
16981333 gbcon212.seq
499819619 gbcon213.seq
499981880 gbcon214.seq
499997209 gbcon215.seq
277682634 gbcon216.seq
499898455 gbcon217.seq
499856643 gbcon218.seq
499998729 gbcon219.seq
499999109 gbcon22.seq
499907000 gbcon220.seq
499997763 gbcon221.seq
499999543 gbcon222.seq
220931839 gbcon223.seq
83469174 gbcon23.seq
499999901 gbcon24.seq
499630336 gbcon25.seq
499132369 gbcon26.seq
314690312 gbcon27.seq
499452860 gbcon28.seq
126525272 gbcon29.seq
499994203 gbcon3.seq
126587128 gbcon30.seq
499912359 gbcon31.seq
499998468 gbcon32.seq
27859502 gbcon33.seq
499999414 gbcon34.seq
499998297 gbcon35.seq
444037905 gbcon36.seq
499999057 gbcon37.seq
499998568 gbcon38.seq
499999100 gbcon39.seq
106345447 gbcon4.seq
41918782 gbcon40.seq
500000081 gbcon41.seq
499998540 gbcon42.seq
277009775 gbcon43.seq
499996336 gbcon44.seq
499998469 gbcon45.seq
270612827 gbcon46.seq
499996532 gbcon47.seq
499996905 gbcon48.seq
385374935 gbcon49.seq
499940282 gbcon5.seq
499997390 gbcon50.seq
499999185 gbcon51.seq
176580283 gbcon52.seq
499999848 gbcon53.seq
499997718 gbcon54.seq
238773972 gbcon55.seq
499997628 gbcon56.seq
499995125 gbcon57.seq
335698760 gbcon58.seq
499996299 gbcon59.seq
494454587 gbcon6.seq
499999132 gbcon60.seq
298461041 gbcon61.seq
499995314 gbcon62.seq
499999014 gbcon63.seq
259899669 gbcon64.seq
499996880 gbcon65.seq
499997062 gbcon66.seq
187377116 gbcon67.seq
499996720 gbcon68.seq
499999826 gbcon69.seq
494751901 gbcon7.seq
364586197 gbcon70.seq
499993696 gbcon71.seq
499999904 gbcon72.seq
386119955 gbcon73.seq
499993762 gbcon74.seq
472811181 gbcon75.seq
174082386 gbcon76.seq
499969505 gbcon77.seq
23946021 gbcon78.seq
499984379 gbcon79.seq
499999799 gbcon8.seq
205111588 gbcon80.seq
199581542 gbcon81.seq
499268287 gbcon82.seq
499996643 gbcon83.seq
338965107 gbcon84.seq
499532057 gbcon85.seq
495874812 gbcon86.seq
499834813 gbcon87.seq
337734479 gbcon88.seq
499980044 gbcon89.seq
61944737 gbcon9.seq
499998630 gbcon90.seq
498904729 gbcon91.seq
169932990 gbcon92.seq
499999616 gbcon93.seq
499999383 gbcon94.seq
131836339 gbcon95.seq
499990652 gbcon96.seq
499998447 gbcon97.seq
499997417 gbcon98.seq
266670627 gbcon99.seq
137832 gbdel.txt
499999429 gbenv1.seq
499998223 gbenv10.seq
331316231 gbenv11.seq
499999293 gbenv12.seq
499999677 gbenv13.seq
53880227 gbenv14.seq
499999879 gbenv15.seq
499998079 gbenv16.seq
499999478 gbenv17.seq
499999544 gbenv18.seq
3618125 gbenv19.seq
499998453 gbenv2.seq
499999002 gbenv20.seq
499998213 gbenv21.seq
190621198 gbenv22.seq
499979910 gbenv23.seq
499999285 gbenv24.seq
499999875 gbenv25.seq
84006860 gbenv26.seq
499998912 gbenv27.seq
499996642 gbenv28.seq
177788104 gbenv29.seq
352295609 gbenv3.seq
499998558 gbenv30.seq
499997296 gbenv31.seq
499999524 gbenv32.seq
46480041 gbenv33.seq
499999106 gbenv34.seq
499999773 gbenv35.seq
192783277 gbenv36.seq
499998403 gbenv37.seq
500000164 gbenv38.seq
334968797 gbenv39.seq
494546959 gbenv4.seq
499999029 gbenv40.seq
499996383 gbenv41.seq
471516804 gbenv42.seq
499999400 gbenv43.seq
499997803 gbenv44.seq
338638437 gbenv45.seq
499998153 gbenv46.seq
499997831 gbenv47.seq
394455847 gbenv48.seq
499999570 gbenv49.seq
496526644 gbenv5.seq
499999456 gbenv50.seq
345513136 gbenv51.seq
499998983 gbenv52.seq
499998924 gbenv53.seq
237977475 gbenv54.seq
499999190 gbenv55.seq
499998689 gbenv56.seq
391153120 gbenv57.seq
499998772 gbenv58.seq
499983204 gbenv59.seq
499834241 gbenv6.seq
499998017 gbenv60.seq
96284384 gbenv61.seq
499998764 gbenv62.seq
499999152 gbenv63.seq
499998697 gbenv64.seq
198233913 gbenv65.seq
499999987 gbenv66.seq
499936947 gbenv67.seq
499979074 gbenv68.seq
499998753 gbenv69.seq
466429401 gbenv7.seq
316558523 gbenv70.seq
497122861 gbenv8.seq
499659232 gbenv9.seq
499999886 gbest1.seq
499998754 gbest10.seq
499999645 gbest100.seq
499999885 gbest101.seq
499998433 gbest102.seq
500000099 gbest103.seq
26995507 gbest104.seq
499996554 gbest105.seq
499997290 gbest106.seq
499999575 gbest107.seq
499997304 gbest108.seq
9862063 gbest109.seq
499997630 gbest11.seq
499999929 gbest110.seq
499998414 gbest111.seq
499999195 gbest112.seq
499997019 gbest113.seq
21753201 gbest114.seq
500000014 gbest115.seq
499999248 gbest116.seq
499999583 gbest117.seq
17679403 gbest118.seq
499998016 gbest119.seq
475534456 gbest12.seq
499998546 gbest120.seq
499997661 gbest121.seq
69242600 gbest122.seq
499997905 gbest123.seq
499996194 gbest124.seq
223679428 gbest125.seq
499997461 gbest126.seq
499998633 gbest127.seq
195307357 gbest128.seq
499997173 gbest129.seq
499998870 gbest13.seq
499998792 gbest130.seq
499995025 gbest131.seq
499996839 gbest132.seq
85321549 gbest133.seq
499999011 gbest134.seq
500000103 gbest135.seq
499997620 gbest136.seq
499998847 gbest137.seq
103557175 gbest138.seq
499999885 gbest139.seq
249982405 gbest14.seq
499996904 gbest140.seq
500000218 gbest141.seq
499998833 gbest142.seq
28430551 gbest143.seq
499998526 gbest144.seq
499996469 gbest145.seq
499995653 gbest146.seq
500000048 gbest147.seq
30910652 gbest148.seq
499998037 gbest149.seq
499999286 gbest15.seq
499997920 gbest150.seq
499997150 gbest151.seq
324336051 gbest152.seq
499997344 gbest153.seq
499999008 gbest154.seq
499996792 gbest155.seq
499998093 gbest156.seq
26483164 gbest157.seq
499999138 gbest158.seq
499998999 gbest159.seq
499999839 gbest16.seq
499996024 gbest160.seq
499998492 gbest161.seq
11183156 gbest162.seq
499997340 gbest163.seq
499997377 gbest164.seq
499999626 gbest165.seq
499996166 gbest166.seq
86346933 gbest167.seq
500000180 gbest168.seq
499996624 gbest169.seq
421346801 gbest17.seq
499997982 gbest170.seq
499996832 gbest171.seq
120388331 gbest172.seq
499998796 gbest173.seq
499999076 gbest174.seq
500000124 gbest175.seq
500000114 gbest176.seq
65991139 gbest177.seq
499999609 gbest178.seq
403619645 gbest179.seq
499999119 gbest18.seq
500000063 gbest180.seq
499998814 gbest181.seq
499998084 gbest182.seq
499997540 gbest183.seq
42825665 gbest184.seq
499998484 gbest185.seq
499998015 gbest186.seq
499998246 gbest187.seq
499999346 gbest188.seq
42160177 gbest189.seq
499996867 gbest19.seq
499997610 gbest190.seq
499998693 gbest191.seq
499999933 gbest192.seq
500000173 gbest193.seq
11501435 gbest194.seq
499997160 gbest195.seq
499998510 gbest196.seq
499997132 gbest197.seq
499997919 gbest198.seq
28268623 gbest199.seq
499998277 gbest2.seq
263017478 gbest20.seq
499998890 gbest200.seq
499998663 gbest201.seq
499999381 gbest202.seq
499998138 gbest203.seq
34237970 gbest204.seq
13610371 gbest205.seq
499997974 gbest206.seq
499997459 gbest207.seq
329256310 gbest208.seq
499997954 gbest209.seq
499995674 gbest21.seq
500000064 gbest210.seq
321738245 gbest211.seq
499999450 gbest212.seq
499998729 gbest213.seq
267108910 gbest214.seq
499997062 gbest215.seq
499999494 gbest216.seq
270108380 gbest217.seq
499999418 gbest218.seq
499999059 gbest219.seq
499998922 gbest22.seq
499997823 gbest220.seq
499998986 gbest221.seq
51988594 gbest222.seq
499998113 gbest223.seq
499998333 gbest224.seq
499998770 gbest225.seq
499998156 gbest226.seq
47735872 gbest227.seq
499998887 gbest228.seq
499999215 gbest229.seq
244340335 gbest23.seq
176584566 gbest230.seq
500000259 gbest231.seq
499998777 gbest232.seq
499999925 gbest233.seq
478326583 gbest234.seq
499997785 gbest235.seq
499999603 gbest236.seq
499997429 gbest237.seq
462328784 gbest238.seq
499999067 gbest239.seq
500000235 gbest24.seq
499999466 gbest240.seq
499999246 gbest241.seq
495323447 gbest242.seq
499999965 gbest243.seq
499998071 gbest244.seq
499999534 gbest245.seq
499997813 gbest246.seq
25251343 gbest247.seq
499999109 gbest248.seq
499998401 gbest249.seq
499997506 gbest25.seq
497267371 gbest250.seq
499999018 gbest251.seq
499998363 gbest252.seq
499998003 gbest253.seq
499998663 gbest254.seq
21635727 gbest255.seq
499997327 gbest256.seq
499995735 gbest257.seq
499996372 gbest258.seq
500000180 gbest259.seq
499999489 gbest26.seq
76689108 gbest260.seq
499998250 gbest261.seq
499999716 gbest262.seq
500000081 gbest263.seq
499998794 gbest264.seq
15525005 gbest265.seq
499996394 gbest266.seq
499997974 gbest267.seq
499999272 gbest268.seq
499999407 gbest269.seq
500000205 gbest27.seq
56981508 gbest270.seq
499998700 gbest271.seq
499999812 gbest272.seq
499999979 gbest273.seq
122782773 gbest274.seq
499996420 gbest275.seq
499998292 gbest276.seq
499996981 gbest277.seq
499996320 gbest278.seq
53596630 gbest279.seq
49054642 gbest28.seq
500000179 gbest280.seq
499997154 gbest281.seq
499998024 gbest282.seq
499999881 gbest283.seq
57202966 gbest284.seq
499998842 gbest285.seq
499998241 gbest286.seq
499995988 gbest287.seq
499998776 gbest288.seq
12647131 gbest289.seq
499998393 gbest29.seq
499998774 gbest290.seq
499999019 gbest291.seq
499998364 gbest292.seq
499998356 gbest293.seq
25130664 gbest294.seq
499999905 gbest295.seq
499999169 gbest296.seq
485346145 gbest297.seq
499996754 gbest298.seq
499999830 gbest299.seq
499997365 gbest3.seq
499999804 gbest30.seq
499999306 gbest300.seq
499998435 gbest301.seq
5321038 gbest302.seq
499998914 gbest303.seq
499998155 gbest304.seq
499999384 gbest305.seq
499999979 gbest306.seq
8677048 gbest307.seq
499998760 gbest308.seq
499998936 gbest309.seq
499999240 gbest31.seq
499997307 gbest310.seq
425297121 gbest311.seq
500000243 gbest312.seq
499996657 gbest313.seq
499996945 gbest314.seq
499999846 gbest315.seq
1986281 gbest316.seq
499999089 gbest317.seq
499997897 gbest318.seq
469362314 gbest319.seq
487176114 gbest32.seq
499999477 gbest320.seq
499998262 gbest321.seq
499999719 gbest322.seq
499998371 gbest323.seq
40423642 gbest324.seq
499997688 gbest325.seq
499998667 gbest326.seq
499999455 gbest327.seq
494521089 gbest328.seq
499998307 gbest329.seq
499996463 gbest33.seq
499996037 gbest330.seq
499998365 gbest331.seq
500000166 gbest332.seq
57725922 gbest333.seq
500000164 gbest334.seq
500000124 gbest335.seq
499998630 gbest336.seq
469710586 gbest337.seq
499998351 gbest338.seq
499999333 gbest339.seq
499996810 gbest34.seq
499998517 gbest340.seq
500000041 gbest341.seq
20351241 gbest342.seq
500000011 gbest343.seq
493014432 gbest344.seq
499999992 gbest345.seq
500000029 gbest346.seq
500000141 gbest347.seq
499998817 gbest348.seq
7025278 gbest349.seq
499999528 gbest35.seq
499999171 gbest350.seq
499998324 gbest351.seq
499998604 gbest352.seq
445206881 gbest353.seq
499999670 gbest354.seq
499999568 gbest355.seq
500000244 gbest356.seq
385830792 gbest357.seq
499999372 gbest358.seq
499997000 gbest359.seq
465871645 gbest36.seq
499997917 gbest360.seq
499999645 gbest361.seq
23214676 gbest362.seq
499998601 gbest363.seq
499999302 gbest364.seq
499999529 gbest365.seq
499999121 gbest366.seq
60139292 gbest367.seq
166258344 gbest368.seq
500000179 gbest369.seq
500000209 gbest37.seq
499999251 gbest370.seq
499998532 gbest371.seq
499997626 gbest372.seq
87733712 gbest373.seq
499997252 gbest374.seq
499999367 gbest375.seq
499997045 gbest376.seq
499999546 gbest377.seq
167121887 gbest378.seq
499996810 gbest379.seq
499998451 gbest38.seq
499998009 gbest380.seq
499999556 gbest381.seq
499998335 gbest382.seq
155306383 gbest383.seq
499997530 gbest384.seq
499998520 gbest385.seq
499999295 gbest386.seq
496942011 gbest387.seq
499998244 gbest388.seq
499997393 gbest389.seq
499999976 gbest39.seq
499997552 gbest390.seq
68562748 gbest391.seq
499998099 gbest392.seq
499995721 gbest393.seq
499997473 gbest394.seq
499998850 gbest395.seq
84700612 gbest396.seq
499999689 gbest397.seq
499996073 gbest398.seq
499999445 gbest399.seq
434896511 gbest4.seq
499997651 gbest40.seq
499998221 gbest400.seq
87997644 gbest401.seq
499999562 gbest402.seq
499999746 gbest403.seq
499999085 gbest404.seq
499997011 gbest405.seq
49235799 gbest406.seq
499999872 gbest407.seq
499998505 gbest408.seq
499998759 gbest409.seq
191428295 gbest41.seq
499999679 gbest410.seq
89160845 gbest411.seq
500000242 gbest412.seq
499997853 gbest413.seq
499995689 gbest414.seq
499999246 gbest415.seq
124809323 gbest416.seq
499996953 gbest417.seq
328041859 gbest418.seq
499997537 gbest419.seq
499997364 gbest42.seq
499999392 gbest420.seq
499999368 gbest421.seq
499999290 gbest422.seq
60418424 gbest423.seq
499998536 gbest424.seq
499999639 gbest425.seq
499997585 gbest426.seq
410620703 gbest427.seq
499997260 gbest428.seq
499999283 gbest429.seq
499997237 gbest43.seq
335979604 gbest430.seq
499996599 gbest431.seq
499999460 gbest432.seq
262500572 gbest433.seq
499999798 gbest434.seq
499998541 gbest435.seq
456055484 gbest436.seq
499999170 gbest437.seq
499995823 gbest438.seq
305124852 gbest439.seq
499997245 gbest44.seq
499996212 gbest440.seq
499998106 gbest441.seq
336207493 gbest442.seq
500000094 gbest443.seq
499997705 gbest444.seq
186758089 gbest445.seq
499999759 gbest446.seq
499999483 gbest447.seq
121142819 gbest448.seq
500000129 gbest449.seq
499996431 gbest45.seq
499998537 gbest450.seq
144796918 gbest451.seq
499999611 gbest452.seq
499998380 gbest453.seq
146704385 gbest454.seq
499998626 gbest455.seq
499997991 gbest456.seq
499997900 gbest457.seq
487556202 gbest458.seq
499999523 gbest459.seq
189558363 gbest46.seq
499997491 gbest460.seq
499997879 gbest461.seq
499999074 gbest462.seq
23477954 gbest463.seq
170019681 gbest464.seq
499998234 gbest465.seq
499997948 gbest466.seq
499998330 gbest467.seq
499998840 gbest468.seq
28589640 gbest469.seq
499999360 gbest47.seq
499999508 gbest470.seq
499999012 gbest471.seq
499999966 gbest472.seq
499999994 gbest473.seq
66467607 gbest474.seq
499998146 gbest475.seq
499996531 gbest476.seq
499997896 gbest477.seq
499997304 gbest478.seq
58819344 gbest479.seq
499998265 gbest48.seq
500000136 gbest480.seq
499996013 gbest481.seq
499998950 gbest482.seq
499998237 gbest483.seq
36800490 gbest484.seq
499997365 gbest485.seq
499997555 gbest486.seq
499999944 gbest487.seq
500000006 gbest488.seq
74672874 gbest489.seq
499997971 gbest49.seq
499996869 gbest490.seq
499999695 gbest491.seq
499997486 gbest492.seq
206551370 gbest493.seq
499996334 gbest494.seq
499999633 gbest495.seq
499998085 gbest496.seq
499999077 gbest497.seq
90122354 gbest498.seq
499998317 gbest499.seq
499999604 gbest5.seq
477001857 gbest50.seq
499997831 gbest500.seq
499997935 gbest501.seq
499995691 gbest502.seq
57521406 gbest503.seq
499995444 gbest504.seq
499998789 gbest505.seq
499999487 gbest506.seq
499997240 gbest507.seq
143896596 gbest508.seq
499999501 gbest509.seq
499999116 gbest51.seq
499998882 gbest510.seq
499996883 gbest511.seq
499998573 gbest512.seq
145499914 gbest513.seq
499997936 gbest514.seq
499999363 gbest515.seq
499999066 gbest516.seq
499998787 gbest517.seq
20665665 gbest518.seq
174271459 gbest519.seq
356399962 gbest52.seq
499998034 gbest520.seq
499998127 gbest521.seq
85666880 gbest522.seq
499998243 gbest523.seq
499999107 gbest524.seq
76895500 gbest525.seq
499998621 gbest526.seq
499997372 gbest527.seq
499999336 gbest528.seq
499999233 gbest529.seq
499999044 gbest53.seq
101202718 gbest530.seq
499998548 gbest531.seq
499999664 gbest532.seq
499999051 gbest533.seq
499997991 gbest534.seq
10812947 gbest535.seq
499998167 gbest536.seq
499999317 gbest537.seq
499999417 gbest538.seq
477043712 gbest539.seq
499999947 gbest54.seq
499999064 gbest540.seq
499999178 gbest541.seq
499998817 gbest542.seq
416863471 gbest543.seq
499999742 gbest544.seq
500000106 gbest545.seq
499999793 gbest546.seq
499998376 gbest547.seq
83233267 gbest548.seq
499999705 gbest549.seq
499997712 gbest55.seq
499999631 gbest550.seq
499999857 gbest551.seq
499996947 gbest552.seq
32801332 gbest553.seq
499996586 gbest554.seq
499997837 gbest555.seq
500000124 gbest556.seq
499998086 gbest557.seq
44754123 gbest558.seq
499997687 gbest559.seq
483687528 gbest56.seq
500000261 gbest560.seq
499999098 gbest561.seq
499998195 gbest562.seq
11930776 gbest563.seq
499999633 gbest564.seq
499998329 gbest565.seq
393275204 gbest566.seq
499997621 gbest567.seq
499997447 gbest568.seq
103617911 gbest569.seq
499999849 gbest57.seq
499998740 gbest570.seq
499998382 gbest571.seq
50523126 gbest572.seq
499999830 gbest573.seq
499997136 gbest574.seq
499999789 gbest575.seq
255974615 gbest576.seq
499999533 gbest58.seq
500000156 gbest59.seq
499998507 gbest6.seq
464399310 gbest60.seq
499997769 gbest61.seq
500000238 gbest62.seq
499999713 gbest63.seq
499999160 gbest64.seq
7793276 gbest65.seq
499997627 gbest66.seq
499997947 gbest67.seq
499998652 gbest68.seq
484302208 gbest69.seq
499999283 gbest7.seq
499998443 gbest70.seq
499997272 gbest71.seq
499997898 gbest72.seq
499997256 gbest73.seq
9739104 gbest74.seq
123413300 gbest75.seq
499999298 gbest76.seq
499998245 gbest77.seq
499998907 gbest78.seq
499999038 gbest79.seq
470350557 gbest8.seq
6590015 gbest80.seq
499998041 gbest81.seq
499996490 gbest82.seq
499997543 gbest83.seq
499996909 gbest84.seq
46982705 gbest85.seq
499998288 gbest86.seq
500000041 gbest87.seq
499997700 gbest88.seq
499996925 gbest89.seq
499997309 gbest9.seq
53718343 gbest90.seq
499998173 gbest91.seq
499999170 gbest92.seq
499997913 gbest93.seq
472228455 gbest94.seq
499998402 gbest95.seq
499999480 gbest96.seq
499999956 gbest97.seq
499890443 gbest98.seq
35244903 gbest99.seq
499997458 gbgss1.seq
55740438 gbgss10.seq
499997670 gbgss100.seq
45810173 gbgss101.seq
499999922 gbgss102.seq
499997379 gbgss103.seq
499998319 gbgss104.seq
468736585 gbgss105.seq
499998676 gbgss106.seq
500000226 gbgss107.seq
499998462 gbgss108.seq
499997978 gbgss109.seq
499999928 gbgss11.seq
42548343 gbgss110.seq
499997770 gbgss111.seq
499999226 gbgss112.seq
499997782 gbgss113.seq
318773212 gbgss114.seq
499999367 gbgss115.seq
499999051 gbgss116.seq
499997978 gbgss117.seq
499999019 gbgss118.seq
105483484 gbgss119.seq
499999265 gbgss12.seq
499997351 gbgss120.seq
499997815 gbgss121.seq
499997392 gbgss122.seq
499998819 gbgss123.seq
8930221 gbgss124.seq
499999907 gbgss125.seq
499998685 gbgss126.seq
499999539 gbgss127.seq
451770472 gbgss128.seq
499998345 gbgss129.seq
499999682 gbgss13.seq
499999211 gbgss130.seq
499997711 gbgss131.seq
499998622 gbgss132.seq
29785783 gbgss133.seq
499997877 gbgss134.seq
209679641 gbgss135.seq
500000110 gbgss136.seq
499999602 gbgss137.seq
499997969 gbgss138.seq
500000125 gbgss139.seq
499998207 gbgss14.seq
14831686 gbgss140.seq
499996726 gbgss141.seq
499997951 gbgss142.seq
499999528 gbgss143.seq
499997001 gbgss144.seq
16786266 gbgss145.seq
499997786 gbgss146.seq
499996974 gbgss147.seq
499999546 gbgss148.seq
499996547 gbgss149.seq
4917168 gbgss15.seq
2045398 gbgss150.seq
499997382 gbgss151.seq
499998165 gbgss152.seq
499998480 gbgss153.seq
499997367 gbgss154.seq
6835799 gbgss155.seq
373479493 gbgss156.seq
499998266 gbgss157.seq
499997530 gbgss158.seq
499998707 gbgss159.seq
499997659 gbgss16.seq
455712434 gbgss160.seq
499997803 gbgss161.seq
499999324 gbgss162.seq
499998852 gbgss163.seq
456490124 gbgss164.seq
499997998 gbgss165.seq
499999955 gbgss166.seq
499998714 gbgss167.seq
456858700 gbgss168.seq
499998620 gbgss169.seq
499998184 gbgss17.seq
499999142 gbgss170.seq
499999865 gbgss171.seq
363941024 gbgss172.seq
500000047 gbgss173.seq
500000133 gbgss174.seq
215779044 gbgss175.seq
500000172 gbgss176.seq
499998443 gbgss177.seq
67688415 gbgss178.seq
499999079 gbgss179.seq
499999310 gbgss18.seq
499999336 gbgss180.seq
499998518 gbgss181.seq
499999975 gbgss182.seq
49671428 gbgss183.seq
500000207 gbgss184.seq
499998668 gbgss185.seq
499998448 gbgss186.seq
500000134 gbgss187.seq
41156795 gbgss188.seq
499999015 gbgss189.seq
482990292 gbgss19.seq
499999289 gbgss190.seq
23962516 gbgss191.seq
499998791 gbgss192.seq
499996639 gbgss193.seq
499997685 gbgss194.seq
496087090 gbgss195.seq
499999000 gbgss196.seq
499999717 gbgss197.seq
499997511 gbgss198.seq
499999779 gbgss199.seq
499996429 gbgss2.seq
499999447 gbgss20.seq
55740343 gbgss200.seq
499998159 gbgss201.seq
499999372 gbgss202.seq
499999236 gbgss203.seq
480794865 gbgss204.seq
499999696 gbgss205.seq
499998040 gbgss206.seq
55217889 gbgss207.seq
499999671 gbgss208.seq
499999336 gbgss209.seq
326438013 gbgss21.seq
499999851 gbgss210.seq
483100976 gbgss211.seq
499999165 gbgss212.seq
500000241 gbgss213.seq
499998777 gbgss214.seq
499997739 gbgss215.seq
31438 gbgss216.seq
499998512 gbgss217.seq
499999622 gbgss218.seq
499998482 gbgss219.seq
499996936 gbgss22.seq
475058258 gbgss220.seq
499999825 gbgss221.seq
499997013 gbgss222.seq
499997622 gbgss223.seq
6323878 gbgss224.seq
499999723 gbgss225.seq
499999684 gbgss226.seq
499998774 gbgss227.seq
264586823 gbgss228.seq
499998477 gbgss229.seq
499999113 gbgss23.seq
500000259 gbgss230.seq
499998344 gbgss231.seq
429755296 gbgss232.seq
499998680 gbgss233.seq
499997883 gbgss234.seq
499999992 gbgss235.seq
471956638 gbgss236.seq
499999119 gbgss237.seq
499999463 gbgss238.seq
499997873 gbgss239.seq
499998813 gbgss24.seq
419058265 gbgss240.seq
499998792 gbgss241.seq
499998663 gbgss242.seq
499997808 gbgss243.seq
499998922 gbgss244.seq
17836299 gbgss245.seq
315572447 gbgss246.seq
499997744 gbgss247.seq
499999025 gbgss248.seq
499998492 gbgss249.seq
499999856 gbgss25.seq
467298948 gbgss250.seq
499998875 gbgss251.seq
499997169 gbgss252.seq
499998873 gbgss253.seq
499997827 gbgss254.seq
36132488 gbgss255.seq
499998608 gbgss256.seq
499999218 gbgss257.seq
499998113 gbgss258.seq
499998912 gbgss259.seq
49836535 gbgss26.seq
22042461 gbgss260.seq
499999951 gbgss261.seq
499999217 gbgss262.seq
499998742 gbgss263.seq
2065681 gbgss264.seq
499998420 gbgss265.seq
499998781 gbgss266.seq
499999300 gbgss267.seq
498278800 gbgss268.seq
499999723 gbgss269.seq
499998255 gbgss27.seq
499999571 gbgss270.seq
472111367 gbgss271.seq
499997017 gbgss28.seq
499996649 gbgss29.seq
499996818 gbgss3.seq
499998291 gbgss30.seq
31243183 gbgss31.seq
499998298 gbgss32.seq
499999440 gbgss33.seq
500000153 gbgss34.seq
475296111 gbgss35.seq
499997988 gbgss36.seq
499998016 gbgss37.seq
499998968 gbgss38.seq
499998789 gbgss39.seq
499999484 gbgss4.seq
12457092 gbgss40.seq
499998729 gbgss41.seq
499997515 gbgss42.seq
168546271 gbgss43.seq
499997525 gbgss44.seq
499997753 gbgss45.seq
499999140 gbgss46.seq
486883580 gbgss47.seq
499998195 gbgss48.seq
499997635 gbgss49.seq
41480505 gbgss5.seq
499997904 gbgss50.seq
443945964 gbgss51.seq
499998446 gbgss52.seq
500000163 gbgss53.seq
499998431 gbgss54.seq
421055741 gbgss55.seq
499998235 gbgss56.seq
499999740 gbgss57.seq
500000154 gbgss58.seq
427947379 gbgss59.seq
499999218 gbgss6.seq
67665344 gbgss60.seq
499997014 gbgss61.seq
499997577 gbgss62.seq
499999370 gbgss63.seq
492411995 gbgss64.seq
499999868 gbgss65.seq
499998563 gbgss66.seq
499998282 gbgss67.seq
499998811 gbgss68.seq
2280772 gbgss69.seq
499997518 gbgss7.seq
500000229 gbgss70.seq
499999619 gbgss71.seq
500000260 gbgss72.seq
419366282 gbgss73.seq
500000010 gbgss74.seq
499997041 gbgss75.seq
499997295 gbgss76.seq
34859199 gbgss77.seq
499997046 gbgss78.seq
499999706 gbgss79.seq
499999105 gbgss8.seq
500000037 gbgss80.seq
490123040 gbgss81.seq
499999721 gbgss82.seq
499998812 gbgss83.seq
499999829 gbgss84.seq
500000104 gbgss85.seq
4027535 gbgss86.seq
499999082 gbgss87.seq
499999236 gbgss88.seq
499999212 gbgss89.seq
499998511 gbgss9.seq
499997858 gbgss90.seq
30679057 gbgss91.seq
499998289 gbgss92.seq
499998886 gbgss93.seq
499998172 gbgss94.seq
465185709 gbgss95.seq
244248654 gbgss96.seq
499999492 gbgss97.seq
499998457 gbgss98.seq
500000176 gbgss99.seq
499999046 gbhtc1.seq
499988632 gbhtc2.seq
499995070 gbhtc3.seq
331480491 gbhtc4.seq
499997830 gbhtc5.seq
439766319 gbhtc6.seq
499999692 gbhtc7.seq
213519799 gbhtc8.seq
499949323 gbhtg1.seq
499980488 gbhtg10.seq
485100216 gbhtg11.seq
499977040 gbhtg12.seq
499847878 gbhtg13.seq
499963905 gbhtg14.seq
499701543 gbhtg15.seq
474637795 gbhtg16.seq
499709797 gbhtg17.seq
499810685 gbhtg18.seq
499965489 gbhtg19.seq
499847286 gbhtg2.seq
499990701 gbhtg20.seq
473198722 gbhtg21.seq
499919006 gbhtg22.seq
499967880 gbhtg23.seq
499100457 gbhtg24.seq
499962931 gbhtg25.seq
484453569 gbhtg26.seq
499959716 gbhtg27.seq
499868009 gbhtg28.seq
268058563 gbhtg29.seq
499869335 gbhtg3.seq
499922791 gbhtg30.seq
499807238 gbhtg31.seq
224934479 gbhtg32.seq
499945565 gbhtg33.seq
499927151 gbhtg34.seq
265477063 gbhtg35.seq
499867320 gbhtg36.seq
499972802 gbhtg37.seq
223152146 gbhtg38.seq
499806592 gbhtg39.seq
499846790 gbhtg4.seq
499974839 gbhtg40.seq
234952918 gbhtg41.seq
499825905 gbhtg42.seq
499886151 gbhtg43.seq
202125817 gbhtg44.seq
499805593 gbhtg45.seq
499927302 gbhtg46.seq
205797145 gbhtg47.seq
499976951 gbhtg48.seq
499932272 gbhtg49.seq
499934567 gbhtg5.seq
193865096 gbhtg50.seq
499927926 gbhtg51.seq
499933183 gbhtg52.seq
161356215 gbhtg53.seq
499991294 gbhtg54.seq
499991025 gbhtg55.seq
252731163 gbhtg56.seq
499944125 gbhtg57.seq
499990303 gbhtg58.seq
499843154 gbhtg59.seq
507366 gbhtg6.seq
167235113 gbhtg60.seq
499934810 gbhtg61.seq
499926029 gbhtg62.seq
499881289 gbhtg63.seq
468570824 gbhtg64.seq
499882387 gbhtg65.seq
499975194 gbhtg66.seq
499952537 gbhtg67.seq
499955759 gbhtg68.seq
499868574 gbhtg69.seq
499821808 gbhtg7.seq
417842631 gbhtg70.seq
499740705 gbhtg71.seq
499822035 gbhtg72.seq
385408676 gbhtg73.seq
499947980 gbhtg74.seq
499966173 gbhtg75.seq
383565091 gbhtg76.seq
499960780 gbhtg77.seq
499985240 gbhtg78.seq
499783914 gbhtg79.seq
499933840 gbhtg8.seq
499757763 gbhtg80.seq
499913098 gbhtg81.seq
275364943 gbhtg82.seq
499899726 gbhtg9.seq
499858391 gbinv1.seq
490451259 gbinv10.seq
499998931 gbinv100.seq
499996931 gbinv101.seq
116386205 gbinv102.seq
499996961 gbinv103.seq
499998121 gbinv104.seq
406836086 gbinv105.seq
499998089 gbinv106.seq
499999952 gbinv107.seq
181343003 gbinv108.seq
499998732 gbinv109.seq
491062219 gbinv11.seq
499999685 gbinv110.seq
119531179 gbinv111.seq
499997267 gbinv112.seq
499998382 gbinv113.seq
150662273 gbinv114.seq
499998691 gbinv115.seq
499999552 gbinv116.seq
158815231 gbinv117.seq
500000222 gbinv118.seq
499996749 gbinv119.seq
469688374 gbinv12.seq
194287684 gbinv120.seq
499997726 gbinv121.seq
499998194 gbinv122.seq
248698468 gbinv123.seq
499997511 gbinv124.seq
499999405 gbinv125.seq
499998282 gbinv126.seq
499998881 gbinv127.seq
40783773 gbinv128.seq
499999374 gbinv129.seq
485523455 gbinv13.seq
455573372 gbinv130.seq
289072818 gbinv131.seq
54983087 gbinv132.seq
52942591 gbinv133.seq
157105258 gbinv134.seq
499999159 gbinv135.seq
268190266 gbinv136.seq
499996088 gbinv137.seq
499997883 gbinv138.seq
182060786 gbinv139.seq
174159504 gbinv14.seq
499194794 gbinv140.seq
499850171 gbinv141.seq
498733817 gbinv142.seq
135334814 gbinv143.seq
496683125 gbinv144.seq
51960557 gbinv145.seq
466571787 gbinv146.seq
479577598 gbinv147.seq
450565055 gbinv148.seq
482003105 gbinv149.seq
486730694 gbinv15.seq
121049467 gbinv150.seq
494590358 gbinv151.seq
499153426 gbinv152.seq
498623791 gbinv153.seq
70591482 gbinv154.seq
872662073 gbinv155.seq
815663159 gbinv156.seq
813528097 gbinv157.seq
780491774 gbinv158.seq
734904723 gbinv159.seq
481403838 gbinv16.seq
816941878 gbinv160.seq
452891562 gbinv161.seq
480839037 gbinv162.seq
375796220 gbinv163.seq
499933503 gbinv164.seq
485386314 gbinv165.seq
485283938 gbinv166.seq
498294953 gbinv167.seq
414580638 gbinv168.seq
498679440 gbinv169.seq
499418028 gbinv17.seq
495007238 gbinv170.seq
486086193 gbinv171.seq
483986740 gbinv172.seq
479016567 gbinv173.seq
377180280 gbinv174.seq
491313703 gbinv175.seq
482991950 gbinv176.seq
495169229 gbinv177.seq
493741890 gbinv178.seq
495500028 gbinv179.seq
414205609 gbinv18.seq
371035005 gbinv180.seq
470293000 gbinv181.seq
496252830 gbinv182.seq
496286826 gbinv183.seq
472374759 gbinv184.seq
493442600 gbinv185.seq
418565417 gbinv186.seq
493154076 gbinv187.seq
491119641 gbinv188.seq
465656312 gbinv189.seq
105599970 gbinv19.seq
490891118 gbinv190.seq
459581775 gbinv191.seq
406078142 gbinv192.seq
476900813 gbinv193.seq
481848725 gbinv194.seq
496747706 gbinv195.seq
492742184 gbinv196.seq
496271174 gbinv197.seq
392139815 gbinv198.seq
496951694 gbinv199.seq
456567720 gbinv2.seq
305989097 gbinv20.seq
492317100 gbinv200.seq
475960728 gbinv201.seq
498250544 gbinv202.seq
496664285 gbinv203.seq
351267284 gbinv204.seq
454438248 gbinv205.seq
490109816 gbinv206.seq
477775507 gbinv207.seq
497117087 gbinv208.seq
273421111 gbinv209.seq
499447601 gbinv21.seq
484546259 gbinv210.seq
486200140 gbinv211.seq
489013669 gbinv212.seq
499892182 gbinv213.seq
389960712 gbinv214.seq
230763287 gbinv215.seq
433765668 gbinv216.seq
341801067 gbinv217.seq
488714019 gbinv218.seq
442232047 gbinv219.seq
331575178 gbinv22.seq
499337802 gbinv220.seq
498884573 gbinv221.seq
192430563 gbinv222.seq
499999205 gbinv223.seq
499998531 gbinv224.seq
274539625 gbinv225.seq
499998297 gbinv226.seq
499998249 gbinv227.seq
203846135 gbinv228.seq
499996485 gbinv229.seq
409329256 gbinv23.seq
499996906 gbinv230.seq
271975601 gbinv231.seq
499997371 gbinv232.seq
499986789 gbinv233.seq
321258954 gbinv234.seq
499997812 gbinv235.seq
499879420 gbinv236.seq
499911221 gbinv237.seq
433566814 gbinv238.seq
499999353 gbinv239.seq
337324220 gbinv24.seq
499954513 gbinv240.seq
394313230 gbinv241.seq
499999746 gbinv242.seq
499862404 gbinv243.seq
499942773 gbinv244.seq
261894712 gbinv245.seq
499489044 gbinv246.seq
499984461 gbinv247.seq
499999178 gbinv248.seq
219010924 gbinv249.seq
416902989 gbinv25.seq
499665286 gbinv250.seq
499954794 gbinv251.seq
499986274 gbinv252.seq
349517342 gbinv253.seq
500000137 gbinv254.seq
499979428 gbinv255.seq
499915813 gbinv256.seq
499990759 gbinv257.seq
499998437 gbinv258.seq
7826534 gbinv259.seq
480340526 gbinv26.seq
499999636 gbinv260.seq
499704487 gbinv261.seq
499897338 gbinv262.seq
499999895 gbinv263.seq
68002970 gbinv264.seq
499977802 gbinv265.seq
499904157 gbinv266.seq
499970007 gbinv267.seq
499999529 gbinv268.seq
499940074 gbinv269.seq
470719972 gbinv27.seq
122380920 gbinv270.seq
500000224 gbinv271.seq
499999552 gbinv272.seq
468683478 gbinv273.seq
499670167 gbinv274.seq
499934229 gbinv275.seq
499999149 gbinv276.seq
497905608 gbinv277.seq
256173990 gbinv278.seq
481046566 gbinv279.seq
478012779 gbinv28.seq
450037909 gbinv280.seq
303709221 gbinv281.seq
293452060 gbinv282.seq
280090041 gbinv283.seq
279807726 gbinv284.seq
274554532 gbinv285.seq
266890122 gbinv286.seq
491295946 gbinv287.seq
418047779 gbinv288.seq
383074444 gbinv289.seq
372274412 gbinv29.seq
489267373 gbinv290.seq
393039367 gbinv291.seq
484538369 gbinv292.seq
482310364 gbinv293.seq
491415359 gbinv294.seq
495004950 gbinv295.seq
483971663 gbinv296.seq
495670320 gbinv297.seq
40846857 gbinv298.seq
492571202 gbinv299.seq
499999409 gbinv3.seq
473605830 gbinv30.seq
490206006 gbinv300.seq
445709424 gbinv301.seq
207302902 gbinv302.seq
370283947 gbinv303.seq
207800719 gbinv304.seq
403111025 gbinv305.seq
496928255 gbinv306.seq
495982788 gbinv307.seq
486335901 gbinv308.seq
491884209 gbinv309.seq
476844427 gbinv31.seq
62681775 gbinv310.seq
487678296 gbinv311.seq
495933337 gbinv312.seq
497117994 gbinv313.seq
485878834 gbinv314.seq
336958408 gbinv315.seq
470338855 gbinv316.seq
473857916 gbinv317.seq
488417194 gbinv318.seq
472996654 gbinv319.seq
487947504 gbinv32.seq
444602917 gbinv320.seq
489109149 gbinv321.seq
489050792 gbinv322.seq
492903374 gbinv323.seq
464570821 gbinv324.seq
389647411 gbinv325.seq
499026549 gbinv326.seq
459754874 gbinv327.seq
457336109 gbinv328.seq
468059342 gbinv329.seq
499999792 gbinv33.seq
487547225 gbinv330.seq
494629437 gbinv331.seq
499369066 gbinv332.seq
425865049 gbinv333.seq
447701977 gbinv334.seq
471356977 gbinv335.seq
106487756 gbinv336.seq
494432647 gbinv337.seq
499096313 gbinv338.seq
174717833 gbinv339.seq
242253277 gbinv34.seq
439432672 gbinv340.seq
315017082 gbinv341.seq
247279447 gbinv342.seq
493106968 gbinv343.seq
482399453 gbinv344.seq
487563600 gbinv345.seq
495047837 gbinv346.seq
345419513 gbinv347.seq
499133273 gbinv348.seq
496482189 gbinv349.seq
499996230 gbinv35.seq
369581646 gbinv350.seq
456145557 gbinv351.seq
200285196 gbinv352.seq
495154413 gbinv353.seq
341654330 gbinv354.seq
336683654 gbinv355.seq
493060580 gbinv356.seq
107491235 gbinv357.seq
487968866 gbinv358.seq
495757046 gbinv359.seq
407746068 gbinv36.seq
481723089 gbinv360.seq
326169629 gbinv361.seq
485888763 gbinv362.seq
492821648 gbinv363.seq
471307712 gbinv364.seq
311911756 gbinv365.seq
499380148 gbinv366.seq
482084817 gbinv367.seq
479662419 gbinv368.seq
363343706 gbinv369.seq
497711292 gbinv37.seq
489746713 gbinv370.seq
499514774 gbinv371.seq
496438512 gbinv372.seq
492580046 gbinv373.seq
486835968 gbinv374.seq
496102227 gbinv375.seq
476044151 gbinv376.seq
496141646 gbinv377.seq
481981378 gbinv378.seq
343407139 gbinv379.seq
491635530 gbinv38.seq
493089306 gbinv380.seq
490891004 gbinv381.seq
498098866 gbinv382.seq
498391562 gbinv383.seq
493309215 gbinv384.seq
324291471 gbinv385.seq
484493924 gbinv386.seq
491069771 gbinv387.seq
494055574 gbinv388.seq
235593723 gbinv389.seq
468890973 gbinv39.seq
319983008 gbinv390.seq
484241023 gbinv391.seq
216170369 gbinv392.seq
218804026 gbinv393.seq
336455655 gbinv394.seq
297857601 gbinv395.seq
477593708 gbinv396.seq
493171167 gbinv397.seq
96653657 gbinv398.seq
401450903 gbinv399.seq
498399045 gbinv4.seq
480508090 gbinv40.seq
471214414 gbinv400.seq
478230772 gbinv401.seq
481554780 gbinv402.seq
119372855 gbinv403.seq
489114034 gbinv404.seq
418974457 gbinv405.seq
492119058 gbinv406.seq
488068826 gbinv407.seq
86400276 gbinv408.seq
475977385 gbinv409.seq
96954549 gbinv41.seq
479046564 gbinv410.seq
91925882 gbinv411.seq
498866242 gbinv412.seq
475446584 gbinv413.seq
492109157 gbinv414.seq
493644048 gbinv415.seq
450867996 gbinv416.seq
491759397 gbinv417.seq
84745739 gbinv418.seq
423732674 gbinv419.seq
495716316 gbinv42.seq
344360076 gbinv420.seq
487664553 gbinv421.seq
481798385 gbinv422.seq
419437489 gbinv423.seq
447480354 gbinv424.seq
458542150 gbinv425.seq
84187054 gbinv426.seq
476248749 gbinv427.seq
482272438 gbinv428.seq
498234741 gbinv429.seq
459725126 gbinv43.seq
471043224 gbinv430.seq
136592520 gbinv431.seq
495120952 gbinv432.seq
498047113 gbinv433.seq
493290837 gbinv434.seq
467611623 gbinv435.seq
464868282 gbinv436.seq
485108715 gbinv437.seq
70627368 gbinv438.seq
444909632 gbinv439.seq
481987024 gbinv44.seq
457689916 gbinv440.seq
485064135 gbinv441.seq
496105931 gbinv442.seq
484290465 gbinv443.seq
248432863 gbinv444.seq
413526452 gbinv445.seq
438000207 gbinv446.seq
487748206 gbinv447.seq
498657774 gbinv448.seq
447485275 gbinv449.seq
494130818 gbinv45.seq
352564218 gbinv450.seq
457737190 gbinv451.seq
480925976 gbinv452.seq
482363288 gbinv453.seq
490058774 gbinv454.seq
457330992 gbinv455.seq
213313220 gbinv456.seq
475683221 gbinv457.seq
491956738 gbinv458.seq
488287391 gbinv459.seq
170883604 gbinv46.seq
486753557 gbinv460.seq
471704294 gbinv461.seq
318129970 gbinv462.seq
469807657 gbinv463.seq
497173372 gbinv464.seq
486068129 gbinv465.seq
497761269 gbinv466.seq
483771794 gbinv467.seq
208973524 gbinv468.seq
482555865 gbinv469.seq
473738127 gbinv47.seq
489387386 gbinv470.seq
174750473 gbinv471.seq
520668510 gbinv472.seq
439679373 gbinv473.seq
76608705 gbinv474.seq
544459462 gbinv475.seq
291577871 gbinv476.seq
499183575 gbinv477.seq
449457164 gbinv478.seq
403099826 gbinv479.seq
489724528 gbinv48.seq
426341523 gbinv480.seq
452289588 gbinv481.seq
332054885 gbinv482.seq
216067190 gbinv483.seq
363589631 gbinv484.seq
349108462 gbinv485.seq
466080521 gbinv486.seq
433540622 gbinv487.seq
325359681 gbinv488.seq
414134794 gbinv489.seq
481853019 gbinv49.seq
443362325 gbinv490.seq
458657490 gbinv491.seq
469667434 gbinv492.seq
275644987 gbinv493.seq
446552014 gbinv494.seq
480169917 gbinv495.seq
474041236 gbinv496.seq
439739678 gbinv497.seq
415879374 gbinv498.seq
467640011 gbinv499.seq
187365363 gbinv5.seq
480574803 gbinv50.seq
312202242 gbinv500.seq
476756260 gbinv501.seq
477060782 gbinv502.seq
483680820 gbinv503.seq
495487713 gbinv504.seq
69234679 gbinv505.seq
477792636 gbinv506.seq
492711094 gbinv507.seq
478184643 gbinv508.seq
492947595 gbinv509.seq
175801402 gbinv51.seq
116672197 gbinv510.seq
483642314 gbinv511.seq
482127664 gbinv512.seq
470874419 gbinv513.seq
495029558 gbinv514.seq
99065870 gbinv515.seq
477953618 gbinv516.seq
452659060 gbinv517.seq
467009813 gbinv518.seq
470035266 gbinv519.seq
495890984 gbinv52.seq
255630047 gbinv520.seq
496825048 gbinv521.seq
457058797 gbinv522.seq
475749694 gbinv523.seq
458940745 gbinv524.seq
478290025 gbinv525.seq
201201186 gbinv526.seq
476458381 gbinv527.seq
472367130 gbinv528.seq
491955676 gbinv529.seq
496714825 gbinv53.seq
445112147 gbinv530.seq
478746373 gbinv531.seq
213103145 gbinv532.seq
426002666 gbinv533.seq
491306479 gbinv534.seq
485922068 gbinv535.seq
470774965 gbinv536.seq
259886438 gbinv537.seq
323358243 gbinv538.seq
292361181 gbinv539.seq
484083642 gbinv54.seq
472027339 gbinv540.seq
394618639 gbinv541.seq
498685113 gbinv542.seq
252840705 gbinv543.seq
409818882 gbinv544.seq
483153478 gbinv545.seq
356373687 gbinv546.seq
382117771 gbinv547.seq
414986838 gbinv548.seq
358562967 gbinv549.seq
472142528 gbinv55.seq
454612949 gbinv550.seq
397094236 gbinv551.seq
472022816 gbinv552.seq
375604154 gbinv553.seq
260058125 gbinv554.seq
416870448 gbinv555.seq
337551656 gbinv556.seq
323476118 gbinv557.seq
316192878 gbinv558.seq
453222939 gbinv559.seq
487970520 gbinv56.seq
473212643 gbinv57.seq
119585423 gbinv58.seq
483414567 gbinv59.seq
497541920 gbinv6.seq
490356175 gbinv60.seq
487648025 gbinv61.seq
482729413 gbinv62.seq
499998456 gbinv63.seq
421465496 gbinv64.seq
485226384 gbinv65.seq
497791713 gbinv66.seq
492273364 gbinv67.seq
493650304 gbinv68.seq
319411371 gbinv69.seq
476459766 gbinv7.seq
495485825 gbinv70.seq
496723738 gbinv71.seq
492757167 gbinv72.seq
483899600 gbinv73.seq
478256052 gbinv74.seq
492780856 gbinv75.seq
499976011 gbinv76.seq
498322007 gbinv77.seq
483551082 gbinv78.seq
444438685 gbinv79.seq
422534062 gbinv8.seq
483770017 gbinv80.seq
493575935 gbinv81.seq
498159916 gbinv82.seq
461241054 gbinv83.seq
429126368 gbinv84.seq
472254506 gbinv85.seq
487388601 gbinv86.seq
488620999 gbinv87.seq
492386441 gbinv88.seq
410012641 gbinv89.seq
173964303 gbinv9.seq
489753781 gbinv90.seq
486907886 gbinv91.seq
475277293 gbinv92.seq
499301158 gbinv93.seq
356777677 gbinv94.seq
461771502 gbinv95.seq
479426528 gbinv96.seq
494640586 gbinv97.seq
328489972 gbinv98.seq
484117250 gbinv99.seq
499997277 gbmam1.seq
82799226 gbmam10.seq
483844712 gbmam100.seq
437064425 gbmam101.seq
223540742 gbmam102.seq
451994163 gbmam103.seq
449442494 gbmam104.seq
428332107 gbmam105.seq
498157348 gbmam106.seq
315414537 gbmam107.seq
227944315 gbmam108.seq
348089742 gbmam109.seq
71269620 gbmam11.seq
373183698 gbmam110.seq
467160879 gbmam111.seq
457054238 gbmam112.seq
483676806 gbmam113.seq
409916232 gbmam114.seq
398303012 gbmam115.seq
346294509 gbmam116.seq
274828735 gbmam117.seq
266926537 gbmam118.seq
442156114 gbmam119.seq
22560541 gbmam12.seq
394957309 gbmam120.seq
359858922 gbmam121.seq
441833211 gbmam122.seq
467877002 gbmam123.seq
460913003 gbmam124.seq
218289169 gbmam125.seq
1268288 gbmam13.seq
378312043 gbmam14.seq
338653928 gbmam15.seq
477859984 gbmam16.seq
445458565 gbmam17.seq
122412952 gbmam18.seq
451114191 gbmam19.seq
399221511 gbmam2.seq
418062936 gbmam20.seq
499818179 gbmam21.seq
462376348 gbmam22.seq
370510647 gbmam23.seq
446296416 gbmam24.seq
431104435 gbmam25.seq
480602942 gbmam26.seq
479109855 gbmam27.seq
483903273 gbmam28.seq
483307002 gbmam29.seq
400559326 gbmam3.seq
48405032 gbmam30.seq
363174382 gbmam31.seq
437246747 gbmam32.seq
470828962 gbmam33.seq
402408906 gbmam34.seq
304109928 gbmam35.seq
452443739 gbmam36.seq
451303958 gbmam37.seq
495648598 gbmam38.seq
405636626 gbmam39.seq
477148353 gbmam4.seq
410457734 gbmam40.seq
441553748 gbmam41.seq
367146984 gbmam42.seq
478421809 gbmam43.seq
316388332 gbmam44.seq
352226884 gbmam45.seq
195247700 gbmam46.seq
474022452 gbmam47.seq
378020853 gbmam48.seq
450136561 gbmam49.seq
374653134 gbmam5.seq
450750944 gbmam50.seq
468132660 gbmam51.seq
374896619 gbmam52.seq
9943400 gbmam53.seq
43988539 gbmam54.seq
91321391 gbmam55.seq
88809601 gbmam56.seq
6363419 gbmam57.seq
20916880 gbmam58.seq
449460983 gbmam59.seq
487713568 gbmam6.seq
423544499 gbmam60.seq
453840584 gbmam61.seq
491149506 gbmam62.seq
425479852 gbmam63.seq
461110029 gbmam64.seq
385606603 gbmam65.seq
489901313 gbmam66.seq
499997943 gbmam67.seq
499998477 gbmam68.seq
18333947 gbmam69.seq
401181424 gbmam7.seq
907465328 gbmam70.seq
839494897 gbmam71.seq
774395849 gbmam72.seq
588873740 gbmam73.seq
364960392 gbmam74.seq
428298067 gbmam75.seq
283039896 gbmam76.seq
266822121 gbmam77.seq
255007049 gbmam78.seq
250435254 gbmam79.seq
435129139 gbmam8.seq
405637142 gbmam80.seq
372091504 gbmam81.seq
465555603 gbmam82.seq
444923782 gbmam83.seq
341582143 gbmam84.seq
257946240 gbmam85.seq
485829704 gbmam86.seq
486026993 gbmam87.seq
483298905 gbmam88.seq
494677523 gbmam89.seq
275778831 gbmam9.seq
335874920 gbmam90.seq
464872853 gbmam91.seq
468294587 gbmam92.seq
497569809 gbmam93.seq
377746247 gbmam94.seq
460747191 gbmam95.seq
150130543 gbmam96.seq
416665240 gbmam97.seq
456214449 gbmam98.seq
486132452 gbmam99.seq
28576326 gbnew.txt
499999220 gbpat1.seq
499999978 gbpat10.seq
499999036 gbpat100.seq
499999497 gbpat101.seq
499997525 gbpat102.seq
228719622 gbpat103.seq
500000251 gbpat104.seq
500000174 gbpat105.seq
499999692 gbpat106.seq
335265882 gbpat107.seq
499996953 gbpat108.seq
499999070 gbpat109.seq
499998690 gbpat11.seq
210146417 gbpat110.seq
499916752 gbpat111.seq
499997067 gbpat112.seq
174107225 gbpat113.seq
499998802 gbpat114.seq
499999706 gbpat115.seq
499994085 gbpat116.seq
8731691 gbpat117.seq
499732031 gbpat118.seq
382810469 gbpat119.seq
179211004 gbpat12.seq
499998267 gbpat120.seq
499997326 gbpat121.seq
499992723 gbpat122.seq
500000027 gbpat123.seq
56335450 gbpat124.seq
499968107 gbpat125.seq
499998772 gbpat126.seq
208443590 gbpat127.seq
500000091 gbpat128.seq
499999529 gbpat129.seq
499973182 gbpat13.seq
59337288 gbpat130.seq
499999029 gbpat131.seq
499996720 gbpat132.seq
488775041 gbpat133.seq
499998943 gbpat134.seq
500000136 gbpat135.seq
28344057 gbpat136.seq
500000028 gbpat137.seq
385112249 gbpat138.seq
499999557 gbpat139.seq
499999905 gbpat14.seq
500000185 gbpat140.seq
148508498 gbpat141.seq
500000167 gbpat142.seq
314545298 gbpat143.seq
499988381 gbpat144.seq
499980283 gbpat145.seq
409538104 gbpat146.seq
500000154 gbpat147.seq
499986801 gbpat148.seq
125987771 gbpat149.seq
62756651 gbpat15.seq
499989559 gbpat150.seq
500000025 gbpat151.seq
499998857 gbpat152.seq
499997730 gbpat153.seq
169881826 gbpat154.seq
499998731 gbpat155.seq
425352131 gbpat156.seq
499999323 gbpat157.seq
499999842 gbpat158.seq
499923909 gbpat159.seq
499999496 gbpat16.seq
353558255 gbpat160.seq
499999833 gbpat161.seq
499998766 gbpat162.seq
291165967 gbpat163.seq
499999445 gbpat164.seq
499998862 gbpat165.seq
499999355 gbpat166.seq
102920462 gbpat167.seq
499994411 gbpat168.seq
499999159 gbpat169.seq
499999402 gbpat17.seq
499997606 gbpat170.seq
499999511 gbpat171.seq
301687777 gbpat172.seq
499999222 gbpat173.seq
499999428 gbpat174.seq
499999912 gbpat175.seq
319825744 gbpat176.seq
499602681 gbpat177.seq
499998954 gbpat178.seq
499999721 gbpat179.seq
422008923 gbpat18.seq
13212105 gbpat180.seq
497266538 gbpat181.seq
499998935 gbpat182.seq
499999679 gbpat183.seq
86834850 gbpat184.seq
499930262 gbpat185.seq
499999973 gbpat186.seq
499998082 gbpat187.seq
39745949 gbpat188.seq
499259794 gbpat189.seq
499921196 gbpat19.seq
499999853 gbpat190.seq
499999544 gbpat191.seq
500000004 gbpat192.seq
96573497 gbpat193.seq
499880980 gbpat194.seq
499997530 gbpat195.seq
499999338 gbpat196.seq
500000166 gbpat197.seq
90172314 gbpat198.seq
499993385 gbpat199.seq
499999788 gbpat2.seq
499998533 gbpat20.seq
499994277 gbpat200.seq
499998512 gbpat201.seq
499999457 gbpat202.seq
4092526 gbpat203.seq
499999756 gbpat204.seq
499999459 gbpat205.seq
500000244 gbpat206.seq
478202129 gbpat207.seq
500000054 gbpat208.seq
499999577 gbpat209.seq
499991294 gbpat21.seq
321705067 gbpat210.seq
499991396 gbpat211.seq
499963719 gbpat212.seq
350635988 gbpat213.seq
497506292 gbpat214.seq
499869540 gbpat215.seq
421452571 gbpat216.seq
499425936 gbpat217.seq
499999361 gbpat218.seq
336263474 gbpat219.seq
347812817 gbpat22.seq
499998549 gbpat220.seq
500000173 gbpat221.seq
499999375 gbpat222.seq
361391353 gbpat223.seq
499999662 gbpat224.seq
494515367 gbpat225.seq
341868206 gbpat226.seq
499999744 gbpat227.seq
500000159 gbpat228.seq
366896749 gbpat229.seq
499893011 gbpat23.seq
499999946 gbpat230.seq
499335751 gbpat231.seq
500000109 gbpat232.seq
499999394 gbpat233.seq
431464852 gbpat234.seq
499998831 gbpat235.seq
499999525 gbpat236.seq
499998698 gbpat237.seq
499999851 gbpat238.seq
83191269 gbpat239.seq
499999752 gbpat24.seq
499999639 gbpat240.seq
499997091 gbpat241.seq
499999375 gbpat242.seq
187729792 gbpat243.seq
500000259 gbpat244.seq
499999167 gbpat245.seq
499999565 gbpat246.seq
419398706 gbpat247.seq
499998352 gbpat25.seq
499999141 gbpat26.seq
165937870 gbpat27.seq
499996900 gbpat28.seq
499999730 gbpat29.seq
61235036 gbpat3.seq
213218489 gbpat30.seq
499999775 gbpat31.seq
406040730 gbpat32.seq
500000138 gbpat33.seq
499999729 gbpat34.seq
126410659 gbpat35.seq
500000124 gbpat36.seq
499999218 gbpat37.seq
500000115 gbpat38.seq
140146491 gbpat39.seq
499999450 gbpat4.seq
499998922 gbpat40.seq
493981981 gbpat41.seq
494767338 gbpat42.seq
499999588 gbpat43.seq
149226143 gbpat44.seq
499999126 gbpat45.seq
499999712 gbpat46.seq
499999244 gbpat47.seq
87865684 gbpat48.seq
499998561 gbpat49.seq
499999637 gbpat5.seq
499999715 gbpat50.seq
499999147 gbpat51.seq
130957592 gbpat52.seq
499999607 gbpat53.seq
499999084 gbpat54.seq
185001858 gbpat55.seq
499999726 gbpat56.seq
499999154 gbpat57.seq
137265710 gbpat58.seq
499998902 gbpat59.seq
419075333 gbpat6.seq
499638184 gbpat60.seq
429855889 gbpat61.seq
499999955 gbpat62.seq
321026556 gbpat63.seq
499999325 gbpat64.seq
499999665 gbpat65.seq
306235164 gbpat66.seq
499999595 gbpat67.seq
499997159 gbpat68.seq
144919043 gbpat69.seq
499998683 gbpat7.seq
499999495 gbpat70.seq
226235202 gbpat71.seq
499942763 gbpat72.seq
500000257 gbpat73.seq
309555677 gbpat74.seq
499990988 gbpat75.seq
499996904 gbpat76.seq
259606120 gbpat77.seq
499998418 gbpat78.seq
499997914 gbpat79.seq
499998063 gbpat8.seq
36785301 gbpat80.seq
500000256 gbpat81.seq
474123180 gbpat82.seq
499999696 gbpat83.seq
331588594 gbpat84.seq
499997471 gbpat85.seq
312032998 gbpat86.seq
499998960 gbpat87.seq
500000168 gbpat88.seq
499997958 gbpat89.seq
317331607 gbpat9.seq
205402638 gbpat90.seq
499999444 gbpat91.seq
455869832 gbpat92.seq
499959698 gbpat93.seq
252286128 gbpat94.seq
499998543 gbpat95.seq
499998869 gbpat96.seq
82959125 gbpat97.seq
499999689 gbpat98.seq
498236426 gbpat99.seq
499886249 gbphg1.seq
499949019 gbphg2.seq
499981595 gbphg3.seq
499804928 gbphg4.seq
423022263 gbphg5.seq
499754441 gbpln1.seq
269118160 gbpln10.seq
498973363 gbpln100.seq
472540038 gbpln101.seq
453105795 gbpln102.seq
445429529 gbpln103.seq
387853287 gbpln104.seq
496158394 gbpln105.seq
499810291 gbpln106.seq
499851118 gbpln107.seq
278684203 gbpln108.seq
489314534 gbpln109.seq
499925274 gbpln11.seq
490138518 gbpln110.seq
499791563 gbpln111.seq
465184010 gbpln112.seq
327453323 gbpln113.seq
499392866 gbpln114.seq
496453930 gbpln115.seq
496535988 gbpln116.seq
479282939 gbpln117.seq
494688464 gbpln118.seq
47626945 gbpln119.seq
498516954 gbpln12.seq
86418 gbpln120.seq
361751 gbpln121.seq
164978328 gbpln122.seq
40086427 gbpln123.seq
74918158 gbpln124.seq
499999482 gbpln125.seq
357959046 gbpln126.seq
499998092 gbpln127.seq
499999630 gbpln128.seq
143918344 gbpln129.seq
469955827 gbpln13.seq
499998945 gbpln130.seq
499511654 gbpln131.seq
499987306 gbpln132.seq
290853743 gbpln133.seq
298765933 gbpln134.seq
211376931 gbpln135.seq
248639874 gbpln136.seq
185681922 gbpln137.seq
997331398 gbpln138.seq
56513612 gbpln139.seq
170594856 gbpln14.seq
487354850 gbpln140.seq
473525596 gbpln141.seq
473209473 gbpln142.seq
467870636 gbpln143.seq
168324953 gbpln144.seq
441980988 gbpln145.seq
460425795 gbpln146.seq
479222672 gbpln147.seq
92564056 gbpln148.seq
609356119 gbpln149.seq
496172808 gbpln15.seq
786074578 gbpln150.seq
733167229 gbpln151.seq
736239733 gbpln152.seq
691575746 gbpln153.seq
660133963 gbpln154.seq
739031764 gbpln155.seq
457972179 gbpln156.seq
425730525 gbpln157.seq
499999859 gbpln158.seq
66306589 gbpln159.seq
478405731 gbpln16.seq
499998298 gbpln160.seq
499998231 gbpln161.seq
272167157 gbpln162.seq
499997664 gbpln163.seq
499999139 gbpln164.seq
94071550 gbpln165.seq
499833238 gbpln166.seq
481540121 gbpln167.seq
499890677 gbpln168.seq
420423613 gbpln169.seq
335223965 gbpln17.seq
499991624 gbpln170.seq
389494435 gbpln171.seq
499999898 gbpln172.seq
499999091 gbpln173.seq
499998299 gbpln174.seq
69260398 gbpln175.seq
499997677 gbpln176.seq
499814493 gbpln177.seq
423033651 gbpln178.seq
499999199 gbpln179.seq
418823303 gbpln18.seq
499762094 gbpln180.seq
499506220 gbpln181.seq
328853429 gbpln182.seq
499834397 gbpln183.seq
491609806 gbpln184.seq
402785639 gbpln185.seq
445924319 gbpln186.seq
499809978 gbpln187.seq
5637088 gbpln188.seq
492242432 gbpln189.seq
499938071 gbpln19.seq
226945063 gbpln190.seq
315788399 gbpln191.seq
665291577 gbpln192.seq
860028189 gbpln193.seq
800605872 gbpln194.seq
794469115 gbpln195.seq
762933697 gbpln196.seq
729969959 gbpln197.seq
808217924 gbpln198.seq
209362395 gbpln199.seq
499937606 gbpln2.seq
176422153 gbpln20.seq
924325157 gbpln200.seq
1201978654 gbpln201.seq
1227268207 gbpln202.seq
1152253241 gbpln203.seq
1115248374 gbpln204.seq
1125506105 gbpln205.seq
1145303472 gbpln206.seq
695608615 gbpln207.seq
494748143 gbpln208.seq
460644363 gbpln209.seq
346140214 gbpln21.seq
152680390 gbpln210.seq
463010270 gbpln211.seq
480459220 gbpln212.seq
494737040 gbpln213.seq
446440740 gbpln214.seq
417743779 gbpln215.seq
250838119 gbpln216.seq
364689197 gbpln217.seq
339196729 gbpln218.seq
386320509 gbpln219.seq
384919629 gbpln22.seq
311828079 gbpln220.seq
213907446 gbpln221.seq
547058897 gbpln222.seq
117077133 gbpln223.seq
485280656 gbpln224.seq
153216335 gbpln225.seq
689933987 gbpln226.seq
887561680 gbpln227.seq
834970472 gbpln228.seq
826391913 gbpln229.seq
205693038 gbpln23.seq
792513917 gbpln230.seq
743209872 gbpln231.seq
833073712 gbpln232.seq
564051 gbpln233.seq
665291577 gbpln234.seq
860028189 gbpln235.seq
800605872 gbpln236.seq
794469115 gbpln237.seq
762933697 gbpln238.seq
729969959 gbpln239.seq
85942713 gbpln24.seq
808217924 gbpln240.seq
189165731 gbpln241.seq
663098252 gbpln242.seq
855592604 gbpln243.seq
807031053 gbpln244.seq
793905039 gbpln245.seq
773303164 gbpln246.seq
718153248 gbpln247.seq
804870210 gbpln248.seq
661762125 gbpln249.seq
477917640 gbpln25.seq
840180304 gbpln250.seq
796430245 gbpln251.seq
779180715 gbpln252.seq
761224530 gbpln253.seq
725380245 gbpln254.seq
792983451 gbpln255.seq
652402241 gbpln256.seq
831209396 gbpln257.seq
783682955 gbpln258.seq
775938782 gbpln259.seq
499902464 gbpln26.seq
741958804 gbpln260.seq
700440901 gbpln261.seq
788705159 gbpln262.seq
683172189 gbpln263.seq
854365289 gbpln264.seq
802776370 gbpln265.seq
793295936 gbpln266.seq
769246264 gbpln267.seq
710912943 gbpln268.seq
799876839 gbpln269.seq
498817673 gbpln27.seq
635039454 gbpln270.seq
824184474 gbpln271.seq
768070182 gbpln272.seq
758956882 gbpln273.seq
732189331 gbpln274.seq
706311232 gbpln275.seq
766293442 gbpln276.seq
651415133 gbpln277.seq
830082304 gbpln278.seq
783385752 gbpln279.seq
323729344 gbpln28.seq
770520351 gbpln280.seq
753421970 gbpln281.seq
699441547 gbpln282.seq
784443196 gbpln283.seq
702337808 gbpln284.seq
906907390 gbpln285.seq
844110716 gbpln286.seq
841780855 gbpln287.seq
805270043 gbpln288.seq
764396863 gbpln289.seq
499081183 gbpln29.seq
841492595 gbpln290.seq
714482811 gbpln291.seq
916127997 gbpln292.seq
858459407 gbpln293.seq
848936990 gbpln294.seq
813129213 gbpln295.seq
765593150 gbpln296.seq
862731158 gbpln297.seq
665885340 gbpln298.seq
629668050 gbpln299.seq
499917074 gbpln3.seq
497391888 gbpln30.seq
814320946 gbpln300.seq
759349720 gbpln301.seq
762512207 gbpln302.seq
724647884 gbpln303.seq
679679449 gbpln304.seq
784312844 gbpln305.seq
684180819 gbpln306.seq
873292213 gbpln307.seq
827422505 gbpln308.seq
815925825 gbpln309.seq
499428080 gbpln31.seq
779009585 gbpln310.seq
739747654 gbpln311.seq
834950434 gbpln312.seq
663096073 gbpln313.seq
849628701 gbpln314.seq
803882830 gbpln315.seq
794420470 gbpln316.seq
760127459 gbpln317.seq
714663802 gbpln318.seq
801095950 gbpln319.seq
103294636 gbpln32.seq
668869887 gbpln320.seq
854770002 gbpln321.seq
805931576 gbpln322.seq
798923954 gbpln323.seq
766411223 gbpln324.seq
723133936 gbpln325.seq
803351408 gbpln326.seq
664176987 gbpln327.seq
854339916 gbpln328.seq
803900400 gbpln329.seq
496566630 gbpln33.seq
791449620 gbpln330.seq
761145205 gbpln331.seq
715062603 gbpln332.seq
806379176 gbpln333.seq
668964953 gbpln334.seq
870939392 gbpln335.seq
809408813 gbpln336.seq
801514137 gbpln337.seq
768794024 gbpln338.seq
723644689 gbpln339.seq
498203430 gbpln34.seq
815153418 gbpln340.seq
661177159 gbpln341.seq
846934671 gbpln342.seq
794708793 gbpln343.seq
789781753 gbpln344.seq
764576068 gbpln345.seq
711115451 gbpln346.seq
797517245 gbpln347.seq
691953899 gbpln348.seq
888406351 gbpln349.seq
349198506 gbpln35.seq
835271741 gbpln350.seq
823533989 gbpln351.seq
787819193 gbpln352.seq
748786657 gbpln353.seq
838184652 gbpln354.seq
488796010 gbpln355.seq
439661491 gbpln356.seq
155752105 gbpln357.seq
758806100 gbpln358.seq
898446949 gbpln359.seq
454048573 gbpln36.seq
628489896 gbpln360.seq
1024113089 gbpln361.seq
1032878661 gbpln362.seq
858694781 gbpln363.seq
960391204 gbpln364.seq
1090094606 gbpln365.seq
781959143 gbpln366.seq
946995961 gbpln367.seq
857542781 gbpln368.seq
656405285 gbpln369.seq
495221947 gbpln37.seq
907889097 gbpln370.seq
896386890 gbpln371.seq
726432335 gbpln372.seq
798296822 gbpln373.seq
918393750 gbpln374.seq
584961784 gbpln375.seq
948865971 gbpln376.seq
954536271 gbpln377.seq
819735731 gbpln378.seq
756588093 gbpln379.seq
382013134 gbpln38.seq
876067119 gbpln380.seq
625446321 gbpln381.seq
977801494 gbpln382.seq
854357980 gbpln383.seq
807732556 gbpln384.seq
947696453 gbpln385.seq
1067629605 gbpln386.seq
822222048 gbpln387.seq
950272996 gbpln388.seq
845138843 gbpln389.seq
498663684 gbpln39.seq
643846993 gbpln390.seq
894745096 gbpln391.seq
893352134 gbpln392.seq
722578984 gbpln393.seq
776227316 gbpln394.seq
899750467 gbpln395.seq
592059964 gbpln396.seq
933986451 gbpln397.seq
939527664 gbpln398.seq
810117922 gbpln399.seq
499976078 gbpln4.seq
471931476 gbpln40.seq
765938558 gbpln400.seq
886537018 gbpln401.seq
623519964 gbpln402.seq
996940649 gbpln403.seq
1030190034 gbpln404.seq
832828033 gbpln405.seq
956342979 gbpln406.seq
1134286144 gbpln407.seq
790513299 gbpln408.seq
944161893 gbpln409.seq
497321365 gbpln41.seq
860035788 gbpln410.seq
647268685 gbpln411.seq
902239623 gbpln412.seq
611029440 gbpln413.seq
734907577 gbpln414.seq
787834228 gbpln415.seq
910724363 gbpln416.seq
606016896 gbpln417.seq
961485234 gbpln418.seq
1242775191 gbpln419.seq
472649861 gbpln42.seq
816670128 gbpln420.seq
636658925 gbpln421.seq
818591771 gbpln422.seq
766580884 gbpln423.seq
752100829 gbpln424.seq
724519993 gbpln425.seq
690955648 gbpln426.seq
769738288 gbpln427.seq
750738544 gbpln428.seq
872184389 gbpln429.seq
478648821 gbpln43.seq
624480879 gbpln430.seq
995069022 gbpln431.seq
1012956234 gbpln432.seq
827074347 gbpln433.seq
940621783 gbpln434.seq
1079418810 gbpln435.seq
776922106 gbpln436.seq
938380968 gbpln437.seq
848757671 gbpln438.seq
643572913 gbpln439.seq
83738365 gbpln44.seq
891714442 gbpln440.seq
878638403 gbpln441.seq
721632671 gbpln442.seq
779156122 gbpln443.seq
895553446 gbpln444.seq
604678568 gbpln445.seq
931006295 gbpln446.seq
933660027 gbpln447.seq
810459540 gbpln448.seq
761872100 gbpln449.seq
494333293 gbpln45.seq
878702815 gbpln450.seq
627081460 gbpln451.seq
994320235 gbpln452.seq
999434327 gbpln453.seq
823789349 gbpln454.seq
945629782 gbpln455.seq
1062113821 gbpln456.seq
792298939 gbpln457.seq
941851700 gbpln458.seq
850142413 gbpln459.seq
475215142 gbpln46.seq
656955691 gbpln460.seq
904094753 gbpln461.seq
900193903 gbpln462.seq
728906821 gbpln463.seq
741172650 gbpln464.seq
898719079 gbpln465.seq
599002526 gbpln466.seq
937117048 gbpln467.seq
936021119 gbpln468.seq
812696702 gbpln469.seq
468208544 gbpln47.seq
746628212 gbpln470.seq
897168807 gbpln471.seq
626698501 gbpln472.seq
1007072101 gbpln473.seq
1000831797 gbpln474.seq
841918855 gbpln475.seq
963426816 gbpln476.seq
1093654114 gbpln477.seq
791118382 gbpln478.seq
959940756 gbpln479.seq
486858437 gbpln48.seq
853263842 gbpln480.seq
648051398 gbpln481.seq
901282075 gbpln482.seq
923491092 gbpln483.seq
732477869 gbpln484.seq
789987733 gbpln485.seq
926022053 gbpln486.seq
610840579 gbpln487.seq
949759032 gbpln488.seq
955444559 gbpln489.seq
272302955 gbpln49.seq
818480442 gbpln490.seq
752251380 gbpln491.seq
897893149 gbpln492.seq
631111272 gbpln493.seq
1022032953 gbpln494.seq
1006306956 gbpln495.seq
837035085 gbpln496.seq
966140819 gbpln497.seq
1090560006 gbpln498.seq
800164754 gbpln499.seq
467908362 gbpln5.seq
172902191 gbpln50.seq
959884028 gbpln500.seq
886916735 gbpln501.seq
641540050 gbpln502.seq
910168783 gbpln503.seq
908785549 gbpln504.seq
729527181 gbpln505.seq
797552105 gbpln506.seq
910975470 gbpln507.seq
616026199 gbpln508.seq
945685366 gbpln509.seq
471233536 gbpln51.seq
953145956 gbpln510.seq
820081609 gbpln511.seq
763165947 gbpln512.seq
870898266 gbpln513.seq
618200825 gbpln514.seq
1009123187 gbpln515.seq
1016689515 gbpln516.seq
832912303 gbpln517.seq
952656374 gbpln518.seq
1065835283 gbpln519.seq
455042321 gbpln52.seq
776075044 gbpln520.seq
935940025 gbpln521.seq
846831932 gbpln522.seq
641399988 gbpln523.seq
892709705 gbpln524.seq
594848385 gbpln525.seq
720169483 gbpln526.seq
780564861 gbpln527.seq
888344689 gbpln528.seq
610800072 gbpln529.seq
488809223 gbpln53.seq
934713391 gbpln530.seq
1233388213 gbpln531.seq
807523234 gbpln532.seq
19542 gbpln533.seq
757881986 gbpln534.seq
889760627 gbpln535.seq
635890046 gbpln536.seq
1007873898 gbpln537.seq
1015524558 gbpln538.seq
836625022 gbpln539.seq
355272263 gbpln54.seq
959076059 gbpln540.seq
1077416379 gbpln541.seq
789416089 gbpln542.seq
958430056 gbpln543.seq
877922843 gbpln544.seq
648665455 gbpln545.seq
907513209 gbpln546.seq
904978028 gbpln547.seq
727024880 gbpln548.seq
789120540 gbpln549.seq
200538454 gbpln55.seq
898507915 gbpln550.seq
617229811 gbpln551.seq
942711764 gbpln552.seq
964780021 gbpln553.seq
818917331 gbpln554.seq
755294557 gbpln555.seq
882064051 gbpln556.seq
627203691 gbpln557.seq
993595919 gbpln558.seq
1021497440 gbpln559.seq
377219536 gbpln56.seq
827286497 gbpln560.seq
962451301 gbpln561.seq
1082256067 gbpln562.seq
781463827 gbpln563.seq
919665368 gbpln564.seq
852133929 gbpln565.seq
645388382 gbpln566.seq
905574854 gbpln567.seq
906714977 gbpln568.seq
718743537 gbpln569.seq
375192640 gbpln57.seq
787529633 gbpln570.seq
910251919 gbpln571.seq
608518276 gbpln572.seq
934541265 gbpln573.seq
954054955 gbpln574.seq
806443717 gbpln575.seq
1009766480 gbpln576.seq
1253136609 gbpln577.seq
1066198175 gbpln578.seq
1119572655 gbpln579.seq
386441749 gbpln58.seq
1040217505 gbpln580.seq
1310077288 gbpln581.seq
955690374 gbpln582.seq
1230684440 gbpln583.seq
1179787958 gbpln584.seq
1125383520 gbpln585.seq
1051194518 gbpln586.seq
965656648 gbpln587.seq
1110281977 gbpln588.seq
32675 gbpln589.seq
482478614 gbpln59.seq
1009766623 gbpln590.seq
1253136752 gbpln591.seq
1066198318 gbpln592.seq
1119572798 gbpln593.seq
1040217648 gbpln594.seq
1310077431 gbpln595.seq
253175482 gbpln596.seq
654245898 gbpln597.seq
843080362 gbpln598.seq
787261705 gbpln599.seq
499997538 gbpln6.seq
473293925 gbpln60.seq
773098599 gbpln600.seq
745082094 gbpln601.seq
711612756 gbpln602.seq
801222610 gbpln603.seq
271464 gbpln604.seq
398651709 gbpln605.seq
315170317 gbpln606.seq
306732013 gbpln607.seq
319872292 gbpln608.seq
286450423 gbpln609.seq
476593700 gbpln61.seq
220883441 gbpln610.seq
470283415 gbpln611.seq
475850186 gbpln612.seq
499131741 gbpln613.seq
460644363 gbpln614.seq
359155255 gbpln615.seq
399402445 gbpln616.seq
501115666 gbpln617.seq
413826113 gbpln618.seq
367000227 gbpln619.seq
434249982 gbpln62.seq
238050627 gbpln620.seq
352241749 gbpln621.seq
298781185 gbpln622.seq
490716477 gbpln623.seq
86107576 gbpln624.seq
9838016 gbpln625.seq
10182575 gbpln626.seq
766528189 gbpln627.seq
422678220 gbpln628.seq
133578941 gbpln629.seq
440487400 gbpln63.seq
756143249 gbpln630.seq
878426054 gbpln631.seq
631056251 gbpln632.seq
993852367 gbpln633.seq
1020132695 gbpln634.seq
830166807 gbpln635.seq
955723315 gbpln636.seq
1057964328 gbpln637.seq
784007552 gbpln638.seq
947940191 gbpln639.seq
444203819 gbpln64.seq
857511193 gbpln640.seq
649137171 gbpln641.seq
903393879 gbpln642.seq
908180396 gbpln643.seq
721135945 gbpln644.seq
786739709 gbpln645.seq
918070756 gbpln646.seq
603192844 gbpln647.seq
938102555 gbpln648.seq
955978436 gbpln649.seq
189178941 gbpln65.seq
813787878 gbpln650.seq
639701128 gbpln651.seq
468547846 gbpln652.seq
499484988 gbpln653.seq
498595765 gbpln654.seq
20796270 gbpln655.seq
768129678 gbpln656.seq
891209633 gbpln657.seq
1017177961 gbpln658.seq
1036708108 gbpln659.seq
460469300 gbpln66.seq
980496603 gbpln660.seq
1096870510 gbpln661.seq
964601805 gbpln662.seq
883690282 gbpln663.seq
879367269 gbpln664.seq
922136688 gbpln665.seq
805432021 gbpln666.seq
912345991 gbpln667.seq
954500353 gbpln668.seq
944560088 gbpln669.seq
440542307 gbpln67.seq
29543156 gbpln670.seq
401682165 gbpln671.seq
499999282 gbpln672.seq
499997847 gbpln673.seq
477462428 gbpln674.seq
499999771 gbpln675.seq
498062595 gbpln676.seq
499999630 gbpln677.seq
60832850 gbpln678.seq
499997397 gbpln679.seq
452992006 gbpln68.seq
499997825 gbpln680.seq
499998384 gbpln681.seq
258765457 gbpln682.seq
499998124 gbpln683.seq
499781921 gbpln684.seq
499873660 gbpln685.seq
499997847 gbpln686.seq
499758108 gbpln687.seq
177476693 gbpln688.seq
499985900 gbpln689.seq
497916786 gbpln69.seq
499998406 gbpln690.seq
499987776 gbpln691.seq
324136537 gbpln692.seq
499728427 gbpln693.seq
449834345 gbpln694.seq
393602368 gbpln695.seq
674055631 gbpln696.seq
865045961 gbpln697.seq
815791689 gbpln698.seq
802718902 gbpln699.seq
499923552 gbpln7.seq
480376128 gbpln70.seq
776304595 gbpln700.seq
721531499 gbpln701.seq
809857060 gbpln702.seq
679344023 gbpln703.seq
873797632 gbpln704.seq
820367220 gbpln705.seq
806296382 gbpln706.seq
775209384 gbpln707.seq
744231520 gbpln708.seq
817156402 gbpln709.seq
71745252 gbpln71.seq
771380170 gbpln710.seq
913253142 gbpln711.seq
634934982 gbpln712.seq
1019175188 gbpln713.seq
1023638564 gbpln714.seq
822225605 gbpln715.seq
961290952 gbpln716.seq
1090804562 gbpln717.seq
813694518 gbpln718.seq
962545328 gbpln719.seq
470916998 gbpln72.seq
873725319 gbpln720.seq
673190932 gbpln721.seq
905064826 gbpln722.seq
908590682 gbpln723.seq
742712720 gbpln724.seq
793279946 gbpln725.seq
934932909 gbpln726.seq
640700840 gbpln727.seq
961568346 gbpln728.seq
952066709 gbpln729.seq
472129613 gbpln73.seq
827214105 gbpln730.seq
455119462 gbpln731.seq
231458363 gbpln732.seq
777312364 gbpln733.seq
1006352199 gbpln734.seq
962815279 gbpln735.seq
975138624 gbpln736.seq
906550423 gbpln737.seq
790269619 gbpln738.seq
956926034 gbpln739.seq
477884160 gbpln74.seq
908369814 gbpln740.seq
1035806383 gbpln741.seq
1095241384 gbpln742.seq
889046375 gbpln743.seq
920177986 gbpln744.seq
934896187 gbpln745.seq
972756494 gbpln746.seq
639243888 gbpln747.seq
839211114 gbpln748.seq
802168717 gbpln749.seq
460004048 gbpln75.seq
677231763 gbpln750.seq
740101369 gbpln751.seq
642539818 gbpln752.seq
835613563 gbpln753.seq
284703679 gbpln754.seq
252385105 gbpln755.seq
408962039 gbpln756.seq
329779393 gbpln757.seq
332794404 gbpln758.seq
418495189 gbpln759.seq
430418757 gbpln76.seq
443558619 gbpln760.seq
449429603 gbpln761.seq
403262216 gbpln762.seq
477398793 gbpln763.seq
434368515 gbpln764.seq
488358692 gbpln765.seq
482850897 gbpln766.seq
469665157 gbpln767.seq
234176646 gbpln768.seq
434627789 gbpln769.seq
441540984 gbpln77.seq
412605137 gbpln770.seq
486453486 gbpln771.seq
475651653 gbpln772.seq
480188814 gbpln773.seq
445114184 gbpln774.seq
461871063 gbpln775.seq
499646071 gbpln776.seq
476206835 gbpln777.seq
473738821 gbpln778.seq
467899242 gbpln779.seq
433637010 gbpln78.seq
302161892 gbpln780.seq
685150845 gbpln781.seq
568932973 gbpln782.seq
539200572 gbpln783.seq
586715283 gbpln784.seq
614749845 gbpln785.seq
568071180 gbpln786.seq
625152324 gbpln787.seq
586214038 gbpln788.seq
746226242 gbpln789.seq
498225038 gbpln79.seq
808684234 gbpln790.seq
907082502 gbpln791.seq
776687848 gbpln792.seq
793240910 gbpln793.seq
698856619 gbpln794.seq
613367605 gbpln795.seq
674018689 gbpln796.seq
609236318 gbpln797.seq
576790588 gbpln798.seq
632368799 gbpln799.seq
226169328 gbpln8.seq
107501191 gbpln80.seq
377507152 gbpln800.seq
669127411 gbpln801.seq
252234127 gbpln802.seq
449964742 gbpln81.seq
422837725 gbpln82.seq
383453843 gbpln83.seq
376172115 gbpln84.seq
326317072 gbpln85.seq
320571252 gbpln86.seq
286199716 gbpln87.seq
277716231 gbpln88.seq
499733063 gbpln89.seq
500000209 gbpln9.seq
63743689 gbpln90.seq
391026515 gbpln91.seq
362500946 gbpln92.seq
390024684 gbpln93.seq
341773034 gbpln94.seq
199854530 gbpln95.seq
483137313 gbpln96.seq
493810295 gbpln97.seq
497201312 gbpln98.seq
492442383 gbpln99.seq
148373644 gbpri1.seq
499825465 gbpri10.seq
499966274 gbpri11.seq
248882813 gbpri12.seq
499849548 gbpri13.seq
352976929 gbpri14.seq
162644149 gbpri15.seq
494716433 gbpri16.seq
499956353 gbpri17.seq
499952905 gbpri18.seq
499962255 gbpri19.seq
499849627 gbpri2.seq
254317986 gbpri20.seq
317623598 gbpri21.seq
301999301 gbpri22.seq
491210434 gbpri23.seq
445784934 gbpri24.seq
381564573 gbpri25.seq
343180385 gbpri26.seq
476587750 gbpri27.seq
474072351 gbpri28.seq
368094033 gbpri29.seq
499891275 gbpri3.seq
500000157 gbpri30.seq
73915642 gbpri31.seq
499936200 gbpri32.seq
445708926 gbpri33.seq
427945376 gbpri34.seq
376528667 gbpri35.seq
483909000 gbpri36.seq
361487740 gbpri37.seq
388659484 gbpri38.seq
448630212 gbpri39.seq
499855408 gbpri4.seq
499941391 gbpri40.seq
307422144 gbpri41.seq
314630207 gbpri42.seq
499798044 gbpri43.seq
500000180 gbpri44.seq
213701921 gbpri45.seq
499995110 gbpri46.seq
499998049 gbpri47.seq
316426362 gbpri48.seq
499986982 gbpri49.seq
499729176 gbpri5.seq
499988166 gbpri50.seq
317186756 gbpri51.seq
258775295 gbpri52.seq
499996685 gbpri53.seq
499999797 gbpri54.seq
499968902 gbpri55.seq
386810349 gbpri56.seq
393528728 gbpri6.seq
499802910 gbpri7.seq
499984899 gbpri8.seq
499967070 gbpri9.seq
702927 gbrel.txt
499762670 gbrod1.seq
500000130 gbrod10.seq
6033934 gbrod11.seq
499810482 gbrod12.seq
203924668 gbrod13.seq
499995739 gbrod14.seq
499997685 gbrod15.seq
499998058 gbrod16.seq
296396049 gbrod17.seq
409660036 gbrod18.seq
485622431 gbrod19.seq
499801667 gbrod2.seq
447177606 gbrod20.seq
401874104 gbrod21.seq
366906621 gbrod22.seq
178573599 gbrod23.seq
488460708 gbrod24.seq
424418862 gbrod25.seq
451727059 gbrod26.seq
499112036 gbrod27.seq
467946548 gbrod28.seq
425428799 gbrod29.seq
499860799 gbrod3.seq
380509124 gbrod30.seq
359291146 gbrod31.seq
441031541 gbrod32.seq
489661762 gbrod33.seq
301541840 gbrod34.seq
245696968 gbrod35.seq
444533522 gbrod36.seq
404901396 gbrod37.seq
350079181 gbrod38.seq
484303888 gbrod39.seq
499965631 gbrod4.seq
464197213 gbrod40.seq
311672321 gbrod41.seq
441713729 gbrod42.seq
398906813 gbrod43.seq
493373336 gbrod44.seq
407105696 gbrod45.seq
117842878 gbrod46.seq
488265022 gbrod47.seq
434197329 gbrod48.seq
412800312 gbrod49.seq
499960342 gbrod5.seq
454365663 gbrod50.seq
382748472 gbrod51.seq
428038719 gbrod52.seq
487918369 gbrod53.seq
440586747 gbrod54.seq
359290553 gbrod55.seq
423923629 gbrod56.seq
258123670 gbrod57.seq
390007635 gbrod58.seq
346418766 gbrod59.seq
80291490 gbrod6.seq
345548222 gbrod60.seq
465925928 gbrod61.seq
403537722 gbrod62.seq
386823577 gbrod63.seq
403462511 gbrod64.seq
391812927 gbrod65.seq
346719868 gbrod66.seq
491742089 gbrod67.seq
445010312 gbrod68.seq
493387550 gbrod69.seq
499846851 gbrod7.seq
300864949 gbrod70.seq
466768965 gbrod71.seq
374387663 gbrod72.seq
350248940 gbrod73.seq
470230178 gbrod74.seq
465917437 gbrod75.seq
493546372 gbrod76.seq
241666801 gbrod77.seq
499742719 gbrod8.seq
499945822 gbrod9.seq
500000033 gbsts1.seq
499998244 gbsts10.seq
433474065 gbsts11.seq
499998879 gbsts2.seq
38293156 gbsts3.seq
499998792 gbsts4.seq
499998127 gbsts5.seq
456725186 gbsts6.seq
499997583 gbsts7.seq
500000077 gbsts8.seq
21007264 gbsts9.seq
300852153 gbsyn1.seq
484840372 gbsyn10.seq
420813753 gbsyn11.seq
490139440 gbsyn12.seq
343340422 gbsyn13.seq
372527348 gbsyn14.seq
417861289 gbsyn15.seq
448312981 gbsyn16.seq
416378132 gbsyn17.seq
453065790 gbsyn18.seq
263307032 gbsyn19.seq
343340424 gbsyn2.seq
484840366 gbsyn20.seq
420813747 gbsyn21.seq
498979310 gbsyn22.seq
499992210 gbsyn23.seq
48549451 gbsyn24.seq
499993129 gbsyn25.seq
499998321 gbsyn26.seq
499991357 gbsyn27.seq
246047929 gbsyn28.seq
370854968 gbsyn29.seq
372527353 gbsyn3.seq
417861297 gbsyn4.seq
448312992 gbsyn5.seq
81377357 gbsyn6.seq
470781602 gbsyn7.seq
317285242 gbsyn8.seq
263307034 gbsyn9.seq
499999170 gbtsa1.seq
499998753 gbtsa10.seq
499997439 gbtsa100.seq
499999811 gbtsa101.seq
499996108 gbtsa102.seq
404671505 gbtsa103.seq
499996434 gbtsa104.seq
499998444 gbtsa105.seq
499998535 gbtsa106.seq
473627173 gbtsa107.seq
499999949 gbtsa108.seq
499998832 gbtsa109.seq
499998190 gbtsa11.seq
236669988 gbtsa110.seq
499991596 gbtsa111.seq
499999834 gbtsa112.seq
499999770 gbtsa113.seq
499998939 gbtsa114.seq
34150369 gbtsa115.seq
499995781 gbtsa116.seq
499999069 gbtsa117.seq
499994937 gbtsa118.seq
470659755 gbtsa119.seq
280433046 gbtsa12.seq
499998218 gbtsa120.seq
499998672 gbtsa121.seq
499999924 gbtsa122.seq
280313902 gbtsa123.seq
499999116 gbtsa124.seq
499998111 gbtsa125.seq
499999818 gbtsa126.seq
423256101 gbtsa127.seq
500000081 gbtsa13.seq
499999057 gbtsa14.seq
161266958 gbtsa15.seq
500000121 gbtsa16.seq
499997446 gbtsa17.seq
259479616 gbtsa18.seq
499997528 gbtsa19.seq
499999468 gbtsa2.seq
499999892 gbtsa20.seq
499999414 gbtsa21.seq
67906184 gbtsa22.seq
499999446 gbtsa23.seq
499998887 gbtsa24.seq
500000190 gbtsa25.seq
282762991 gbtsa26.seq
499999395 gbtsa27.seq
499999391 gbtsa28.seq
79267140 gbtsa29.seq
147857334 gbtsa3.seq
499999538 gbtsa30.seq
500000008 gbtsa31.seq
158524644 gbtsa32.seq
499997307 gbtsa33.seq
499999463 gbtsa34.seq
499999416 gbtsa35.seq
491037960 gbtsa36.seq
499999905 gbtsa37.seq
499997196 gbtsa38.seq
499999501 gbtsa39.seq
499998486 gbtsa4.seq
229447067 gbtsa40.seq
499998695 gbtsa41.seq
499995446 gbtsa42.seq
499998871 gbtsa43.seq
177089009 gbtsa44.seq
499998570 gbtsa45.seq
499998681 gbtsa46.seq
355874071 gbtsa47.seq
499999532 gbtsa48.seq
499998797 gbtsa49.seq
499998583 gbtsa5.seq
298479435 gbtsa50.seq
499997916 gbtsa51.seq
499999651 gbtsa52.seq
403016270 gbtsa53.seq
499999771 gbtsa54.seq
499999873 gbtsa55.seq
499997210 gbtsa56.seq
345607399 gbtsa57.seq
499999894 gbtsa58.seq
499999942 gbtsa59.seq
58525382 gbtsa6.seq
499997721 gbtsa60.seq
226267789 gbtsa61.seq
499999722 gbtsa62.seq
499999282 gbtsa63.seq
260001225 gbtsa64.seq
499999567 gbtsa65.seq
464256826 gbtsa66.seq
499998462 gbtsa67.seq
499999620 gbtsa68.seq
499998580 gbtsa69.seq
500000064 gbtsa7.seq
168770314 gbtsa70.seq
499997567 gbtsa71.seq
500000162 gbtsa72.seq
499998185 gbtsa73.seq
2512297 gbtsa74.seq
499998125 gbtsa75.seq
499999963 gbtsa76.seq
131338866 gbtsa77.seq
500000012 gbtsa78.seq
499999875 gbtsa79.seq
499999969 gbtsa8.seq
34997856 gbtsa80.seq
499999375 gbtsa81.seq
499998196 gbtsa82.seq
499999803 gbtsa83.seq
499999945 gbtsa84.seq
48429697 gbtsa85.seq
499997725 gbtsa86.seq
499999047 gbtsa87.seq
499999139 gbtsa88.seq
82598188 gbtsa89.seq
274241542 gbtsa9.seq
499999824 gbtsa90.seq
389215892 gbtsa91.seq
499998191 gbtsa92.seq
499994249 gbtsa93.seq
499998640 gbtsa94.seq
208350764 gbtsa95.seq
499999734 gbtsa96.seq
499998253 gbtsa97.seq
499996332 gbtsa98.seq
230879944 gbtsa99.seq
7022810 gbuna1.seq
499761219 gbvrl1.seq
499999669 gbvrl10.seq
499974588 gbvrl100.seq
173557601 gbvrl101.seq
499945768 gbvrl102.seq
499968679 gbvrl103.seq
499966059 gbvrl104.seq
226892282 gbvrl105.seq
499949176 gbvrl106.seq
499985383 gbvrl107.seq
499973230 gbvrl108.seq
434756117 gbvrl109.seq
499999563 gbvrl11.seq
499935109 gbvrl110.seq
499934165 gbvrl111.seq
499967979 gbvrl112.seq
141735357 gbvrl113.seq
499996357 gbvrl114.seq
499993431 gbvrl115.seq
499976754 gbvrl116.seq
493695904 gbvrl117.seq
499961414 gbvrl118.seq
499977720 gbvrl119.seq
499966261 gbvrl12.seq
499997114 gbvrl120.seq
255824159 gbvrl121.seq
499958561 gbvrl122.seq
499973710 gbvrl123.seq
499943274 gbvrl124.seq
499944615 gbvrl125.seq
6043062 gbvrl126.seq
499977180 gbvrl127.seq
499968254 gbvrl128.seq
499941560 gbvrl129.seq
163567362 gbvrl13.seq
499978751 gbvrl130.seq
305348624 gbvrl131.seq
499962058 gbvrl132.seq
499975522 gbvrl133.seq
499984933 gbvrl134.seq
499973977 gbvrl135.seq
499980876 gbvrl136.seq
225381409 gbvrl137.seq
499977355 gbvrl138.seq
499973749 gbvrl139.seq
499997590 gbvrl14.seq
499972808 gbvrl140.seq
322004308 gbvrl141.seq
499982106 gbvrl142.seq
499982070 gbvrl143.seq
499962746 gbvrl144.seq
291265881 gbvrl145.seq
499937405 gbvrl146.seq
499983980 gbvrl147.seq
499937691 gbvrl148.seq
183352249 gbvrl149.seq
499998339 gbvrl15.seq
499954751 gbvrl150.seq
499967019 gbvrl151.seq
499953840 gbvrl152.seq
499945092 gbvrl153.seq
253147597 gbvrl154.seq
499965662 gbvrl155.seq
499988145 gbvrl156.seq
499980980 gbvrl157.seq
237889818 gbvrl158.seq
499995726 gbvrl159.seq
134107845 gbvrl16.seq
499998821 gbvrl160.seq
499994790 gbvrl161.seq
499956376 gbvrl162.seq
279419544 gbvrl163.seq
499952708 gbvrl164.seq
499962991 gbvrl165.seq
499934879 gbvrl166.seq
499944432 gbvrl167.seq
225305349 gbvrl168.seq
499956575 gbvrl169.seq
499998921 gbvrl17.seq
499956101 gbvrl170.seq
499948365 gbvrl171.seq
336500756 gbvrl172.seq
499956865 gbvrl173.seq
499963856 gbvrl174.seq
499992330 gbvrl175.seq
148883862 gbvrl176.seq
499967466 gbvrl177.seq
499941834 gbvrl178.seq
499951529 gbvrl179.seq
499999829 gbvrl18.seq
150727797 gbvrl180.seq
499964174 gbvrl181.seq
499966969 gbvrl182.seq
499950729 gbvrl183.seq
461244882 gbvrl184.seq
499942504 gbvrl185.seq
499946664 gbvrl186.seq
499999059 gbvrl187.seq
498629836 gbvrl188.seq
499990413 gbvrl189.seq
315354934 gbvrl19.seq
499949564 gbvrl190.seq
499958126 gbvrl191.seq
171557147 gbvrl192.seq
499952800 gbvrl193.seq
499943082 gbvrl194.seq
499953251 gbvrl195.seq
499978809 gbvrl196.seq
265513075 gbvrl197.seq
499964396 gbvrl198.seq
499966406 gbvrl199.seq
499998416 gbvrl2.seq
499997025 gbvrl20.seq
499946219 gbvrl200.seq
499971851 gbvrl201.seq
260321568 gbvrl202.seq
499967329 gbvrl203.seq
499994060 gbvrl204.seq
499964632 gbvrl205.seq
499975718 gbvrl206.seq
279306548 gbvrl207.seq
499935181 gbvrl208.seq
499970251 gbvrl209.seq
499998775 gbvrl21.seq
499951370 gbvrl210.seq
499968689 gbvrl211.seq
265445924 gbvrl212.seq
499997323 gbvrl213.seq
499951412 gbvrl214.seq
499950588 gbvrl215.seq
499994932 gbvrl216.seq
263706179 gbvrl217.seq
499976244 gbvrl218.seq
499936572 gbvrl219.seq
345423685 gbvrl22.seq
499970425 gbvrl220.seq
499963117 gbvrl221.seq
271765618 gbvrl222.seq
499937782 gbvrl223.seq
499954908 gbvrl224.seq
499935605 gbvrl225.seq
499992304 gbvrl226.seq
263260609 gbvrl227.seq
499966252 gbvrl228.seq
499988287 gbvrl229.seq
499998206 gbvrl23.seq
499977808 gbvrl230.seq
500000030 gbvrl231.seq
264607360 gbvrl232.seq
499979108 gbvrl233.seq
499946026 gbvrl234.seq
499969688 gbvrl235.seq
499939015 gbvrl236.seq
256067877 gbvrl237.seq
499967117 gbvrl238.seq
499938525 gbvrl239.seq
500000219 gbvrl24.seq
499990432 gbvrl240.seq
499977345 gbvrl241.seq
256405350 gbvrl242.seq
499971704 gbvrl243.seq
499935610 gbvrl244.seq
499990997 gbvrl245.seq
499946138 gbvrl246.seq
257162192 gbvrl247.seq
499959248 gbvrl248.seq
499993980 gbvrl249.seq
369048501 gbvrl25.seq
499934770 gbvrl250.seq
499983826 gbvrl251.seq
256486415 gbvrl252.seq
499976627 gbvrl253.seq
499952717 gbvrl254.seq
499944489 gbvrl255.seq
499975270 gbvrl256.seq
499947621 gbvrl257.seq
499978927 gbvrl258.seq
263948335 gbvrl259.seq
499997298 gbvrl26.seq
499962053 gbvrl260.seq
499990247 gbvrl261.seq
499972629 gbvrl262.seq
499946391 gbvrl263.seq
499971341 gbvrl264.seq
499949915 gbvrl265.seq
251978626 gbvrl266.seq
499961225 gbvrl267.seq
499988488 gbvrl268.seq
499967386 gbvrl269.seq
499998756 gbvrl27.seq
499973821 gbvrl270.seq
245862268 gbvrl271.seq
499958529 gbvrl272.seq
499979628 gbvrl273.seq
499943872 gbvrl274.seq
499956163 gbvrl275.seq
241366775 gbvrl276.seq
499993292 gbvrl277.seq
499985582 gbvrl278.seq
499969421 gbvrl279.seq
314112187 gbvrl28.seq
499950029 gbvrl280.seq
414847911 gbvrl281.seq
499966660 gbvrl282.seq
499961440 gbvrl283.seq
499943853 gbvrl284.seq
164656950 gbvrl285.seq
499980968 gbvrl286.seq
499937841 gbvrl287.seq
499987949 gbvrl288.seq
222873900 gbvrl289.seq
499995698 gbvrl29.seq
499990532 gbvrl290.seq
499941643 gbvrl291.seq
499967348 gbvrl292.seq
306854376 gbvrl293.seq
499949695 gbvrl294.seq
499934029 gbvrl295.seq
499974403 gbvrl296.seq
270392864 gbvrl297.seq
499939419 gbvrl298.seq
499956557 gbvrl299.seq
499997270 gbvrl3.seq
499997669 gbvrl30.seq
499997319 gbvrl300.seq
375291366 gbvrl301.seq
499936507 gbvrl302.seq
499961414 gbvrl303.seq
499934019 gbvrl304.seq
391760597 gbvrl305.seq
499986079 gbvrl306.seq
499935604 gbvrl307.seq
499964998 gbvrl308.seq
499986060 gbvrl309.seq
499872670 gbvrl31.seq
25884210 gbvrl310.seq
499986199 gbvrl311.seq
499933725 gbvrl312.seq
499943419 gbvrl313.seq
270681031 gbvrl314.seq
499960226 gbvrl315.seq
499981907 gbvrl316.seq
499968500 gbvrl317.seq
182099962 gbvrl318.seq
499962202 gbvrl319.seq
256195641 gbvrl32.seq
499956565 gbvrl320.seq
499955475 gbvrl321.seq
158191486 gbvrl322.seq
499940815 gbvrl323.seq
499954591 gbvrl324.seq
499943995 gbvrl325.seq
499965673 gbvrl326.seq
72151850 gbvrl327.seq
499981360 gbvrl328.seq
499994373 gbvrl329.seq
499997402 gbvrl33.seq
499970942 gbvrl330.seq
459228903 gbvrl331.seq
499966330 gbvrl332.seq
499984617 gbvrl333.seq
499943955 gbvrl334.seq
462163877 gbvrl335.seq
499951782 gbvrl336.seq
499951074 gbvrl337.seq
499967115 gbvrl338.seq
499947095 gbvrl339.seq
499989947 gbvrl34.seq
119568699 gbvrl340.seq
499952917 gbvrl341.seq
499969672 gbvrl342.seq
499968372 gbvrl343.seq
177750803 gbvrl344.seq
499939900 gbvrl345.seq
499942962 gbvrl346.seq
499972930 gbvrl347.seq
444162371 gbvrl348.seq
499951132 gbvrl349.seq
425783183 gbvrl35.seq
499987529 gbvrl350.seq
499983643 gbvrl351.seq
217605395 gbvrl352.seq
499972111 gbvrl353.seq
499980332 gbvrl354.seq
499989096 gbvrl355.seq
499939403 gbvrl356.seq
225943360 gbvrl357.seq
490034647 gbvrl358.seq
499992743 gbvrl359.seq
499999359 gbvrl36.seq
252280844 gbvrl360.seq
76663525 gbvrl361.seq
499994999 gbvrl362.seq
499995584 gbvrl363.seq
499996567 gbvrl364.seq
248641304 gbvrl365.seq
499989573 gbvrl366.seq
500000038 gbvrl367.seq
499968650 gbvrl368.seq
276758229 gbvrl369.seq
499997727 gbvrl37.seq
499978647 gbvrl370.seq
499976370 gbvrl371.seq
499964458 gbvrl372.seq
167625331 gbvrl373.seq
499970093 gbvrl374.seq
499998175 gbvrl375.seq
499964697 gbvrl376.seq
142301334 gbvrl377.seq
499990556 gbvrl378.seq
499997285 gbvrl379.seq
421345502 gbvrl38.seq
499978295 gbvrl380.seq
256225795 gbvrl381.seq
499986708 gbvrl382.seq
499985173 gbvrl383.seq
499977224 gbvrl384.seq
138895446 gbvrl385.seq
499971782 gbvrl386.seq
499992483 gbvrl387.seq
499997479 gbvrl388.seq
113029750 gbvrl389.seq
499996478 gbvrl39.seq
146006095 gbvrl390.seq
499985590 gbvrl391.seq
499993796 gbvrl392.seq
499994199 gbvrl393.seq
123126465 gbvrl394.seq
499980380 gbvrl395.seq
499988258 gbvrl396.seq
499993469 gbvrl397.seq
467905182 gbvrl398.seq
499990734 gbvrl399.seq
36103616 gbvrl4.seq
499998329 gbvrl40.seq
499992968 gbvrl400.seq
499986113 gbvrl401.seq
145264338 gbvrl402.seq
499978200 gbvrl403.seq
499993073 gbvrl404.seq
499968479 gbvrl405.seq
359291402 gbvrl406.seq
499994806 gbvrl407.seq
499976458 gbvrl408.seq
499994826 gbvrl409.seq
499985458 gbvrl41.seq
499997400 gbvrl410.seq
276920289 gbvrl411.seq
499962348 gbvrl412.seq
499996245 gbvrl413.seq
499985335 gbvrl414.seq
499999032 gbvrl415.seq
52275837 gbvrl416.seq
499966368 gbvrl417.seq
499977083 gbvrl418.seq
499987287 gbvrl419.seq
303100575 gbvrl42.seq
400921695 gbvrl420.seq
499965920 gbvrl421.seq
499974118 gbvrl422.seq
499974403 gbvrl423.seq
354399856 gbvrl424.seq
499965642 gbvrl425.seq
499981585 gbvrl426.seq
499974560 gbvrl427.seq
244319415 gbvrl428.seq
499969047 gbvrl429.seq
499982771 gbvrl43.seq
499998501 gbvrl430.seq
499963466 gbvrl431.seq
311681318 gbvrl432.seq
499970291 gbvrl433.seq
500000153 gbvrl434.seq
499972198 gbvrl435.seq
283947773 gbvrl436.seq
499966506 gbvrl437.seq
499994328 gbvrl438.seq
499989778 gbvrl439.seq
499965393 gbvrl44.seq
281653037 gbvrl440.seq
499967068 gbvrl441.seq
499988696 gbvrl442.seq
499982975 gbvrl443.seq
287554811 gbvrl444.seq
499968257 gbvrl445.seq
499986719 gbvrl446.seq
499976175 gbvrl447.seq
285778503 gbvrl448.seq
499973965 gbvrl449.seq
499999101 gbvrl45.seq
499963703 gbvrl450.seq
499958708 gbvrl451.seq
276980179 gbvrl452.seq
499969873 gbvrl453.seq
499965020 gbvrl454.seq
499993460 gbvrl455.seq
499998475 gbvrl456.seq
93707975 gbvrl457.seq
499970858 gbvrl458.seq
499981579 gbvrl459.seq
284347571 gbvrl46.seq
499981682 gbvrl460.seq
499973466 gbvrl461.seq
74925382 gbvrl462.seq
499983873 gbvrl463.seq
499988248 gbvrl464.seq
499996733 gbvrl465.seq
499979030 gbvrl466.seq
95202028 gbvrl467.seq
499976537 gbvrl468.seq
499995836 gbvrl469.seq
499984088 gbvrl47.seq
499962777 gbvrl470.seq
115358284 gbvrl471.seq
499978042 gbvrl472.seq
499975147 gbvrl473.seq
499998630 gbvrl474.seq
124116784 gbvrl475.seq
499994764 gbvrl476.seq
499962213 gbvrl477.seq
499993317 gbvrl478.seq
124383381 gbvrl479.seq
499943281 gbvrl48.seq
499987030 gbvrl480.seq
499995509 gbvrl481.seq
499974440 gbvrl482.seq
499985340 gbvrl483.seq
150761071 gbvrl484.seq
499970071 gbvrl485.seq
499993808 gbvrl486.seq
499995759 gbvrl487.seq
256400863 gbvrl488.seq
499996408 gbvrl489.seq
499996042 gbvrl49.seq
499983357 gbvrl490.seq
499974024 gbvrl491.seq
499971758 gbvrl492.seq
311176065 gbvrl493.seq
499993059 gbvrl494.seq
499977303 gbvrl495.seq
499967523 gbvrl496.seq
396261764 gbvrl497.seq
499981077 gbvrl498.seq
499994906 gbvrl499.seq
499997494 gbvrl5.seq
293664541 gbvrl50.seq
499980237 gbvrl500.seq
499973503 gbvrl501.seq
499968352 gbvrl502.seq
499997266 gbvrl503.seq
121375985 gbvrl504.seq
499985960 gbvrl505.seq
499977284 gbvrl506.seq
499964686 gbvrl507.seq
499999171 gbvrl508.seq
499972433 gbvrl509.seq
499979536 gbvrl51.seq
471344149 gbvrl510.seq
499998632 gbvrl511.seq
499975315 gbvrl512.seq
499985525 gbvrl513.seq
499987240 gbvrl514.seq
386872031 gbvrl515.seq
499973225 gbvrl516.seq
499975933 gbvrl517.seq
499992983 gbvrl518.seq
499978412 gbvrl519.seq
499992786 gbvrl52.seq
76937982 gbvrl520.seq
499973195 gbvrl521.seq
499970866 gbvrl522.seq
499998836 gbvrl523.seq
499998354 gbvrl524.seq
52934214 gbvrl525.seq
499981673 gbvrl53.seq
257736373 gbvrl54.seq
499978472 gbvrl55.seq
499986024 gbvrl56.seq
499992018 gbvrl57.seq
499962918 gbvrl58.seq
181445713 gbvrl59.seq
499999396 gbvrl6.seq
499950307 gbvrl60.seq
499941978 gbvrl61.seq
499950353 gbvrl62.seq
499993035 gbvrl63.seq
159107810 gbvrl64.seq
499997121 gbvrl65.seq
499989418 gbvrl66.seq
499979413 gbvrl67.seq
499949311 gbvrl68.seq
149261780 gbvrl69.seq
499996763 gbvrl7.seq
499942554 gbvrl70.seq
499967835 gbvrl71.seq
499954173 gbvrl72.seq
406254242 gbvrl73.seq
499941638 gbvrl74.seq
499999232 gbvrl75.seq
499968415 gbvrl76.seq
352729174 gbvrl77.seq
499940410 gbvrl78.seq
499986510 gbvrl79.seq
499995408 gbvrl8.seq
499973363 gbvrl80.seq
314436709 gbvrl81.seq
499961511 gbvrl82.seq
499957914 gbvrl83.seq
499963183 gbvrl84.seq
41374426 gbvrl85.seq
499996300 gbvrl86.seq
499933790 gbvrl87.seq
499994001 gbvrl88.seq
185090092 gbvrl89.seq
301463485 gbvrl9.seq
499993597 gbvrl90.seq
499959935 gbvrl91.seq
499970347 gbvrl92.seq
178247555 gbvrl93.seq
499989285 gbvrl94.seq
499977321 gbvrl95.seq
499940980 gbvrl96.seq
220289076 gbvrl97.seq
499957592 gbvrl98.seq
499993999 gbvrl99.seq
499856078 gbvrt1.seq
290137512 gbvrt10.seq
1063697373 gbvrt100.seq
1045817456 gbvrt101.seq
754876698 gbvrt102.seq
616753988 gbvrt103.seq
490283916 gbvrt104.seq
470651151 gbvrt105.seq
397152890 gbvrt106.seq
351566814 gbvrt107.seq
339881554 gbvrt108.seq
404716166 gbvrt109.seq
87351602 gbvrt11.seq
489465929 gbvrt110.seq
499108511 gbvrt111.seq
486719349 gbvrt112.seq
58362562 gbvrt113.seq
436489699 gbvrt114.seq
486735687 gbvrt115.seq
492786702 gbvrt116.seq
424170309 gbvrt117.seq
281367593 gbvrt118.seq
478264522 gbvrt119.seq
499806077 gbvrt12.seq
485840122 gbvrt120.seq
493662272 gbvrt121.seq
75046811 gbvrt122.seq
979125221 gbvrt123.seq
838606764 gbvrt124.seq
678362247 gbvrt125.seq
476490051 gbvrt126.seq
461393141 gbvrt127.seq
438814149 gbvrt128.seq
394334276 gbvrt129.seq
284674796 gbvrt13.seq
313818221 gbvrt130.seq
288999697 gbvrt131.seq
280186115 gbvrt132.seq
407765043 gbvrt133.seq
421856869 gbvrt134.seq
478932645 gbvrt135.seq
480028007 gbvrt136.seq
438022009 gbvrt137.seq
174441466 gbvrt138.seq
487902327 gbvrt139.seq
15637437 gbvrt14.seq
456814552 gbvrt140.seq
462308829 gbvrt141.seq
168813991 gbvrt142.seq
455915969 gbvrt143.seq
469542169 gbvrt144.seq
479148432 gbvrt145.seq
211438035 gbvrt146.seq
481255007 gbvrt147.seq
475910680 gbvrt148.seq
366785231 gbvrt149.seq
36035214 gbvrt15.seq
464881586 gbvrt150.seq
474452025 gbvrt151.seq
234874130 gbvrt152.seq
697335450 gbvrt153.seq
670835803 gbvrt154.seq
524090553 gbvrt155.seq
413420126 gbvrt156.seq
345317144 gbvrt157.seq
329841089 gbvrt158.seq
250750417 gbvrt159.seq
18509260 gbvrt16.seq
486600390 gbvrt160.seq
364885711 gbvrt161.seq
448395879 gbvrt162.seq
471877569 gbvrt163.seq
393642536 gbvrt164.seq
355134416 gbvrt165.seq
470602746 gbvrt166.seq
448657488 gbvrt167.seq
384724558 gbvrt168.seq
432320923 gbvrt169.seq
497676963 gbvrt17.seq
471132362 gbvrt170.seq
497676594 gbvrt171.seq
207882210 gbvrt172.seq
397267013 gbvrt173.seq
366771863 gbvrt174.seq
351249970 gbvrt175.seq
309532358 gbvrt176.seq
296271444 gbvrt177.seq
286321426 gbvrt178.seq
268164730 gbvrt179.seq
497173924 gbvrt18.seq
253329800 gbvrt180.seq
494939336 gbvrt181.seq
424426418 gbvrt182.seq
410896883 gbvrt183.seq
369957025 gbvrt184.seq
169574120 gbvrt185.seq
426847158 gbvrt186.seq
496824508 gbvrt187.seq
434394791 gbvrt188.seq
494363156 gbvrt189.seq
481350583 gbvrt19.seq
61896426 gbvrt190.seq
431425246 gbvrt191.seq
474666330 gbvrt192.seq
479195821 gbvrt193.seq
352877651 gbvrt194.seq
479851070 gbvrt195.seq
497038176 gbvrt196.seq
432867963 gbvrt197.seq
439843808 gbvrt198.seq
469531790 gbvrt199.seq
499813197 gbvrt2.seq
400795564 gbvrt20.seq
496015817 gbvrt200.seq
488626307 gbvrt201.seq
432135676 gbvrt202.seq
70119528 gbvrt203.seq
491056051 gbvrt204.seq
328508705 gbvrt205.seq
497328806 gbvrt206.seq
499238966 gbvrt207.seq
187508760 gbvrt208.seq
490842556 gbvrt209.seq
488197715 gbvrt21.seq
463385772 gbvrt210.seq
446788975 gbvrt211.seq
438416202 gbvrt212.seq
170595769 gbvrt213.seq
451342688 gbvrt214.seq
474563355 gbvrt215.seq
461335548 gbvrt216.seq
436658187 gbvrt217.seq
154682616 gbvrt218.seq
456837606 gbvrt219.seq
479291185 gbvrt22.seq
488930196 gbvrt220.seq
466502331 gbvrt221.seq
455725140 gbvrt222.seq
453475816 gbvrt223.seq
462276007 gbvrt224.seq
497473221 gbvrt225.seq
499283767 gbvrt226.seq
481742871 gbvrt227.seq
54779872 gbvrt228.seq
477445338 gbvrt229.seq
480798341 gbvrt23.seq
495314515 gbvrt230.seq
486008997 gbvrt231.seq
489201368 gbvrt232.seq
499536480 gbvrt233.seq
347470388 gbvrt234.seq
1068402516 gbvrt235.seq
1067356333 gbvrt236.seq
896844819 gbvrt237.seq
805318347 gbvrt238.seq
718662677 gbvrt239.seq
499274554 gbvrt24.seq
556944666 gbvrt240.seq
299728838 gbvrt241.seq
293507186 gbvrt242.seq
484357811 gbvrt243.seq
130768604 gbvrt244.seq
874873715 gbvrt245.seq
685858825 gbvrt246.seq
627564227 gbvrt247.seq
610271897 gbvrt248.seq
543871783 gbvrt249.seq
483255218 gbvrt25.seq
284797667 gbvrt250.seq
269299175 gbvrt251.seq
474717664 gbvrt252.seq
402979396 gbvrt253.seq
343325815 gbvrt254.seq
450550965 gbvrt255.seq
494368803 gbvrt256.seq
470727278 gbvrt257.seq
470514883 gbvrt258.seq
229658476 gbvrt259.seq
484153949 gbvrt26.seq
499998905 gbvrt260.seq
499998615 gbvrt261.seq
487460877 gbvrt262.seq
499998800 gbvrt263.seq
412802317 gbvrt264.seq
441725801 gbvrt265.seq
471785049 gbvrt266.seq
472485647 gbvrt267.seq
38495736 gbvrt268.seq
477156039 gbvrt269.seq
65325620 gbvrt27.seq
499226352 gbvrt270.seq
477696169 gbvrt271.seq
353039605 gbvrt272.seq
438196164 gbvrt273.seq
489809255 gbvrt274.seq
460938782 gbvrt275.seq
425935508 gbvrt276.seq
463055690 gbvrt277.seq
486381290 gbvrt278.seq
437842334 gbvrt279.seq
437233554 gbvrt28.seq
440416936 gbvrt280.seq
475637169 gbvrt281.seq
477247307 gbvrt282.seq
464764457 gbvrt283.seq
442158629 gbvrt284.seq
490038950 gbvrt285.seq
437760826 gbvrt286.seq
442760644 gbvrt287.seq
386023782 gbvrt288.seq
474713745 gbvrt289.seq
488520688 gbvrt29.seq
485232834 gbvrt290.seq
481700105 gbvrt291.seq
303293376 gbvrt292.seq
466823544 gbvrt3.seq
456456384 gbvrt30.seq
341830916 gbvrt31.seq
14152653 gbvrt32.seq
21384662 gbvrt33.seq
90973101 gbvrt34.seq
499951059 gbvrt35.seq
499999330 gbvrt36.seq
499998322 gbvrt37.seq
55977732 gbvrt38.seq
499998100 gbvrt39.seq
179100370 gbvrt4.seq
270033953 gbvrt40.seq
385151455 gbvrt41.seq
490595601 gbvrt42.seq
386502843 gbvrt43.seq
499998800 gbvrt44.seq
119194767 gbvrt45.seq
499998661 gbvrt46.seq
448790043 gbvrt47.seq
499996190 gbvrt48.seq
28944482 gbvrt49.seq
448778544 gbvrt5.seq
444447385 gbvrt50.seq
499998724 gbvrt51.seq
388477778 gbvrt52.seq
499999134 gbvrt53.seq
280270235 gbvrt54.seq
500000052 gbvrt55.seq
497449594 gbvrt56.seq
489719275 gbvrt57.seq
497618498 gbvrt58.seq
490981487 gbvrt59.seq
490703641 gbvrt6.seq
450977918 gbvrt60.seq
202128841 gbvrt61.seq
123737443 gbvrt62.seq
483315419 gbvrt63.seq
481925744 gbvrt64.seq
499146212 gbvrt65.seq
499983703 gbvrt66.seq
297372571 gbvrt67.seq
492215762 gbvrt68.seq
492375887 gbvrt69.seq
499120716 gbvrt7.seq
479677491 gbvrt70.seq
480814553 gbvrt71.seq
362168611 gbvrt72.seq
490950275 gbvrt73.seq
475405574 gbvrt74.seq
489430322 gbvrt75.seq
352377326 gbvrt76.seq
465372186 gbvrt77.seq
488788789 gbvrt78.seq
189348250 gbvrt79.seq
483705970 gbvrt8.seq
451948482 gbvrt80.seq
443703248 gbvrt81.seq
400719178 gbvrt82.seq
427517644 gbvrt83.seq
319264824 gbvrt84.seq
275756309 gbvrt85.seq
252640763 gbvrt86.seq
251496345 gbvrt87.seq
466369516 gbvrt88.seq
418722220 gbvrt89.seq
263831166 gbvrt9.seq
186091498 gbvrt90.seq
404212770 gbvrt91.seq
481131817 gbvrt92.seq
474827267 gbvrt93.seq
480710662 gbvrt94.seq
89576280 gbvrt95.seq
435880706 gbvrt96.seq
487966705 gbvrt97.seq
497561523 gbvrt98.seq
468911614 gbvrt99.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 101755 185776336
BCT10 102 248054550
BCT100 24 34605217
BCT101 94 226656782
BCT102 118 229172914
BCT103 127 232212861
BCT104 90 178403076
BCT105 114 212138354
BCT106 75 222053892
BCT107 112 225347102
BCT108 124 217786851
BCT109 3 5977905
BCT11 145 242443173
BCT110 246 222256023
BCT111 104 221252195
BCT112 100 224644129
BCT113 83 222703364
BCT114 21 86233168
BCT115 68 221578114
BCT116 87 219795809
BCT117 87 223588406
BCT118 80 226303150
BCT119 20 45564131
BCT12 167 262397135
BCT120 124 217933644
BCT121 53 217706139
BCT122 90 227492926
BCT123 57 149506400
BCT124 94 223837173
BCT125 73 221711999
BCT126 113 222996943
BCT127 78 197436829
BCT128 156 218173209
BCT129 84 220629983
BCT13 6 12749856
BCT130 79 216070642
BCT131 141 228566924
BCT132 106 221256144
BCT133 80 221199213
BCT134 92 196245950
BCT135 115 225967887
BCT136 92 220409897
BCT137 158 214217907
BCT138 88 207032597
BCT139 140 220978157
BCT14 170 237845538
BCT140 63 217844098
BCT141 90 215013764
BCT142 125 217101319
BCT143 88 223616604
BCT144 21 65066945
BCT145 174 220602790
BCT146 128 221993348
BCT147 118 216449560
BCT148 170 220678956
BCT149 54 177570665
BCT15 151 240481452
BCT150 104 218683705
BCT151 113 217389079
BCT152 138 222247056
BCT153 109 220993944
BCT154 101 223667628
BCT155 118 156232056
BCT156 95 229134325
BCT157 104 222093509
BCT158 97 225362965
BCT159 116 220401677
BCT16 199 252481270
BCT160 94 219188969
BCT161 134 220654115
BCT162 36 70525291
BCT163 169 220902025
BCT164 100 223727909
BCT165 94 222167747
BCT166 94 214484227
BCT167 71 223304376
BCT168 123 228309968
BCT169 150 228808455
BCT17 206 229336468
BCT170 80 212893326
BCT171 100 233591727
BCT172 96 224405035
BCT173 134 223606319
BCT174 84 221873830
BCT175 25 88330083
BCT176 119 222185746
BCT177 151 231715107
BCT178 72 216080650
BCT179 81 120955479
BCT18 2 4770723
BCT180 111 216184725
BCT181 156 227708035
BCT182 111 220250972
BCT183 89 136614524
BCT184 133 229717687
BCT185 111 208992481
BCT186 108 219925553
BCT187 77 222877345
BCT188 18 29103391
BCT189 98 220152536
BCT19 136 236547259
BCT190 133 227333368
BCT191 125 230906352
BCT192 118 245874590
BCT193 114 233627230
BCT194 32 86501281
BCT195 131 216438017
BCT196 93 226438829
BCT197 108 224087651
BCT198 116 221458112
BCT199 65 122261042
BCT2 107 227274960
BCT20 114 232548694
BCT200 127 225144984
BCT201 137 258852104
BCT202 100 226683783
BCT203 158 215934234
BCT204 69 111557509
BCT205 123 222422665
BCT206 115 218469346
BCT207 89 219209021
BCT208 103 229936404
BCT209 104 209481600
BCT21 140 223708984
BCT210 97 234475408
BCT211 102 220656832
BCT212 100 218053674
BCT213 94 224743372
BCT214 104 226992367
BCT215 107 231904945
BCT216 70 148112573
BCT217 104 221826114
BCT218 108 221051727
BCT219 98 226007841
BCT22 200 220359484
BCT220 76 270744187
BCT221 75 254647899
BCT222 106 225376718
BCT223 176 219971681
BCT224 132 226738257
BCT225 55 106489903
BCT226 324 275336670
BCT227 116 218712797
BCT228 118 218047051
BCT229 45 74298835
BCT23 24 29385563
BCT230 89 220099828
BCT231 87 228427298
BCT232 78 232624772
BCT233 108 225429540
BCT234 26 68688386
BCT235 60 216868170
BCT236 120 221119124
BCT237 86 223426276
BCT238 85 217995381
BCT239 30 67668948
BCT24 174 220036188
BCT240 157 275025230
BCT241 87 234185848
BCT242 96 219765338
BCT243 135 191926241
BCT244 109 262921422
BCT245 72 217635148
BCT246 100 214909619
BCT247 76 205489624
BCT248 143 306547296
BCT249 72 239204396
BCT25 157 217996559
BCT250 88 216728836
BCT251 132 223474256
BCT252 142 267934611
BCT253 46 90275869
BCT254 146 273570514
BCT255 109 252612009
BCT256 35 229012536
BCT257 56 209847636
BCT258 110 218761905
BCT259 130 219578217
BCT26 52 221902715
BCT260 90 250893937
BCT261 83 205397470
BCT262 124 215159011
BCT263 113 223367533
BCT264 144 228597181
BCT265 114 228439247
BCT266 114 231113225
BCT267 120 228230620
BCT268 26 74228471
BCT269 106 218843831
BCT27 115 226443985
BCT270 82 215186387
BCT271 87 232931079
BCT272 98 219566714
BCT273 13 10410673
BCT274 93 235647841
BCT275 104 235928514
BCT276 69 223063860
BCT277 99 208185886
BCT278 119 216777827
BCT279 166 226651969
BCT28 197 239757955
BCT280 161 212763762
BCT281 133 231781514
BCT282 100 227626264
BCT283 123 230260480
BCT284 157 246992348
BCT285 105 236694886
BCT286 122 221777912
BCT287 112 212578426
BCT288 96 229032785
BCT289 109 215629630
BCT29 1 9254808
BCT290 161 224507963
BCT291 154 215440610
BCT292 104 159015661
BCT293 130 228756073
BCT294 104 220860438
BCT295 84 215327663
BCT296 67 212286790
BCT297 120 189367846
BCT298 88 244048892
BCT299 107 228886299
BCT3 37541 123332243
BCT30 81 239594577
BCT300 83 221517737
BCT301 61 216100377
BCT302 75 170636859
BCT303 115 219540003
BCT304 101 218974130
BCT305 124 216924787
BCT306 90 217527347
BCT307 140 185056878
BCT308 124 248813935
BCT309 110 222498371
BCT31 100 222853857
BCT310 81 224631234
BCT311 61 221300332
BCT312 88 179376157
BCT313 128 238885544
BCT314 197 234044756
BCT315 142 219590522
BCT316 136 216417123
BCT317 110 213514098
BCT318 30 39687036
BCT319 141 246427155
BCT32 96 226432790
BCT320 167 279237902
BCT321 170 216918027
BCT322 131 219454695
BCT323 15 110010139
BCT324 72 228738867
BCT325 128 242193459
BCT326 1240 225059545
BCT327 117 224614018
BCT328 73 186373828
BCT329 101 222185425
BCT33 129 224597211
BCT330 125 212414477
BCT331 97 209352135
BCT332 136 220706579
BCT333 218 234375800
BCT334 204 220140029
BCT335 114 221118385
BCT336 47 99873218
BCT337 123 216507866
BCT338 144 220140457
BCT339 146 218600953
BCT34 82 218519132
BCT340 124 227417343
BCT341 149 234265173
BCT342 92 239548214
BCT343 51 102693253
BCT344 111 224832352
BCT345 163 233467335
BCT346 122 221078125
BCT347 128 225705292
BCT348 79 190763925
BCT349 125 234008897
BCT35 115 235429468
BCT350 122 226223828
BCT351 77 220312740
BCT352 84 219810323
BCT353 55 219285276
BCT354 50 220966234
BCT355 139 226130710
BCT356 38 5693505
BCT357 195 229604129
BCT358 137 253684929
BCT359 127 220485957
BCT36 76 221532579
BCT360 209 226252576
BCT361 48 77988611
BCT362 92 239399904
BCT363 112 248613001
BCT364 46 214210089
BCT365 53 216377175
BCT366 18 68501240
BCT367 92 217200838
BCT368 90 231500758
BCT369 117 246538204
BCT37 157 221990902
BCT370 199 228391855
BCT371 101 221851200
BCT372 118 214540254
BCT373 28 62842863
BCT374 166 261984346
BCT375 180 236857563
BCT376 474 226333252
BCT377 144 236159655
BCT378 148 247542626
BCT379 102 231342386
BCT38 169 242217635
BCT380 80 142334695
BCT381 110 230934388
BCT382 85 220353169
BCT383 92 218533698
BCT384 104 232991105
BCT385 162 222657737
BCT386 42 76520643
BCT387 88 219801256
BCT388 94 227456495
BCT389 162 308190565
BCT39 461 225374315
BCT390 114 250150842
BCT391 98 283092339
BCT392 80 187224335
BCT393 114 227850421
BCT394 146 217630758
BCT395 97 218658836
BCT396 150 228774002
BCT397 124 220737990
BCT398 118 234014721
BCT399 118 186338975
BCT4 41293 139254430
BCT40 5200 7533877
BCT400 105 226068926
BCT401 143 223058556
BCT402 114 236047533
BCT403 177 218440412
BCT404 29 61315594
BCT405 129 231508633
BCT406 143 217992395
BCT407 140 221014593
BCT408 107 224892129
BCT409 66 162750476
BCT41 10402 13141863
BCT410 107 232528182
BCT411 139 242291322
BCT412 93 307197430
BCT413 97 213849493
BCT414 69 103765359
BCT415 120 221718706
BCT416 120 216127599
BCT417 90 222398003
BCT418 93 254204441
BCT419 32 77923297
BCT42 53922 202025650
BCT420 121 215033983
BCT421 119 228238463
BCT422 120 219166765
BCT423 106 215915148
BCT424 18 31368201
BCT425 144 219919128
BCT426 104 251665529
BCT427 156 212575427
BCT428 159 212139624
BCT429 12 11443917
BCT43 185 214548596
BCT430 238 214458452
BCT431 127 213318904
BCT432 102 217958513
BCT433 110 242026946
BCT434 133 260122026
BCT435 54 138746553
BCT436 101 232702544
BCT437 112 234353938
BCT438 133 217531778
BCT439 104 232455153
BCT44 104 232516945
BCT440 104 218407474
BCT441 47 70027220
BCT442 166 214355582
BCT443 112 222167522
BCT444 134 227273159
BCT445 107 220617954
BCT446 73 218171488
BCT447 140 220805395
BCT448 255 130786256
BCT449 364 210657095
BCT45 116 205561869
BCT450 117 212804246
BCT451 134 211491923
BCT452 150 212215499
BCT453 174 222080619
BCT454 168 211415286
BCT455 47 70668803
BCT456 161 208257957
BCT457 162 212193463
BCT458 114 210605338
BCT459 157 213126972
BCT46 103 222777517
BCT460 132 209356669
BCT461 131 195243107
BCT462 183 210687290
BCT463 116 210811583
BCT464 136 211510245
BCT465 163 218213544
BCT466 52 97685124
BCT467 166 242740607
BCT468 136 228502291
BCT469 137 221771991
BCT47 131 222293417
BCT470 91 220386590
BCT471 143 230374619
BCT472 133 223813694
BCT473 182 192669337
BCT474 107 232838404
BCT475 100 222679480
BCT476 98 229155604
BCT477 62 225248562
BCT478 125 278231109
BCT479 98 231790842
BCT48 123 223122738
BCT480 35 49408160
BCT481 126 234988382
BCT482 136 223683086
BCT483 120 210448459
BCT484 176 219672856
BCT485 133 230121660
BCT486 141 225955605
BCT487 10 28629009
BCT488 106 257225143
BCT489 92 217527271
BCT49 150 224035996
BCT490 158 216707113
BCT491 140 217074444
BCT492 104 225357610
BCT493 128 221059478
BCT494 65 91463211
BCT495 152 246232217
BCT496 129 331051401
BCT497 118 238549476
BCT498 197 249128615
BCT499 97 233048038
BCT5 20643 169641743
BCT50 157 222523995
BCT500 62 168688453
BCT501 100 223567069
BCT502 77 214541590
BCT503 109 234374705
BCT504 124 220655224
BCT505 120 216176916
BCT506 72 76807440
BCT507 127 216734105
BCT508 140 214709902
BCT509 134 233332968
BCT51 103 120901509
BCT510 218 218940077
BCT511 189 181528395
BCT512 133 226910571
BCT513 120 216793972
BCT514 148 239122181
BCT515 134 228454460
BCT516 111 219967608
BCT517 156 206034335
BCT518 152 223412671
BCT519 46 210247612
BCT52 255 227294457
BCT520 243 224229323
BCT521 81 230444606
BCT522 138 219592828
BCT523 55 86174025
BCT524 148 251704567
BCT525 167 241600692
BCT526 188 209247919
BCT527 122 247763716
BCT528 72 222081674
BCT529 125 232055794
BCT53 86 220119558
BCT530 144 224522779
BCT531 127 224590415
BCT532 97 219446041
BCT533 91 208668221
BCT534 113 216837334
BCT535 128 226630130
BCT536 114 216696615
BCT537 91 223626812
BCT538 109 224683749
BCT539 21 54718831
BCT54 113 224688543
BCT540 129 227385316
BCT541 160 222067990
BCT542 159 221685726
BCT543 136 218795682
BCT544 139 245757887
BCT545 114 241074585
BCT546 154 230817412
BCT547 152 218196894
BCT548 86 220948898
BCT549 172 222453219
BCT55 128 222273877
BCT550 116 217623369
BCT551 61 208737714
BCT552 60 209982617
BCT553 88 224430671
BCT554 72 211773664
BCT555 9 32889598
BCT556 74 211800342
BCT557 70 210637645
BCT558 136 216782235
BCT559 134 267178219
BCT56 135 219981644
BCT560 207 241176305
BCT561 83 164259095
BCT562 92 211661888
BCT563 119 224573556
BCT564 108 219315886
BCT565 127 213889086
BCT566 66 215915254
BCT567 123 156724332
BCT568 121 238759328
BCT569 111 226226667
BCT57 111 162805198
BCT570 131 220447902
BCT571 132 243189979
BCT572 94 387150049
BCT573 108 281598547
BCT574 91 317300604
BCT575 199 223348188
BCT576 123 216900210
BCT577 135 282364200
BCT578 79 80058745
BCT579 106 222164517
BCT58 136 223054995
BCT580 84 225289652
BCT581 153 260037182
BCT582 120 246466642
BCT583 265 224865292
BCT584 147 212405338
BCT585 29 71285844
BCT586 158 258439422
BCT587 117 224006946
BCT588 147 216345387
BCT589 130 210125682
BCT59 112 217399067
BCT590 41 60487083
BCT591 112 211778878
BCT592 112 217877416
BCT593 215 213033755
BCT594 151 227292299
BCT595 172 217801417
BCT596 123 222511909
BCT597 150 224039796
BCT598 29 66928777
BCT599 159 222893147
BCT6 2600 37759883
BCT60 131 223635367
BCT600 113 225564539
BCT601 103 219735228
BCT602 140 214939907
BCT603 150 239119567
BCT604 125 217751851
BCT605 48 211644768
BCT606 51 113089379
BCT607 82 210594039
BCT608 119 216986327
BCT609 85 221159132
BCT61 121 221481204
BCT610 91 244263044
BCT611 134 223239878
BCT612 321 211788913
BCT613 93 232078346
BCT614 39 70756114
BCT615 73 211682768
BCT616 88 226835527
BCT617 132 213735952
BCT618 139 210336335
BCT619 56 100045476
BCT62 138 232661918
BCT620 142 206612759
BCT621 111 214974930
BCT622 133 220139614
BCT623 93 219497137
BCT624 26 65917844
BCT625 123 243592447
BCT626 101 228903058
BCT627 146 216100708
BCT628 124 227304053
BCT629 63 109440282
BCT63 108 225781339
BCT630 129 223956588
BCT631 133 239431610
BCT632 111 222095367
BCT633 135 219962700
BCT634 106 219294096
BCT635 95 107235843
BCT636 528 115589384
BCT637 1589 2511957
BCT638 3172 5268484
BCT639 6338 7796395
BCT64 38 50860113
BCT640 12613 14997690
BCT641 25523 27672494
BCT642 50566 54072396
BCT643 148793 156620038
BCT644 14290 193613127
BCT645 3297 203942569
BCT646 2509 213411401
BCT647 7215 212675624
BCT648 164 249069009
BCT649 39928 39703867
BCT65 94 229475332
BCT650 75102 180239641
BCT651 11057 202910557
BCT652 6079 198788687
BCT653 97309 180440763
BCT654 64010 70612839
BCT655 148989 156831999
BCT656 84717 88160222
BCT657 144497 150963243
BCT658 25981 25680207
BCT659 132449 167404561
BCT66 117 227983621
BCT660 31616 43816844
BCT661 116235 178581738
BCT662 7842 17268880
BCT663 32958 53337698
BCT664 31871 246143718
BCT665 6331 295280669
BCT666 83 3605676
BCT667 5035 225442726
BCT668 3847 224092509
BCT669 1442 273316652
BCT67 160 232898310
BCT670 109 222593498
BCT671 55 216844860
BCT672 70 213822191
BCT673 34 137765382
BCT674 69 224394912
BCT675 364 238323955
BCT676 889 289911825
BCT677 316 85816731
BCT678 1274 198668008
BCT679 333 211837174
BCT68 154 221704284
BCT680 514 379401000
BCT681 883 314043216
BCT682 262 70200635
BCT683 3148 246273076
BCT684 719 287380877
BCT685 347 391585216
BCT686 302 299282949
BCT687 362 393266490
BCT688 364 392445913
BCT689 2141 260289909
BCT69 128 238275556
BCT690 63 145106063
BCT691 86 222746849
BCT692 78 227354684
BCT693 3023 245927078
BCT694 1230 124242115
BCT695 1412 261424764
BCT696 47 241352896
BCT697 45 243003094
BCT698 2180 269716913
BCT699 945 54278114
BCT7 1310 133308362
BCT70 114 230664549
BCT700 2288 268994823
BCT701 83 274582043
BCT702 422 283036369
BCT703 3015 248690235
BCT704 11940 19905115
BCT705 25214 42009550
BCT706 118375 188572182
BCT707 115340 191579941
BCT708 89131 154104158
BCT709 103239 197507422
BCT71 54 123393656
BCT710 114774 202450607
BCT711 11031 301594737
BCT712 24005 62653240
BCT72 300 239582260
BCT73 142 231562727
BCT74 354 225466658
BCT75 111 222896198
BCT76 121 213352666
BCT77 120 227473574
BCT78 98 224926366
BCT79 90 224039666
BCT8 191 234251938
BCT80 98 225070223
BCT81 58 138528232
BCT82 53 211054879
BCT83 45 210584326
BCT84 45 210864282
BCT85 45 212727898
BCT86 76 222861078
BCT87 40 115080869
BCT88 112 227959956
BCT89 129 231316827
BCT9 133 236750743
BCT90 99 245428056
BCT91 87 223381451
BCT92 59 181990919
BCT93 93 237302287
BCT94 103 223843089
BCT95 62 225168570
BCT96 64 140507059
BCT97 97 233623581
BCT98 82 229505918
BCT99 100 238937572
ENV1 189917 141857953
ENV10 108668 188622464
ENV11 130439 96471839
ENV12 218974 102573446
ENV13 176367 159885899
ENV14 19576 17074715
ENV15 204686 124198790
ENV16 186229 146015781
ENV17 209630 130953753
ENV18 180188 144831241
ENV19 867 1161555
ENV2 148919 161112716
ENV20 155434 156521494
ENV21 244834 67513617
ENV22 92642 21373597
ENV23 220959 118335235
ENV24 255268 109063044
ENV25 205254 126403606
ENV26 27325 25830310
ENV27 152284 158742123
ENV28 201168 103402490
ENV29 68242 51326142
ENV3 66104 142864281
ENV30 213262 108912885
ENV31 170982 153754059
ENV32 135007 163685580
ENV33 11563 15753400
ENV34 179946 128303673
ENV35 218049 118478075
ENV36 78494 41731965
ENV37 143982 98004547
ENV38 100623 112272168
ENV39 130595 80418666
ENV4 124 288213636
ENV40 173936 138865632
ENV41 163629 139564967
ENV42 179868 114626036
ENV43 200964 107345399
ENV44 196354 109552207
ENV45 111588 97822356
ENV46 158050 134822110
ENV47 145093 136778691
ENV48 169118 47797226
ENV49 172162 133105267
ENV5 83 221317267
ENV50 210937 100424991
ENV51 142425 62208703
ENV52 216479 84260093
ENV53 212742 92633808
ENV54 108073 43435208
ENV55 224284 98781298
ENV56 224806 91746443
ENV57 142909 92473104
ENV58 198698 110742910
ENV59 182658 90464164
ENV6 97 218466622
ENV60 193863 112796693
ENV61 35421 24811293
ENV62 128506 185653274
ENV63 223844 135573436
ENV64 233127 93876800
ENV65 83944 39073637
ENV66 194989 111845706
ENV67 125954 173406080
ENV68 69690 226453405
ENV69 93715 173760917
ENV7 63 204534087
ENV70 92907 98773395
ENV8 76 217162029
ENV9 90 228334822
EST1 152676 59069390
EST10 155710 67094244
EST100 152779 76472112
EST101 145010 99279950
EST102 145172 85253125
EST103 148897 93092661
EST104 7490 4338724
EST105 149617 109417790
EST106 135201 99318378
EST107 136259 97454300
EST108 136240 94831240
EST109 2404 1587299
EST11 163513 69162725
EST110 136753 77271733
EST111 176402 105757775
EST112 193955 119227182
EST113 236919 141661928
EST114 6623 4066903
EST115 229453 127643708
EST116 181481 102909630
EST117 190332 93492765
EST118 5099 3955929
EST119 148552 100253258
EST12 150942 64842625
EST120 154735 119130491
EST121 166280 97900067
EST122 22063 15461205
EST123 130045 82537869
EST124 83544 30919021
EST125 36751 12480016
EST126 84106 31034635
EST127 84264 34515269
EST128 33711 11378339
EST129 85031 32709177
EST13 186631 83471509
EST130 82017 34968192
EST131 83454 35266094
EST132 84118 32965334
EST133 14468 5903340
EST134 83460 51063090
EST135 173481 87480434
EST136 170361 77647991
EST137 145527 91797238
EST138 29659 18775715
EST139 140355 87014374
EST14 104810 47839968
EST140 149335 97877743
EST141 157292 78661333
EST142 181201 92625054
EST143 8925 5196103
EST144 141572 76041757
EST145 151600 73226510
EST146 148413 87031476
EST147 155752 83569790
EST148 11737 6920241
EST149 166215 102160051
EST15 197269 111601119
EST150 202209 107318872
EST151 158863 93287635
EST152 102211 51066648
EST153 155639 79042501
EST154 135075 80133731
EST155 141690 88158876
EST156 165810 85752287
EST157 9314 5218716
EST158 178963 104151551
EST159 218711 94419352
EST16 147215 104725379
EST160 145773 85810763
EST161 161375 87629314
EST162 3060 1522277
EST163 140669 82402624
EST164 132523 83741460
EST165 147238 88249661
EST166 146462 80715254
EST167 20637 10461944
EST168 117769 61073260
EST169 115690 61941713
EST17 156631 83466519
EST170 122419 54128062
EST171 121107 48630686
EST172 29423 11431564
EST173 122215 48678047
EST174 125709 48482605
EST175 165795 83310643
EST176 172205 75576921
EST177 24657 15513157
EST178 147743 104364925
EST179 163429 99358064
EST18 190911 116773263
EST180 205284 116217156
EST181 167158 93374413
EST182 154060 103298566
EST183 134220 92974687
EST184 10749 5997163
EST185 146581 94120314
EST186 155009 80959121
EST187 131944 71058948
EST188 160858 90605442
EST189 13366 8452045
EST19 177388 113010572
EST190 148858 87654837
EST191 153703 95468899
EST192 175524 99184355
EST193 140440 77141908
EST194 5051 4140877
EST195 123969 64274913
EST196 162879 90940215
EST197 173145 99559397
EST198 149576 92840312
EST199 6122 3844858
EST2 157284 60511718
EST20 71052 55760620
EST200 164744 79130838
EST201 122494 84334397
EST202 163360 96333381
EST203 163857 96044460
EST204 14391 6877097
EST205 5847 2580354
EST206 111104 63044686
EST207 151119 87067568
EST208 107291 63581253
EST209 164131 100717476
EST21 194392 109146345
EST210 168271 124553548
EST211 82827 67366748
EST212 186418 95121486
EST213 145276 90199387
EST214 87375 65650378
EST215 141901 85212151
EST216 137926 75159382
EST217 95589 30683406
EST218 146906 86273980
EST219 148603 82462097
EST22 179812 92396298
EST220 141349 94228845
EST221 155430 90012111
EST222 9685 6801701
EST223 161751 99534043
EST224 154087 93665386
EST225 123359 88322855
EST226 146025 90242566
EST227 6970 4220792
EST228 128831 82021098
EST229 127856 89666249
EST23 107373 50539677
EST230 44462 31954010
EST231 156437 83335784
EST232 167399 92029513
EST233 166930 92691856
EST234 158117 88078491
EST235 163896 91508682
EST236 163228 92242200
EST237 166033 91294921
EST238 154891 85088026
EST239 168030 90687163
EST24 190973 61391053
EST240 187909 98489047
EST241 191353 107062803
EST242 168339 100302935
EST243 180025 103224685
EST244 190025 112759300
EST245 186323 113230756
EST246 178009 115392159
EST247 7072 5608087
EST248 140678 86230531
EST249 212608 138834650
EST25 136526 39210780
EST250 226939 111326329
EST251 164069 113913134
EST252 183146 95756964
EST253 197974 98471029
EST254 123046 89289573
EST255 7475 5185523
EST256 140224 82365172
EST257 206165 112641063
EST258 162520 106390912
EST259 93652 92365147
EST26 102354 27619605
EST260 15350 19976681
EST261 147622 99189632
EST262 150774 89759199
EST263 139090 101684880
EST264 216253 99322877
EST265 4727 2907563
EST266 133637 96436732
EST267 130217 90890958
EST268 135712 98383498
EST269 113483 81457151
EST27 201338 85169852
EST270 16459 10390451
EST271 136224 84348047
EST272 125703 85851017
EST273 127790 96577160
EST274 36547 26163272
EST275 126643 89388805
EST276 116516 79036312
EST277 139027 83785347
EST278 145967 114893564
EST279 15453 10925903
EST28 19821 8893541
EST280 125396 117389437
EST281 132432 98774167
EST282 162340 97564182
EST283 165664 104470460
EST284 19254 12068797
EST285 142161 92405331
EST286 168942 115087684
EST287 151762 103954467
EST288 136291 103153979
EST289 3472 2297545
EST29 203801 100091766
EST290 159549 97229973
EST291 222526 90766361
EST292 152836 111325212
EST293 160406 71767282
EST294 10503 1187900
EST295 208917 37980980
EST296 212285 83331327
EST297 150079 115258622
EST298 168111 97765915
EST299 154828 103149855
EST3 156018 54727700
EST30 216481 109022941
EST300 169088 109995841
EST301 149601 109949487
EST302 1952 1321395
EST303 180770 102249348
EST304 178557 93088450
EST305 168968 109476676
EST306 158897 104102874
EST307 2390 1907522
EST308 225882 106204624
EST309 266222 115901760
EST31 153821 67061608
EST310 185439 112102698
EST311 151095 28710339
EST312 227854 99483966
EST313 175580 100342945
EST314 156175 99883140
EST315 159745 95019896
EST316 525 396575
EST317 166298 114042738
EST318 179946 95180769
EST319 143779 97256505
EST32 149596 63761513
EST320 188320 110423173
EST321 187360 49128528
EST322 201669 33864879
EST323 174165 95391984
EST324 14772 9232819
EST325 158235 113265480
EST326 184738 110428476
EST327 167353 97720475
EST328 166040 109775280
EST329 165849 71375282
EST33 165157 65679151
EST330 127597 80015094
EST331 121219 80441264
EST332 146648 101336767
EST333 22532 8283129
EST334 250611 26632520
EST335 254708 23392212
EST336 152004 94195783
EST337 152251 98608210
EST338 150983 99687094
EST339 145900 92251874
EST34 147003 64492650
EST340 237636 43477911
EST341 185544 80778185
EST342 4107 5063062
EST343 168803 99761533
EST344 164003 101147652
EST345 145654 92760457
EST346 189445 103114623
EST347 156145 109738352
EST348 153298 101564640
EST349 2420 913051
EST35 162551 70856183
EST350 184315 108348454
EST351 169901 94661420
EST352 169190 105188763
EST353 178517 59673569
EST354 195269 72030896
EST355 194748 75388710
EST356 197291 74551080
EST357 134728 70211808
EST358 174807 127367579
EST359 148418 85121620
EST36 160819 65982591
EST360 150542 86642955
EST361 121468 94919785
EST362 5854 4644851
EST363 142698 94365777
EST364 155336 94313585
EST365 162093 90167053
EST366 157050 100309842
EST367 23518 10346655
EST368 45656 24624838
EST369 155288 104534407
EST37 107941 33682655
EST370 137851 97031462
EST371 158402 101964430
EST372 152636 109696961
EST373 30256 25775278
EST374 173564 146756127
EST375 163563 85431475
EST376 127556 80910067
EST377 137828 94040600
EST378 51292 35914739
EST379 131619 88276056
EST38 99513 30489875
EST380 137093 89601408
EST381 139337 96986761
EST382 147122 97080674
EST383 51285 41115140
EST384 164163 86543504
EST385 143622 81414969
EST386 144917 86070913
EST387 144174 103725090
EST388 155671 93199334
EST389 137838 87384737
EST39 99154 31399112
EST390 132359 84149472
EST391 20620 12734823
EST392 196942 107257732
EST393 136851 75001285
EST394 92969 54570705
EST395 120408 80237774
EST396 23482 14313208
EST397 131163 83003777
EST398 119637 76596555
EST399 147263 80737135
EST4 142970 56362163
EST40 98816 29786908
EST400 210375 82562247
EST401 30522 12819862
EST402 163629 84365124
EST403 163915 99171904
EST404 159146 95828367
EST405 125988 81300508
EST406 12160 7968720
EST407 129505 86703580
EST408 137395 90180185
EST409 178549 111876264
EST41 39236 11600145
EST410 154172 93123054
EST411 27990 12149071
EST412 166708 92005722
EST413 168827 124876464
EST414 87405 56144079
EST415 69679 41105540
EST416 34123 16799504
EST417 137508 79953191
EST418 82435 49421981
EST419 139695 56837590
EST42 101326 31351096
EST420 148165 29996844
EST421 148030 30296764
EST422 162600 80122839
EST423 28322 14992272
EST424 201213 115842274
EST425 237755 108748070
EST426 220149 107478214
EST427 127109 74510332
EST428 128057 85803248
EST429 131704 80409324
EST43 102633 36243427
EST430 93228 56881081
EST431 173929 109988692
EST432 212993 84747061
EST433 106893 28534631
EST434 183805 112197780
EST435 204013 111450866
EST436 179865 106142376
EST437 199825 118151636
EST438 132833 62169230
EST439 110244 60113023
EST44 95475 48218258
EST440 162601 108614110
EST441 181152 115720728
EST442 108077 86015819
EST443 177406 140114098
EST444 150416 90428046
EST445 53727 34187139
EST446 166032 106944103
EST447 178087 101018025
EST448 43119 24597584
EST449 195531 106623447
EST45 121121 52335541
EST450 183938 94245324
EST451 52079 38877556
EST452 189908 115817461
EST453 180010 117991164
EST454 54577 33991762
EST455 196573 133887305
EST456 219857 123775014
EST457 190083 126954064
EST458 183884 144616432
EST459 204235 155997292
EST46 55810 33167886
EST460 192186 115131159
EST461 160758 96336780
EST462 181270 94921265
EST463 7384 612769
EST464 53496 4381716
EST465 158232 12239421
EST466 144975 12987161
EST467 147925 29931089
EST468 148356 29501756
EST469 8452 1761940
EST47 176557 89017795
EST470 148043 30264080
EST471 141212 81174487
EST472 171840 100381630
EST473 161774 110922860
EST474 18852 13395857
EST475 160785 92772870
EST476 150648 104119894
EST477 133680 93216225
EST478 141645 98056185
EST479 16394 8452879
EST48 158183 65088174
EST480 157370 103674753
EST481 146436 105285396
EST482 162033 97575888
EST483 165803 50894471
EST484 11878 1866206
EST485 160476 40344382
EST486 150798 102143723
EST487 146645 96524317
EST488 170799 112268881
EST489 21942 11899307
EST49 162221 91938423
EST490 132802 75912771
EST491 189822 108023075
EST492 149513 109146009
EST493 53113 36044831
EST494 126855 87064282
EST495 145520 90206486
EST496 148563 89395105
EST497 163379 89043681
EST498 35622 18161574
EST499 151814 92135788
EST5 162046 62591557
EST50 154876 80579871
EST500 155897 91913883
EST501 168335 101985873
EST502 136358 85417323
EST503 15923 9003037
EST504 100253 71169364
EST505 78626 60620272
EST506 97487 64759548
EST507 143372 80452947
EST508 37226 21222196
EST509 120541 73310508
EST51 156390 74771983
EST510 133322 87344399
EST511 135156 79264445
EST512 151334 92889729
EST513 47409 25670700
EST514 155632 85768724
EST515 184604 110437315
EST516 120133 78946746
EST517 178634 94897730
EST518 5700 2164098
EST519 52576 18674859
EST52 108219 61222574
EST520 182549 100653795
EST521 152367 81445617
EST522 22854 13814836
EST523 162316 94446797
EST524 211236 123658554
EST525 30185 19341621
EST526 147947 99619943
EST527 158450 97593385
EST528 134306 87493560
EST529 128606 87864927
EST53 153908 88947693
EST530 26187 16360625
EST531 178675 74362205
EST532 179255 79447754
EST533 198851 83514482
EST534 194840 80581746
EST535 3966 1342650
EST536 178841 95307232
EST537 174453 102491582
EST538 180226 107868953
EST539 171846 103644370
EST54 154192 84966111
EST540 196638 126473040
EST541 186318 103089437
EST542 178897 82814695
EST543 147550 94078204
EST544 206518 125003286
EST545 205657 126701639
EST546 188926 108266858
EST547 208317 121345654
EST548 34317 17820709
EST549 154052 96415299
EST55 152219 92235100
EST550 188393 117732246
EST551 166519 98776846
EST552 133844 98369794
EST553 8620 7015823
EST554 157219 92146041
EST555 170362 84878810
EST556 149196 85129124
EST557 151162 81926136
EST558 11957 7151607
EST559 156468 79958243
EST56 150016 69955319
EST560 181241 106307122
EST561 162168 102986945
EST562 175078 107764282
EST563 4064 2799714
EST564 170731 117095565
EST565 183761 113529611
EST566 129212 83785356
EST567 168582 97327409
EST568 184819 110401899
EST569 37263 24341790
EST57 142162 76714634
EST570 204465 119127975
EST571 269500 91747576
EST572 25706 9441749
EST573 262208 83553217
EST574 157809 57578785
EST575 162272 59124446
EST576 80841 30900587
EST58 151712 83218730
EST59 161193 65788370
EST6 166112 64978985
EST60 144589 70133092
EST61 160365 89939140
EST62 150338 92593245
EST63 150109 99271395
EST64 157599 94514967
EST65 2728 1149257
EST66 154753 103415401
EST67 162949 82998651
EST68 166589 84840478
EST69 142352 77836923
EST7 163847 67720676
EST70 148310 82501319
EST71 149036 86112123
EST72 148460 92218214
EST73 150607 87461804
EST74 3197 1891718
EST75 29919 18235506
EST76 186623 102758272
EST77 170455 90769208
EST78 212135 115450370
EST79 179537 103352293
EST8 161153 67905615
EST80 2595 1769868
EST81 196745 121640362
EST82 167538 93335522
EST83 136016 63285525
EST84 128080 62611529
EST85 11176 5735615
EST86 150337 92597771
EST87 154535 96917359
EST88 130219 66325490
EST89 140169 89295213
EST9 169372 69362188
EST90 14601 7583982
EST91 183459 91893008
EST92 204450 119806817
EST93 202071 108015966
EST94 192047 90419584
EST95 203805 86998966
EST96 145901 86952813
EST97 137794 84714119
EST98 158915 76746036
EST99 9280 6073374
GSS1 172818 126565512
GSS10 15067 14537267
GSS100 156116 139401502
GSS101 16660 10968419
GSS102 168717 143963327
GSS103 157878 109070809
GSS104 156130 106446641
GSS105 152742 105720870
GSS106 168005 122783070
GSS107 149452 126270758
GSS108 161684 125096177
GSS109 186494 115925678
GSS11 145620 106560749
GSS110 16921 10328517
GSS111 185687 119751799
GSS112 201287 103923207
GSS113 219850 124105831
GSS114 87618 57033670
GSS115 151983 114077516
GSS116 155174 118808941
GSS117 155138 118870338
GSS118 163306 106817361
GSS119 37488 21562888
GSS12 199550 104018945
GSS120 179013 131661113
GSS121 189765 117491847
GSS122 166053 55057548
GSS123 169938 76249060
GSS124 3108 2065491
GSS125 161448 105035511
GSS126 188861 124688564
GSS127 200296 82002210
GSS128 168220 79987296
GSS129 137268 94431217
GSS13 191750 84122956
GSS130 129855 104605133
GSS131 132043 108777560
GSS132 132451 106048276
GSS133 8056 5958858
GSS134 135214 112032054
GSS135 56598 47104660
GSS136 132584 107786768
GSS137 139149 116140565
GSS138 140043 114408742
GSS139 138251 109584898
GSS14 173813 89351023
GSS140 4155 2820771
GSS141 134784 106426486
GSS142 134049 108003847
GSS143 134400 111531585
GSS144 138188 116474348
GSS145 4675 3643453
GSS146 139468 108106612
GSS147 136810 113648547
GSS148 136898 113473892
GSS149 137299 112649085
GSS15 1923 979546
GSS150 559 466085
GSS151 137155 110923756
GSS152 134480 106278327
GSS153 133002 107665198
GSS154 138659 116136290
GSS155 1985 1674795
GSS156 127182 92203837
GSS157 174120 105055177
GSS158 184500 110115659
GSS159 162396 108642438
GSS16 167993 83936759
GSS160 177410 102425568
GSS161 196159 128786237
GSS162 201517 133289997
GSS163 200700 134079741
GSS164 180292 126051152
GSS165 198341 136948587
GSS166 196713 139067120
GSS167 196064 138671402
GSS168 174299 134354206
GSS169 144508 97362152
GSS17 159730 81436785
GSS170 138069 80500295
GSS171 165312 73476193
GSS172 130246 57949597
GSS173 162971 140972883
GSS174 170932 113513648
GSS175 80873 52981024
GSS176 191836 128985792
GSS177 196309 117886155
GSS178 28746 15068170
GSS179 180225 98140530
GSS18 155963 85601456
GSS180 181302 123365801
GSS181 178800 126906476
GSS182 181098 127179984
GSS183 19114 12799890
GSS184 165902 130533276
GSS185 170769 155442034
GSS186 219492 123624062
GSS187 216568 103419657
GSS188 17938 8362456
GSS189 210015 95106166
GSS19 153512 95921722
GSS190 156358 134161974
GSS191 7028 6973186
GSS192 125540 102753347
GSS193 122235 93469471
GSS194 156641 154268782
GSS195 167926 158459909
GSS196 131396 104305071
GSS197 149360 107958474
GSS198 170087 141609204
GSS199 173854 119768130
GSS2 172571 106974251
GSS20 153653 72718658
GSS200 20783 12070044
GSS201 181326 133978343
GSS202 184903 120111167
GSS203 180120 93026884
GSS204 172833 121727487
GSS205 189431 117159380
GSS206 189632 116856204
GSS207 21296 12387505
GSS208 200656 130020228
GSS209 215713 142627344
GSS21 106600 59132682
GSS210 217639 140378671
GSS211 166383 136378793
GSS212 152463 108698263
GSS213 159548 120181227
GSS214 159222 144721352
GSS215 159697 141539706
GSS216 10 9109
GSS217 160025 145012269
GSS218 161623 143744366
GSS219 162207 142682743
GSS22 132522 64635660
GSS220 161901 124660013
GSS221 168118 139542770
GSS222 162158 116272085
GSS223 180581 88741808
GSS224 2336 1590941
GSS225 251369 52150506
GSS226 262481 40466091
GSS227 262523 40408947
GSS228 122800 38229504
GSS229 253355 52912344
GSS23 125192 56723722
GSS230 182565 86129448
GSS231 188824 55952203
GSS232 154340 118464017
GSS233 177033 144334259
GSS234 160566 145786280
GSS235 158963 146486119
GSS236 175119 110481562
GSS237 238210 57319690
GSS238 198799 101427029
GSS239 228515 39541879
GSS24 133968 72981771
GSS240 119354 74753574
GSS241 173535 111783710
GSS242 148018 90088400
GSS243 140583 83904986
GSS244 159747 149647065
GSS245 6363 5417290
GSS246 112668 95722541
GSS247 180351 149222837
GSS248 172952 122406011
GSS249 201906 127716686
GSS25 142794 74274291
GSS250 188212 120277412
GSS251 166175 94403497
GSS252 159865 84500591
GSS253 156428 119869599
GSS254 203515 148105542
GSS255 14310 9406216
GSS256 171523 67875770
GSS257 176316 96175653
GSS258 195480 152066346
GSS259 199052 153893384
GSS26 12574 5388027
GSS260 8581 7079434
GSS261 197557 157030943
GSS262 197584 124265372
GSS263 194871 142522000
GSS264 895 619641
GSS265 214910 131529849
GSS266 189958 57638588
GSS267 211832 108819063
GSS268 177255 156983326
GSS269 163847 150141472
GSS27 140896 65655631
GSS270 234900 132469785
GSS271 240184 119740822
GSS28 159848 79832938
GSS29 156477 92542330
GSS3 138091 115757733
GSS30 164870 85222547
GSS31 10249 5303517
GSS32 171961 102867176
GSS33 182793 109077642
GSS34 182275 87047073
GSS35 172993 102196407
GSS36 190487 103919871
GSS37 162239 112347665
GSS38 160381 98321810
GSS39 173084 108449557
GSS4 140070 112435838
GSS40 4447 3196273
GSS41 183985 122974505
GSS42 181741 117322404
GSS43 52286 27335335
GSS44 177820 102905200
GSS45 164518 141969870
GSS46 179633 148569334
GSS47 139686 92499212
GSS48 182873 132017102
GSS49 181617 114554523
GSS5 12740 9526334
GSS50 204428 116967955
GSS51 185581 99459566
GSS52 211954 108037045
GSS53 211747 108318359
GSS54 197283 132772792
GSS55 158243 124832316
GSS56 185583 139405028
GSS57 196772 63136393
GSS58 171739 96411428
GSS59 157707 106161954
GSS6 152750 116376137
GSS60 23373 13575160
GSS61 166615 156644394
GSS62 177186 98817414
GSS63 161235 115244635
GSS64 172264 112294127
GSS65 175437 118749924
GSS66 184317 127706706
GSS67 205680 128787401
GSS68 187487 111746271
GSS69 904 494120
GSS7 170822 119987739
GSS70 200507 134082593
GSS71 215979 158545254
GSS72 188980 137988156
GSS73 173702 107612445
GSS74 198148 111946385
GSS75 140507 76313882
GSS76 163068 95818066
GSS77 10997 7015314
GSS78 159270 97756741
GSS79 159481 96970229
GSS8 177093 108887079
GSS80 172285 114351414
GSS81 170749 109399099
GSS82 174615 122489482
GSS83 188970 105357676
GSS84 175441 126369286
GSS85 163963 106290421
GSS86 1132 892150
GSS87 189457 108639065
GSS88 181511 114052212
GSS89 166781 118041057
GSS9 141917 118718919
GSS90 192391 105704299
GSS91 9229 5330602
GSS92 213831 107550639
GSS93 226833 89047322
GSS94 213068 138993481
GSS95 183490 92580894
GSS96 94686 37020965
GSS97 193805 75823638
GSS98 201086 123394316
GSS99 191020 122180795
HTC1 41190 63371632
HTC2 32318 72271528
HTC3 32081 77888423
HTC4 84851 50686507
HTC5 129507 161162980
HTC6 125281 123134227
HTC7 137566 130735831
HTC8 68152 61421264
HTG1 3784 374870703
HTG10 2848 363016285
HTG11 1976 365940103
HTG12 1714 382089084
HTG13 1718 381796340
HTG14 1659 383118453
HTG15 1835 380424998
HTG16 1750 361896240
HTG17 1843 380599315
HTG18 1752 382301790
HTG19 1775 381824019
HTG2 5068 373604329
HTG20 1891 380883515
HTG21 2135 355865123
HTG22 2426 376351102
HTG23 2269 379507879
HTG24 2442 381163865
HTG25 2175 382733656
HTG26 2070 368006459
HTG27 2074 380458182
HTG28 2061 380108509
HTG29 1047 202962639
HTG3 2556 370662362
HTG30 2040 379446758
HTG31 2203 375546591
HTG32 986 170706729
HTG33 2152 379221269
HTG34 2348 376393195
HTG35 1372 195850538
HTG36 2462 370234045
HTG37 2428 372528369
HTG38 1015 169191937
HTG39 2235 381490266
HTG4 2735 369989641
HTG40 2336 385145188
HTG41 1069 180930974
HTG42 2312 384776536
HTG43 2363 384490832
HTG44 906 155597869
HTG45 2500 379735659
HTG46 2319 385244375
HTG47 927 158722850
HTG48 2315 385567657
HTG49 2293 386023883
HTG5 2500 373389217
HTG50 900 149450476
HTG51 2237 385154833
HTG52 2106 380011723
HTG53 657 122585305
HTG54 2010 379525743
HTG55 1981 378955508
HTG56 1184 193581815
HTG57 2144 380658486
HTG58 2686 383430148
HTG59 2972 383122016
HTG6 2 386956
HTG60 885 128384665
HTG61 2959 380503057
HTG62 3012 366231486
HTG63 2990 372824610
HTG64 2953 336850403
HTG65 3178 359117111
HTG66 3179 359260560
HTG67 3186 360427818
HTG68 3128 367889098
HTG69 2913 377859052
HTG7 2327 375791086
HTG70 1846 312468258
HTG71 3415 365492036
HTG72 2071 381329139
HTG73 1668 298160154
HTG74 2088 382520375
HTG75 2244 384445864
HTG76 1669 296247510
HTG77 2201 385233869
HTG78 2249 384504439
HTG79 3218 384021459
HTG8 1500 384347777
HTG80 2165 384532378
HTG81 3034 373057359
HTG82 2057 208377779
HTG9 1582 384062276
INV1 154211 140122921
INV10 14 359428768
INV100 38880 329077136
INV101 150515 102090831
INV102 32988 23665040
INV103 148734 103481508
INV104 151725 116077172
INV105 122434 84105854
INV106 154561 113292866
INV107 153214 120313428
INV108 54840 36600696
INV109 152550 109215065
INV11 9 363281720
INV110 153275 115183839
INV111 37636 32593485
INV112 141194 88276990
INV113 147302 93543097
INV114 44605 33726338
INV115 147845 97101715
INV116 138812 81288441
INV117 43601 25835317
INV118 138030 82544524
INV119 137808 82609091
INV12 52 355336707
INV120 54182 35767631
INV121 138717 83226001
INV122 135048 98663257
INV123 75408 58984175
INV124 141733 107958109
INV125 150328 120570595
INV126 155757 117803726
INV127 109682 220497962
INV128 10948 22550333
INV129 181112 235169059
INV13 14 371434550
INV130 218151 167649786
INV131 38629 187147326
INV132 800 42674647
INV133 566 40635863
INV134 8037 115580217
INV135 23265 332345847
INV136 23319 172531536
INV137 67585 303875862
INV138 121343 264933975
INV139 66775 80327893
INV14 78 134821644
INV140 180562 231780487
INV141 41599 303967104
INV142 314 393292454
INV143 1015 105322314
INV144 2059 383654064
INV145 2 41011863
INV146 591 361654729
INV147 8 378508614
INV148 974 354275690
INV149 6 380479040
INV15 6 384224499
INV150 2 95552909
INV151 22 390382246
INV152 10036 362338941
INV153 377 367082657
INV154 3415 40188607
INV155 1 685423969
INV156 1 640667275
INV157 1 639123876
INV158 1 612949391
INV159 1 577192767
INV16 14 379706462
INV160 1 641629864
INV161 497 320978344
INV162 2 371500015
INV163 2 289902239
INV164 2965 358959205
INV165 59277 333080486
INV166 34 383065485
INV167 19 393344928
INV168 14 327270017
INV169 27 393651567
INV17 34 389278640
INV170 32 390738662
INV171 24 383706815
INV172 25 382049854
INV173 31 378115211
INV174 13 297748085
INV175 18 387848062
INV176 24 381271345
INV177 36 390867092
INV178 34 389743485
INV179 26 391141334
INV18 19 320912664
INV180 19 292893418
INV181 11 371260264
INV182 19 391738075
INV183 12 391781067
INV184 13 372901688
INV185 32 389502835
INV186 22 330411078
INV187 29 389284801
INV188 38 387663352
INV189 17 367589223
INV19 1 83304076
INV190 12 387517245
INV191 17 362786034
INV192 10 320557524
INV193 13 376469258
INV194 35 380323776
INV195 26 392110960
INV196 24 388964019
INV197 21 391745060
INV198 22 309540561
INV199 27 392282931
INV2 2291 316412759
INV20 3 241225934
INV200 24 388632304
INV201 12 375724207
INV202 16 393313708
INV203 13 392068861
INV204 10 277290815
INV205 15 358735036
INV206 11 386907833
INV207 16 377160064
INV208 21 392427759
INV209 5 215849302
INV21 3 393880593
INV210 15 382505853
INV211 743 382889760
INV212 26 386022184
INV213 28 394591284
INV214 7 307846648
INV215 4 182170525
INV216 2 342421305
INV217 2 269826459
INV218 18 385786230
INV219 1901 346423954
INV22 3 261336042
INV220 8863 319021282
INV221 11615 311682508
INV222 29307 83537282
INV223 149582 106173057
INV224 152640 93741498
INV225 83755 48758869
INV226 150998 93683419
INV227 150814 109808720
INV228 60196 50940703
INV229 151337 122945289
INV23 3 322765503
INV230 149605 121337544
INV231 82535 67105604
INV232 149060 114532347
INV233 143527 123224195
INV234 83505 103921542
INV235 145492 124980267
INV236 123968 131508095
INV237 1560 380239679
INV238 3679 325540953
INV239 96781 321023124
INV24 2 265971290
INV240 217342 232110336
INV241 60949 250981301
INV242 104213 292697254
INV243 28749 364829410
INV244 1766 378350697
INV245 2736 196647685
INV246 184144 268358078
INV247 1785 378880292
INV248 5583 374469857
INV249 20768 153711624
INV25 4 328757598
INV250 288223 205808194
INV251 1224 379793465
INV252 4515 373876603
INV253 92490 210334617
INV254 391527 140904810
INV255 109733 258294965
INV256 62463 308727005
INV257 4162 375136162
INV258 44629 350112618
INV259 2155 4626806
INV26 5 378753109
INV260 298725 199657065
INV261 214334 249067665
INV262 2226 377046597
INV263 19303 366955288
INV264 16948 41978773
INV265 298408 186907243
INV266 1355 379516794
INV267 3687 378313727
INV268 136930 300095839
INV269 38349 357698579
INV27 5 371191486
INV270 664 92151452
INV271 8529 370827851
INV272 197744 256830145
INV273 359558 128682792
INV274 93023 322972837
INV275 2568 378355489
INV276 61847 343439542
INV277 128238 269260340
INV278 14 202218402
INV279 15 379655485
INV28 4 376987297
INV280 6 355188453
INV281 1 239744465
INV282 1 231634122
INV283 1 221096292
INV284 1 220877407
INV285 1 216720617
INV286 1 210676062
INV287 2 387811394
INV288 2 329972158
INV289 2 302384449
INV29 4 293537168
INV290 20 360081608
INV291 9 301825222
INV292 23 382490317
INV293 23 380735444
INV294 18 387931948
INV295 33 390736486
INV296 780 381140152
INV297 20 391287680
INV298 2 32244328
INV299 27 388830496
INV3 104572 181901181
INV30 4 373434888
INV300 21 386972019
INV301 9 351834369
INV302 5 163634948
INV303 1 292306469
INV304 1 164045107
INV305 2 318230244
INV306 855 391020194
INV307 30 391515590
INV308 25 383908286
INV309 25 388289419
INV31 42 369246043
INV310 3 49480870
INV311 25 384967207
INV312 26 391482668
INV313 22 392427991
INV314 26 383547221
INV315 26 265978999
INV316 6 371290168
INV317 13 374069663
INV318 19 385560269
INV319 15 373391572
INV32 85 349384053
INV320 13 350978987
INV321 22 386100611
INV322 24 386055502
INV323 23 389090030
INV324 31 366704932
INV325 12 307588661
INV326 24 393918543
INV327 16 362929629
INV328 8 361035446
INV329 13 369493806
INV33 79793 267060188
INV330 13 384884009
INV331 18 390461886
INV332 22 394170044
INV333 11 336163521
INV334 6 353407420
INV335 7 372089599
INV336 3 84055540
INV337 9 390324178
INV338 19 393988728
INV339 11 137914990
INV34 73258 60629893
INV340 1 346874609
INV341 1 248688513
INV342 1 195213701
INV343 21 389226046
INV344 16 380802157
INV345 17 384888603
INV346 24 390785021
INV347 14 272669524
INV348 19 394017224
INV349 17 391933486
INV35 167061 133956989
INV350 7 291754234
INV351 2 360067285
INV352 1 158111693
INV353 5 390880948
INV354 1 269711166
INV355 1 265788494
INV356 5 389225578
INV357 8 84827761
INV358 32 385162699
INV359 29 391336068
INV36 127000 112715931
INV360 26 380265073
INV361 8 257485661
INV362 20 383534539
INV363 18 388997674
INV364 13 372064491
INV365 12 246225518
INV366 18 394216238
INV367 18 380558243
INV368 10 378653212
INV369 35 286756574
INV37 37136 273256295
INV370 57 386542022
INV371 41 394290459
INV372 30 391877099
INV373 23 388833300
INV374 17 384297034
INV375 16 391613329
INV376 12 375795023
INV377 26 391638042
INV378 20 380480634
INV379 22 271076993
INV38 2779 371575686
INV380 29 389236155
INV381 23 387510109
INV382 25 393194949
INV383 29 393406758
INV384 10 389413895
INV385 12 256001243
INV386 25 382453876
INV387 25 387644779
INV388 17 390017898
INV389 13 185974631
INV39 44 370097884
INV390 1 252586203
INV391 2 382245123
INV392 1 170640157
INV393 3 172715237
INV394 1 265601162
INV395 1 235131548
INV396 8 377013040
INV397 18 389308576
INV398 6 76294397
INV399 2 316929497
INV4 59421 271469004
INV40 24 379282269
INV400 5 371999024
INV401 13 377525467
INV402 22 380131966
INV403 4 94235370
INV404 20 386111019
INV405 10 330750052
INV406 8 388492156
INV407 29 385235322
INV408 3 68204675
INV409 1 375708846
INV41 5 76533839
INV410 156 377889012
INV411 3 72566929
INV412 18 393806697
INV413 12 375328864
INV414 13 388485421
INV415 17 389690952
INV416 10 355855682
INV417 12 388165924
INV418 5 66893570
INV419 2 334507981
INV42 32 391299062
INV420 2 271847796
INV421 9 384970046
INV422 14 380331769
INV423 17 331062789
INV424 4 353245537
INV425 5 361980503
INV426 1 66459093
INV427 6 375950524
INV428 11 380698960
INV429 13 393299321
INV43 25 362900281
INV430 16 371834617
INV431 4 107829629
INV432 16 390859621
INV433 35 393136677
INV434 18 389411089
INV435 79 348191088
INV436 10 366985680
INV437 18 382945053
INV438 3 55752453
INV439 23 351194891
INV44 18 380479131
INV440 4 361297550
INV441 9 382900679
INV442 16 391635138
INV443 22 382293034
INV444 15 196095018
INV445 12 326431359
INV446 3 345780114
INV447 4 385052575
INV448 7 393658431
INV449 34 353200314
INV45 19 390062857
INV450 2 278332741
INV451 8 361353987
INV452 10 379658367
INV453 13 380787037
INV454 8 386860579
INV455 6 361028373
INV456 3 168396230
INV457 7 375518624
INV458 11 388354722
INV459 34 385429758
INV46 5 134896453
INV460 20 384238059
INV461 9 372379570
INV462 10 251128019
INV463 11 370878851
INV464 38 392392993
INV465 39 383674587
INV466 29 392907305
INV467 24 381869223
INV468 13 164951452
INV469 41 380881166
INV47 18 373966012
INV470 15 386326246
INV471 9 137942415
INV472 1 410988561
INV473 2 347081175
INV474 2 60458881
INV475 1 429819325
INV476 1 230177572
INV477 2 394052085
INV478 35 354776638
INV479 7 318208416
INV48 24 386582132
INV480 5 336561253
INV481 7 357043306
INV482 7 262116983
INV483 1 170575982
INV484 2 287036945
INV485 2 275604705
INV486 3 367947227
INV487 3 342256987
INV488 5 256844362
INV489 13 321847114
INV49 8 380395300
INV490 5 332460113
INV491 95 319933371
INV492 12 328718900
INV493 9 217598510
INV494 20 352503315
INV495 9 379049671
INV496 14 374215308
INV497 15 347131978
INV498 3 328312092
INV499 4 369177951
INV5 37250 77357097
INV50 19 379365223
INV500 3 246468438
INV501 5 376372316
INV502 11 376604127
INV503 17 381822991
INV504 22 391138986
INV505 6 54648714
INV506 12 377183847
INV507 20 388948614
INV508 18 377484507
INV509 27 389125135
INV51 9 138772803
INV510 7 92098153
INV511 22 381784561
INV512 21 380590911
INV513 13 371720425
INV514 17 390781836
INV515 3 78204341
INV516 17 377301939
INV517 12 357316218
INV518 6 368644317
INV519 11 310901032
INV52 28 391443577
INV520 11 175929272
INV521 22 392193755
INV522 13 360806743
INV523 11 375564408
INV524 9 362288897
INV525 3 377576368
INV526 4 158823784
INV527 12 376095937
INV528 6 372905819
INV529 7 388366567
INV53 28 392100242
INV530 7 351386075
INV531 12 377931078
INV532 10 168222845
INV533 21 336280653
INV534 11 387853015
INV535 17 383594904
INV536 12 371624632
INV537 4 205127384
INV538 1 255265360
INV539 1 230794410
INV54 45 382097969
INV540 2 372619140
INV541 2 311523487
INV542 13 393665610
INV543 24 199571394
INV544 2 323510804
INV545 12 381394394
INV546 12 281321844
INV547 6 301645505
INV548 3 327580854
INV549 2 283053804
INV55 27 372689086
INV550 4 358883688
INV551 3 313487646
INV552 12 372628339
INV553 11 296511468
INV554 12 205288598
INV555 1 329103898
INV556 1 266482116
INV557 1 255371252
INV558 1 249620899
INV559 20081 322724895
INV56 18 385206419
INV57 12 373566826
INV58 1 94407144
INV59 15 381614547
INV6 129081 165754942
INV60 29 387067226
INV61 25 384930026
INV62 18 381070342
INV63 96848 235149453
INV64 124341 97247568
INV65 28932 319690973
INV66 28941 347133943
INV67 20 388604938
INV68 15 389699299
INV69 16 252138391
INV7 207 346774014
INV70 34 391108693
INV71 71 392017627
INV72 24 388974367
INV73 21 381982755
INV74 20 377528210
INV75 24 388990898
INV76 29 394663938
INV77 27 393364046
INV78 23 381713426
INV79 134 350713408
INV8 85 322154899
INV80 4 381900476
INV81 24 389620289
INV82 33 393229173
INV83 9 344807465
INV84 23 323415557
INV85 32 372768847
INV86 20 384740836
INV87 25 385708589
INV88 29 388680045
INV89 22 323658394
INV9 3 136766944
INV90 25 386606940
INV91 22 384360764
INV92 22 375170759
INV93 31 394116451
INV94 20 281624502
INV95 11 364532943
INV96 14 378464462
INV97 38 390437780
INV98 20 259303673
INV99 35 382133951
MAM1 32389 323884866
MAM10 26814 24994146
MAM100 5 381968701
MAM101 4 345040697
MAM102 3 176472919
MAM103 6 356825309
MAM104 3 354814440
MAM105 3336 333279354
MAM106 66984 268371174
MAM107 71394 104538717
MAM108 1 179953079
MAM109 4 274800947
MAM11 13731 20581276
MAM110 4 294612101
MAM111 4 368804057
MAM112 5 360824188
MAM113 3 381844289
MAM114 4 323611747
MAM115 5 314441637
MAM116 261 273069064
MAM117 1 216965501
MAM118 1 210729441
MAM119 2 349064804
MAM12 3445 7368868
MAM120 2 311803703
MAM121 2 284093331
MAM122 3 348809871
MAM123 4 369368223
MAM124 5 363867118
MAM125 8033 159372046
MAM13 107 699953
MAM14 20 277696380
MAM15 1 249270926
MAM16 2 343930246
MAM17 3 325384739
MAM18 1 90795278
MAM19 4 322903327
MAM2 22251 277070695
MAM20 4 298795355
MAM21 6 353843759
MAM22 5 329700903
MAM23 2 289079565
MAM24 3 348530310
MAM25 4 336581445
MAM26 5 375256260
MAM27 6 373952570
MAM28 8 377813420
MAM29 5 379300313
MAM3 2 316219032
MAM30 1 38035513
MAM31 5 285741626
MAM32 5 342804543
MAM33 8 370485433
MAM34 6 316655225
MAM35 4 238884849
MAM36 4 355768297
MAM37 6 355037276
MAM38 7 389945117
MAM39 6 319172640
MAM4 2 376685399
MAM40 5 323047396
MAM41 4 347221982
MAM42 5 288444151
MAM43 5 375232988
MAM44 5 248962388
MAM45 1 277956744
MAM46 1 154038104
MAM47 3 374028897
MAM48 2 298256496
MAM49 3 355148320
MAM5 2 295769989
MAM50 3 355658200
MAM51 3 369352591
MAM52 13 295784090
MAM53 54 7614329
MAM54 215 34073042
MAM55 431 71272130
MAM56 861 68509101
MAM57 1706 2411269
MAM58 6836 6159435
MAM59 110526 193401624
MAM6 2 385026516
MAM60 33190 281607634
MAM61 4 358286156
MAM62 5 387739617
MAM63 5 335893012
MAM64 6 364021592
MAM65 6 304412506
MAM66 10 386743576
MAM67 132590 153979627
MAM68 117940 169539583
MAM69 5957 5255602
MAM7 3 316699161
MAM70 1 716413629
MAM71 1 662751787
MAM72 1 611347268
MAM73 1 464895054
MAM74 1 288121652
MAM75 3 338107697
MAM76 1 223449203
MAM77 1 210645437
MAM78 1 201318998
MAM79 1 197708286
MAM8 5 343489620
MAM80 2 320231256
MAM81 2 293750401
MAM82 3 367535284
MAM83 4 351244600
MAM84 367 269065793
MAM85 1 203623556
MAM86 2 383513587
MAM87 4 383666147
MAM88 5 381503248
MAM89 263 390074346
MAM9 933 216317382
MAM90 2 265153725
MAM91 4 366992153
MAM92 5 369689861
MAM93 5 392803577
MAM94 6 298207437
MAM95 3 363734450
MAM96 1 118519168
MAM97 3 328935722
MAM98 4 359964523
MAM99 4 383777488
PAT1 420068 157359119
PAT10 304138 130867531
PAT100 352852 189327041
PAT101 310862 206556098
PAT102 261889 226571161
PAT103 130469 96637053
PAT104 304402 217824161
PAT105 276793 236021165
PAT106 255575 243191966
PAT107 219302 91982645
PAT108 185377 167946970
PAT109 193875 145574609
PAT11 235967 216994795
PAT110 99146 56208976
PAT111 244010 110313663
PAT112 143099 226367997
PAT113 78464 27203646
PAT114 88270 271848197
PAT115 224842 124890697
PAT116 225598 104795549
PAT117 1438 4521973
PAT118 247765 75673289
PAT119 230776 33741646
PAT12 83514 75768772
PAT120 94886 123403652
PAT121 98574 119749391
PAT122 81936 115812708
PAT123 203184 107726169
PAT124 26068 9050316
PAT125 203753 100524714
PAT126 183494 80758738
PAT127 117402 19496593
PAT128 249521 208801777
PAT129 384336 114595180
PAT13 242994 211781414
PAT130 54372 7592836
PAT131 283263 179655463
PAT132 123892 298062824
PAT133 110584 304005334
PAT134 393154 122356229
PAT135 289870 158296044
PAT136 13477 9074355
PAT137 287143 182661675
PAT138 409358 14024130
PAT139 496794 33315114
PAT14 328195 148438513
PAT140 525210 7878150
PAT141 153476 3896843
PAT142 377385 123753128
PAT143 245737 106350143
PAT144 259895 238802744
PAT145 4634 392128968
PAT146 190899 207809354
PAT147 308470 120437803
PAT148 140524 153724833
PAT149 6434 91722304
PAT15 63811 1595275
PAT150 177885 181303248
PAT151 71548 185117089
PAT152 75797 115786083
PAT153 75754 115775734
PAT154 46229 38674255
PAT155 245578 68641081
PAT156 201635 63083420
PAT157 264557 57807328
PAT158 309557 83973887
PAT159 458767 54678286
PAT16 197471 165311926
PAT160 227775 118065838
PAT161 359566 132223241
PAT162 288051 50677391
PAT163 154874 4646924
PAT164 228339 77240208
PAT165 228222 72940367
PAT166 281345 18592144
PAT167 65063 7149854
PAT168 153382 170224371
PAT169 73417 134982088
PAT17 217864 141801942
PAT170 74139 123430830
PAT171 137226 84276684
PAT172 175196 2627940
PAT173 233542 99258089
PAT174 198421 145045380
PAT175 229735 110452220
PAT176 105700 68109671
PAT177 80124 122466507
PAT178 260792 46024405
PAT179 294811 4422165
PAT18 217799 104581737
PAT180 7790 116850
PAT181 278538 10765362
PAT182 99587 135915370
PAT183 220910 105875978
PAT184 23920 35278651
PAT185 143999 206566501
PAT186 173285 186742155
PAT187 70129 243259642
PAT188 6542 8869371
PAT189 137168 133366031
PAT19 238917 105580979
PAT190 136592 204923845
PAT191 208574 98959571
PAT192 284102 31395230
PAT193 26285 42269559
PAT194 264589 66935450
PAT195 227269 82111943
PAT196 179588 5746816
PAT197 194343 81150933
PAT198 52350 9088688
PAT199 82690 146051882
PAT2 329678 203029882
PAT20 217511 131791123
PAT200 75930 116106222
PAT201 76058 115438165
PAT202 205771 85563217
PAT203 2801 56020
PAT204 342231 6844620
PAT205 341891 7168782
PAT206 341071 7503562
PAT207 331154 110021550
PAT208 268658 230373189
PAT209 282624 222310160
PAT21 295508 53417985
PAT210 192664 139614235
PAT211 276098 235021090
PAT212 188385 291326630
PAT213 137484 196232251
PAT214 247191 246690030
PAT215 11728 387687504
PAT216 313354 152356909
PAT217 244602 252477336
PAT218 160029 300870611
PAT219 215545 135077252
PAT22 146942 94828667
PAT220 172971 290885692
PAT221 266005 215700981
PAT222 351365 145812905
PAT223 304068 76036269
PAT224 317818 206630332
PAT225 43590 365712261
PAT226 151381 180550783
PAT227 338212 193787787
PAT228 332520 206353769
PAT229 155792 199233054
PAT23 196051 155681695
PAT230 249094 251157045
PAT231 209852 277995521
PAT232 262858 236722257
PAT233 313828 214462099
PAT234 164472 182083893
PAT235 229078 114541893
PAT236 213135 141111481
PAT237 284111 19299271
PAT238 281469 22378925
PAT239 48940 929860
PAT24 279813 73243548
PAT240 281624 22162860
PAT241 286514 14630240
PAT242 287155 13479675
PAT243 96564 20012546
PAT244 263509 44902329
PAT245 293106 5569014
PAT246 293106 5569014
PAT247 200573 78857135
PAT25 228211 147406911
PAT26 209289 140271124
PAT27 62589 53902828
PAT28 304661 206972920
PAT29 321040 202872656
PAT3 50191 20261086
PAT30 69615 127457294
PAT31 217213 274043600
PAT32 399532 38379558
PAT33 255502 168777995
PAT34 232146 138090967
PAT35 62787 29365462
PAT36 159610 193120910
PAT37 187244 152014323
PAT38 211998 134509322
PAT39 97877 9820308
PAT4 329463 180384415
PAT40 349667 21562036
PAT41 269132 102155254
PAT42 166 390395449
PAT43 7285 386170321
PAT44 91553 5256860
PAT45 304606 19422510
PAT46 304621 19407682
PAT47 188137 183520250
PAT48 31158 33401194
PAT49 100016 274294600
PAT5 261715 200080836
PAT50 347910 22047307
PAT51 356635 6776065
PAT52 92440 1756360
PAT53 351473 15875984
PAT54 360979 6858601
PAT55 133566 2537754
PAT56 360626 6851894
PAT57 359974 6839506
PAT58 125418 2711844
PAT59 535700 100616524
PAT6 217907 164406625
PAT60 111356 330233433
PAT61 289774 158820679
PAT62 481500 50383506
PAT63 225638 89297619
PAT64 254448 194601369
PAT65 328326 204072166
PAT66 171880 140724496
PAT67 349862 190728733
PAT68 612603 75778089
PAT69 132887 40797313
PAT7 247412 122521156
PAT70 484033 127126269
PAT71 126354 109119371
PAT72 150168 307250321
PAT73 318626 211710240
PAT74 51881 214846609
PAT75 189165 289007376
PAT76 317843 207880789
PAT77 123868 129694058
PAT78 342751 192409991
PAT79 362616 180214431
PAT8 224235 103098380
PAT80 20467 17346132
PAT81 311143 212599739
PAT82 414691 138165335
PAT83 481329 57361173
PAT84 327289 49350302
PAT85 456874 82632471
PAT86 157580 115887156
PAT87 166961 185778832
PAT88 315166 151593681
PAT89 224922 179199344
PAT9 153371 78067076
PAT90 161423 40686141
PAT91 548289 10417491
PAT92 499577 9491963
PAT93 509421 32468072
PAT94 211222 45802544
PAT95 257674 203203947
PAT96 387972 140936445
PAT97 39802 44629378
PAT98 361773 186862184
PAT99 415062 154422395
PHG1 8915 216276642
PHG2 4793 223832927
PHG3 5302 216038480
PHG4 7782 238186934
PHG5 4060 189260903
PLN1 134955 171801462
PLN10 18946 157439113
PLN100 57 390189770
PLN101 11 373036233
PLN102 8 357693623
PLN103 6 351635285
PLN104 12 293471641
PLN105 78 341267500
PLN106 131 317758159
PLN107 124 358113214
PLN108 105 219857218
PLN109 196 355571810
PLN11 29376 278343654
PLN110 127 342881192
PLN111 82 336675854
PLN112 15 367227793
PLN113 23 224588881
PLN114 206 386882773
PLN115 104 391705279
PLN116 87 391781905
PLN117 63 346560823
PLN118 145 363563183
PLN119 18 37574126
PLN12 2659 334303627
PLN120 37 16871
PLN121 149 79314
PLN122 2469 93786416
PLN123 7181 18795412
PLN124 14346 29953091
PLN125 97570 209254847
PLN126 129572 90157760
PLN127 158734 148017133
PLN128 162640 146389252
PLN129 58019 31842053
PLN13 37 329935405
PLN130 181508 123929724
PLN131 49961 254173551
PLN132 41548 288337301
PLN133 72034 110573783
PLN134 98644 85504671
PLN135 49729 72847341
PLN136 25061 110565816
PLN137 13561 89764040
PLN138 1 774434471
PLN139 8305 28494037
PLN14 46 124218893
PLN140 1861 361385154
PLN141 5 372618381
PLN142 6 372447772
PLN143 6 368295254
PLN144 2 132503639
PLN145 428 311697900
PLN146 8 327823341
PLN147 6 343447962
PLN148 1 66465249
PLN149 1 474651383
PLN15 9 366014477
PLN150 1 612216829
PLN151 1 571018318
PLN152 1 574020038
PLN153 1 538550714
PLN154 1 514282554
PLN155 1 575541767
PLN156 134 336045988
PLN157 13669 306991053
PLN158 174175 123932534
PLN159 24742 16080155
PLN16 2395 340580897
PLN160 148135 156035632
PLN161 149366 145719901
PLN162 87113 72036634
PLN163 154329 132533560
PLN164 163851 118472034
PLN165 25465 27645506
PLN166 147439 133925170
PLN167 125872 156458711
PLN168 167140 121495021
PLN169 116186 120844038
PLN17 1949 233857567
PLN170 134501 149282553
PLN171 102256 121985975
PLN172 135629 149863700
PLN173 126510 163007198
PLN174 120375 166644115
PLN175 20680 18360198
PLN176 124156 164068818
PLN177 112820 172564174
PLN178 86183 159125476
PLN179 118831 171978341
PLN18 3 330514248
PLN180 115314 186723547
PLN181 15293 302751446
PLN182 18901 229983270
PLN183 19737 363518883
PLN184 10232 333664247
PLN185 302 288936846
PLN186 5 324373291
PLN187 1670 369972731
PLN188 1620 2256477
PLN189 1384 387002570
PLN19 37 346663474
PLN190 8 179149947
PLN191 1282 232633870
PLN192 1 522466905
PLN193 1 675310294
PLN194 1 628753756
PLN195 1 624247919
PLN196 1 599018945
PLN197 1 573247234
PLN198 1 634667502
PLN199 8563 149646365
PLN2 39699 282505851
PLN20 19735 84856634
PLN200 1 727344967
PLN201 1 946003158
PLN202 1 965754312
PLN203 1 906459801
PLN204 1 876148008
PLN205 1 885153844
PLN206 1 899925126
PLN207 1 528437893
PLN208 4156 344360411
PLN209 10 362580157
PLN21 96586 101383894
PLN210 4 120184706
PLN211 129 363593727
PLN212 404 366581476
PLN213 9 335385998
PLN214 130 308977848
PLN215 2 317663561
PLN216 1 192140685
PLN217 1 279860179
PLN218 1 259520967
PLN219 2 294703259
PLN22 113432 117620172
PLN220 1 238633233
PLN221 1 162496318
PLN222 1 420743833
PLN223 206 92200731
PLN224 16 383095167
PLN225 32 120825431
PLN226 1 541700351
PLN227 1 696809892
PLN228 1 655542733
PLN229 1 648987779
PLN23 57311 72144580
PLN230 1 622068216
PLN231 1 583456046
PLN232 1 654005093
PLN233 130 298375
PLN234 1 522466905
PLN235 1 675310294
PLN236 1 628753756
PLN237 1 624247919
PLN238 1 599018945
PLN239 1 573247234
PLN24 28689 28922869
PLN240 1 634667502
PLN241 341 95021966
PLN242 1 521073757
PLN243 1 672273650
PLN244 1 634137895
PLN245 1 624121443
PLN246 1 607506942
PLN247 1 564293627
PLN248 1 632401812
PLN249 1 520603772
PLN25 2648 194594881
PLN250 1 661076038
PLN251 1 626572591
PLN252 1 612852138
PLN253 1 598896166
PLN254 1 570629545
PLN255 1 623813090
PLN256 1 513014082
PLN257 1 653624577
PLN258 1 616219606
PLN259 1 610044819
PLN26 344 254550430
PLN260 1 583417444
PLN261 1 550735148
PLN262 1 620104558
PLN263 1 536602846
PLN264 1 671211297
PLN265 1 630677708
PLN266 1 623428415
PLN267 1 604298040
PLN268 1 558526623
PLN269 1 628419988
PLN27 400 261235914
PLN270 1 500012378
PLN271 1 648922534
PLN272 1 604770208
PLN273 1 597403059
PLN274 1 576456374
PLN275 1 556080982
PLN276 1 603311816
PLN277 1 512023576
PLN278 1 652551272
PLN279 1 615767531
PLN28 198 168828441
PLN280 1 605571303
PLN281 1 592249714
PLN282 1 549757368
PLN283 1 616509610
PLN284 1 550024188
PLN285 1 710194481
PLN286 1 661081403
PLN287 1 659460550
PLN288 1 630572514
PLN289 1 598618390
PLN29 298 258873545
PLN290 1 658974642
PLN291 1 559656399
PLN292 1 717517502
PLN293 1 672450454
PLN294 1 665297378
PLN295 1 636785599
PLN296 1 599706080
PLN297 1 675658265
PLN298 1 523168208
PLN299 1 495661851
PLN3 3691 380289178
PLN30 339 265493888
PLN300 1 640830439
PLN301 1 597781253
PLN302 1 600363860
PLN303 1 570178053
PLN304 1 534998810
PLN305 1 616598997
PLN306 1 537457279
PLN307 1 685947972
PLN308 1 649921694
PLN309 1 641099225
PLN31 485 350911896
PLN310 1 611845738
PLN311 1 581041262
PLN312 1 655783664
PLN313 1 521174834
PLN314 1 667717957
PLN315 1 631819663
PLN316 1 624692602
PLN317 1 597351075
PLN318 1 561737938
PLN319 1 629651422
PLN32 112 80604200
PLN320 1 524514255
PLN321 1 670202054
PLN322 1 631946783
PLN323 1 626743494
PLN324 1 600801835
PLN325 1 566971015
PLN326 1 629827058
PLN327 1 522114480
PLN328 1 671530377
PLN329 1 631910401
PLN33 455 379563194
PLN330 1 622474059
PLN331 1 598240357
PLN332 1 562137082
PLN333 1 633805855
PLN334 1 525723083
PLN335 1 684336246
PLN336 1 636053469
PLN337 1 629969872
PLN338 1 604087610
PLN339 1 568600391
PLN34 127 379253996
PLN340 1 640498578
PLN341 1 519546829
PLN342 1 665715246
PLN343 1 624683667
PLN344 1 621078253
PLN345 1 600910593
PLN346 1 558953701
PLN347 1 626840912
PLN348 1 543344542
PLN349 1 697540743
PLN35 91 241350431
PLN350 1 655862368
PLN351 1 646765634
PLN352 1 618540729
PLN353 1 587963859
PLN354 1 658085510
PLN355 446 378685619
PLN356 15 312691008
PLN357 20 111531882
PLN358 1 596211899
PLN359 1 705338699
PLN36 108 325736871
PLN360 1 493450010
PLN361 1 804285258
PLN362 1 810734643
PLN363 1 673981989
PLN364 1 754496630
PLN365 1 855759449
PLN366 1 614042580
PLN367 1 743847818
PLN368 1 673340788
PLN369 1 515668560
PLN37 17 390428741
PLN370 1 713320806
PLN371 1 703598484
PLN372 1 570159854
PLN373 1 625793224
PLN374 1 721110502
PLN375 1 459355444
PLN376 1 745201001
PLN377 1 749284433
PLN378 1 643344672
PLN379 1 595297365
PLN38 234 283333018
PLN380 1 688905267
PLN381 1 491807393
PLN382 1 769338634
PLN383 1 671568023
PLN384 1 635285330
PLN385 1 745618965
PLN386 1 839470345
PLN387 1 646400022
PLN388 1 747589525
PLN389 1 665179885
PLN39 155 383508558
PLN390 1 506585010
PLN391 1 703962928
PLN392 1 702438406
PLN393 1 568126671
PLN394 1 610851963
PLN395 1 707596419
PLN396 1 465558328
PLN397 1 734536914
PLN398 1 738743901
PLN399 1 636778132
PLN4 3520 387675289
PLN40 85 329381794
PLN400 1 602900890
PLN401 1 697493198
PLN402 1 490518203
PLN403 1 784661008
PLN404 1 810500911
PLN405 1 655314739
PLN406 1 752710991
PLN407 1 890847171
PLN408 1 621781073
PLN409 1 743084022
PLN41 15 388403916
PLN410 1 676741658
PLN411 1 509452426
PLN412 1 710124532
PLN413 1 480767623
PLN414 1 578021311
PLN415 1 620140791
PLN416 1 716573881
PLN417 1 476726550
PLN418 1 756324664
PLN419 1 977471539
PLN42 22 360710420
PLN420 1 642207261
PLN421 1 502612092
PLN422 1 646234737
PLN423 1 605172934
PLN424 1 593744788
PLN425 1 571972453
PLN426 1 545472572
PLN427 1 607667504
PLN428 1 590561804
PLN429 1 685720839
PLN43 6 376299569
PLN430 1 490910922
PLN431 1 782694893
PLN432 1 796420183
PLN433 1 650274702
PLN434 1 739889549
PLN435 1 848590828
PLN436 1 610626473
PLN437 1 738023571
PLN438 1 667607564
PLN439 1 506274898
PLN44 1 65870126
PLN440 1 701434008
PLN441 1 690770133
PLN442 1 567265955
PLN443 1 612987783
PLN444 1 704156067
PLN445 1 475327881
PLN446 1 732118298
PLN447 1 733931846
PLN448 1 636796232
PLN449 1 599764323
PLN45 93 388494695
PLN450 1 691313424
PLN451 1 493357854
PLN452 1 782685093
PLN453 1 786410271
PLN454 1 648139033
PLN455 1 744407562
PLN456 1 835583350
PLN457 1 623221719
PLN458 1 741299132
PLN459 1 669032550
PLN46 15 373888800
PLN460 1 517040482
PLN461 1 711661679
PLN462 1 708205786
PLN463 1 573398137
PLN464 1 583494258
PLN465 1 707105489
PLN466 1 471251328
PLN467 1 737453356
PLN468 1 736349413
PLN469 1 639162162
PLN47 9 363551984
PLN470 1 586755746
PLN471 1 704478343
PLN472 1 492109999
PLN473 1 791475352
PLN474 1 785940626
PLN475 1 661246824
PLN476 1 756990402
PLN477 1 858776195
PLN478 1 621195942
PLN479 1 754256086
PLN48 60 374148929
PLN480 1 670301833
PLN481 1 509263899
PLN482 1 708234589
PLN483 1 725120110
PLN484 1 575129590
PLN485 1 620883766
PLN486 1 727285804
PLN487 1 479660269
PLN488 1 745978486
PLN489 1 750160716
PLN49 14 212654302
PLN490 1 642428577
PLN491 1 591313643
PLN492 1 705330581
PLN493 1 495656580
PLN494 1 803232604
PLN495 1 790745243
PLN496 1 657494025
PLN497 1 759305888
PLN498 1 856542542
PLN499 1 628321883
PLN5 97759 202945262
PLN50 74 124609184
PLN500 1 754364263
PLN501 1 697113365
PLN502 1 504254270
PLN503 1 715354979
PLN504 1 713929667
PLN505 1 572943128
PLN506 1 626959190
PLN507 1 715714221
PLN508 1 483823121
PLN509 1 742917797
PLN51 8 358353307
PLN510 1 748536659
PLN511 1 643784981
PLN512 1 600654286
PLN513 1 685083685
PLN514 1 486317123
PLN515 1 794150360
PLN516 1 799857935
PLN517 1 655329108
PLN518 1 749763888
PLN519 1 838116175
PLN52 3 347496433
PLN520 1 610468321
PLN521 1 736551279
PLN522 1 666328382
PLN523 1 504826275
PLN524 1 702606209
PLN525 1 467876140
PLN526 1 566465558
PLN527 1 614421429
PLN528 1 698878671
PLN529 1 480431564
PLN53 4 370651368
PLN530 1 735408736
PLN531 1 969998116
PLN532 1 635024734
PLN533 10 3368
PLN534 1 595339094
PLN535 1 698605642
PLN536 1 499102108
PLN537 1 791748890
PLN538 1 797311483
PLN539 1 656817438
PLN54 2 271593360
PLN540 1 753360318
PLN541 1 845838138
PLN542 1 619661694
PLN543 1 752772853
PLN544 1 689709469
PLN545 1 509595892
PLN546 1 712797596
PLN547 1 710493282
PLN548 1 570643040
PLN549 1 619886155
PLN55 1 150766190
PLN550 1 705533140
PLN551 1 484551304
PLN552 1 740148362
PLN553 1 757233630
PLN554 1 642499559
PLN555 1 594006513
PLN556 1 693261537
PLN557 1 492948387
PLN558 1 781462734
PLN559 1 802944975
PLN56 2 288204953
PLN560 1 650275864
PLN561 1 756841830
PLN562 1 850623622
PLN563 1 614136911
PLN564 1 723255126
PLN565 1 669876730
PLN566 1 507533340
PLN567 1 712168462
PLN568 1 712339524
PLN569 1 564869106
PLN57 2 286787940
PLN570 1 619418949
PLN571 1 715454519
PLN572 1 478264344
PLN573 1 734693445
PLN574 1 749685439
PLN575 1 633598967
PLN576 1 782818162
PLN577 1 971920087
PLN578 1 827198496
PLN579 1 867619200
PLN58 2 295931502
PLN580 1 806566123
PLN581 1 1015700474
PLN582 1 742303966
PLN583 1 956173857
PLN584 1 916702776
PLN585 1 874517040
PLN586 1 816294110
PLN587 1 750216944
PLN588 1 862608691
PLN589 20 4493
PLN59 50 360868274
PLN590 1 782818162
PLN591 1 971920087
PLN592 1 827198496
PLN593 1 867619200
PLN594 1 806566123
PLN595 1 1015700474
PLN596 175 140763171
PLN597 1 516505932
PLN598 1 665585731
PLN599 1 621516506
PLN6 111632 128056978
PLN60 8 373615720
PLN600 1 610333535
PLN601 1 588218686
PLN602 1 561794515
PLN603 1 632540561
PLN604 118 87991
PLN605 1 313789095
PLN606 1 248068439
PLN607 1 241454477
PLN608 1 251811976
PLN609 1 225452224
PLN61 7 376229618
PLN610 1 173806927
PLN611 2 370152128
PLN612 158 374282142
PLN613 603 391598667
PLN614 10 362580157
PLN615 7 281547701
PLN616 1 314258027
PLN617 1 394306295
PLN618 1 325599754
PLN619 1 288763641
PLN62 6 342806685
PLN620 1 187311108
PLN621 1 277174932
PLN622 1 235078182
PLN623 15 332895745
PLN624 16436 36185494
PLN625 5636 1862075
PLN626 5224 2478918
PLN627 1 563502314
PLN628 833 298337632
PLN629 1194 92707173
PLN63 6 347730275
PLN630 1 594102056
PLN631 1 689851870
PLN632 1 495453186
PLN633 1 780798557
PLN634 1 801256715
PLN635 1 651852609
PLN636 1 750843639
PLN637 1 830829764
PLN638 1 615552423
PLN639 1 744588157
PLN64 6 350661716
PLN640 1 673617499
PLN641 1 509857067
PLN642 1 709773743
PLN643 1 713149757
PLN644 1 566080677
PLN645 1 618079260
PLN646 1 720988478
PLN647 1 473592718
PLN648 1 736706236
PLN649 1 750620385
PLN65 43 144640005
PLN650 1 638686055
PLN651 1 480980714
PLN652 6684 330577769
PLN653 3760 370633860
PLN654 10098 326491459
PLN655 1753 12315783
PLN656 1 585266722
PLN657 1 681112512
PLN658 1 775448786
PLN659 1 790338525
PLN66 144 326417895
PLN660 1 746673839
PLN661 1 836514780
PLN662 1 736872137
PLN663 1 676292951
PLN664 1 669155517
PLN665 1 701372996
PLN666 1 615672275
PLN667 1 698614761
PLN668 1 728031845
PLN669 1 722970987
PLN67 7 298887356
PLN670 12302 8480478
PLN671 94663 142071821
PLN672 109153 181506578
PLN673 90309 195720942
PLN674 80839 198456393
PLN675 98424 191498687
PLN676 102823 187653337
PLN677 101594 189487633
PLN678 10428 25697414
PLN679 88520 206540975
PLN68 6 332369654
PLN680 85847 206513255
PLN681 75356 219247179
PLN682 35252 113815988
PLN683 68400 232456356
PLN684 75810 213936629
PLN685 66781 230734996
PLN686 67480 231893394
PLN687 62187 234266012
PLN688 18497 89937302
PLN689 62842 232051495
PLN69 50 340388796
PLN690 50630 250175929
PLN691 51272 270788941
PLN692 33269 154591804
PLN693 71886 235128509
PLN694 21552 320359270
PLN695 6 310674098
PLN696 1 528447123
PLN697 1 678170541
PLN698 1 639558213
PLN699 1 629672760
PLN7 64211 184493436
PLN70 34 333743749
PLN700 1 608467472
PLN701 1 565695744
PLN702 1 634886329
PLN703 1 532083992
PLN704 1 684376481
PLN705 1 642597466
PLN706 1 631979072
PLN707 1 607115911
PLN708 1 582960187
PLN709 1 640026769
PLN71 1 48961553
PLN710 1 608979116
PLN711 1 720972993
PLN712 1 501257520
PLN713 1 804602427
PLN714 1 808121247
PLN715 1 649118519
PLN716 1 758906661
PLN717 1 861141126
PLN718 1 642382296
PLN719 1 759893476
PLN72 195 309764478
PLN720 1 689766370
PLN721 1 531462149
PLN722 1 714517032
PLN723 1 717288350
PLN724 1 586345039
PLN725 1 626266972
PLN726 1 738085275
PLN727 1 505809789
PLN728 1 759124079
PLN729 1 751612808
PLN73 6 336790634
PLN730 1 653055523
PLN731 7 358620060
PLN732 675 180123810
PLN733 1 613662638
PLN734 1 794474755
PLN735 1 760111594
PLN736 1 769810128
PLN737 1 715684684
PLN738 1 623890083
PLN739 1 755457679
PLN74 5 336035871
PLN740 1 717109572
PLN741 1 817712742
PLN742 1 864624966
PLN743 1 701857263
PLN744 1 726425509
PLN745 1 738041677
PLN746 1 767912069
PLN747 1 504659958
PLN748 1 662526948
PLN749 1 633282846
PLN75 6 326965702
PLN750 1 534651777
PLN751 1 584285409
PLN752 1 507261758
PLN753 1 659687352
PLN754 1 224073253
PLN755 1 198628823
PLN756 1 322486422
PLN757 1 260047251
PLN758 1 262402055
PLN759 1 330012911
PLN76 5 304407451
PLN760 1 349800169
PLN761 1 354403191
PLN762 1 317988395
PLN763 1 376468909
PLN764 310 342162756
PLN765 6 385538869
PLN766 19 375745858
PLN767 12 364214839
PLN768 55 174559720
PLN769 38 343074766
PLN77 13 303962775
PLN770 5 325733636
PLN771 11 384023275
PLN772 10 375480087
PLN773 10 379071384
PLN774 9 351388705
PLN775 127 364503257
PLN776 10 394439500
PLN777 10 375932913
PLN778 10 373983960
PLN779 10 369372075
PLN78 5 284426683
PLN780 1176 236961425
PLN781 1 540897063
PLN782 1 449127287
PLN783 1 425675180
PLN784 1 463192880
PLN785 1 485323027
PLN786 1 448461343
PLN787 1 493511962
PLN788 1 462796039
PLN789 1 589118817
PLN79 8 327303441
PLN790 1 638425132
PLN791 1 716105986
PLN792 1 613160974
PLN793 1 626220839
PLN794 1 551718542
PLN795 1 484215583
PLN796 1 532103454
PLN797 1 480949782
PLN798 1 455353809
PLN799 1 499214392
PLN8 21754 107220939
PLN80 61 76849044
PLN800 1 298028472
PLN801 1 528225653
PLN802 36661 125020154
PLN81 2 355063454
PLN82 1 333667882
PLN83 1 302574826
PLN84 1 296818136
PLN85 1 257455782
PLN86 1 252943167
PLN87 1 225803546
PLN88 1 219123305
PLN89 2 394302667
PLN9 35208 291130285
PLN90 38 30696039
PLN91 15 305289289
PLN92 2 286029496
PLN93 2 307738366
PLN94 2 269669619
PLN95 1 157681923
PLN96 40 376080648
PLN97 33 389701062
PLN98 106 384154506
PLN99 99 346737635
PRI1 23047 60053106
PRI10 2265 387936439
PRI11 4375 381717987
PRI12 2068 191950792
PRI13 2459 391017609
PRI14 17343 243216304
PRI15 27929 79132073
PRI16 96050 166265556
PRI17 11025 363947920
PRI18 3741 383223079
PRI19 15303 353911286
PRI2 23840 319341223
PRI20 2239 172855211
PRI21 1 250749103
PRI22 1 238414537
PRI23 2 387789264
PRI24 2 351926207
PRI25 2 301224727
PRI26 2 270924633
PRI27 3 376243325
PRI28 4 374251276
PRI29 5 290585290
PRI3 2613 370370379
PRI30 42298 314450675
PRI31 19023 23601165
PRI32 53141 193817517
PRI33 4 351860731
PRI34 5 337827736
PRI35 3 297245061
PRI36 3 382019003
PRI37 2 285375381
PRI38 2 306826759
PRI39 2 354172067
PRI4 2409 360399901
PRI40 2 394680893
PRI41 1 242696752
PRI42 1 248387328
PRI43 17505 351769399
PRI44 118184 177542192
PRI45 43939 90939041
PRI46 74330 199952244
PRI47 54415 215570274
PRI48 34652 144372221
PRI49 69722 214218466
PRI5 2593 353874487
PRI50 97196 191703079
PRI51 261 231206724
PRI52 1 190673448
PRI53 9368 358512524
PRI54 48774 211104168
PRI55 84738 189563334
PRI56 66071 181742482
PRI6 2112 282951291
PRI7 2729 356953890
PRI8 3181 362167571
PRI9 2423 385530941
ROD1 38455 309602182
ROD10 15053 352243468
ROD11 1336 2453179
ROD12 22213 347967024
ROD13 1002 157743814
ROD14 53466 238707384
ROD15 21658 310382782
ROD16 228314 97111734
ROD17 97450 65689073
ROD18 39084 249074611
ROD19 2 383374219
ROD2 1810 346955540
ROD20 2 353017828
ROD21 2 317259772
ROD22 2 289653994
ROD23 1 140975125
ROD24 3 385591618
ROD25 4 335044383
ROD26 5 356599364
ROD27 2 394024503
ROD28 2 369416674
ROD29 2 335852806
ROD3 1885 351998373
ROD30 2 300392300
ROD31 2 283621167
ROD32 3 348161973
ROD33 5 386542915
ROD34 154 237877425
ROD35 1 193958709
ROD36 2 350925653
ROD37 2 319642044
ROD38 2 276360533
ROD39 3 382322699
ROD4 1944 361078959
ROD40 3 366447402
ROD41 84 245931526
ROD42 2 348668775
ROD43 2 314889876
ROD44 3 389462371
ROD45 3 321351180
ROD46 1 93020901
ROD47 5 385423505
ROD48 6 342729329
ROD49 3 325864489
ROD5 1990 363733749
ROD50 4 358685719
ROD51 4 302148481
ROD52 5 337904903
ROD53 6 385168143
ROD54 6 347801590
ROD55 6 283624907
ROD56 68428 202949835
ROD57 1 203594213
ROD58 2 307631349
ROD59 2 273205312
ROD6 306 57843793
ROD60 2 272523522
ROD61 3 367476852
ROD62 3 318205593
ROD63 5 305035074
ROD64 2 318173246
ROD65 2 308990189
ROD66 2 273361793
ROD67 3 387778067
ROD68 3 350884214
ROD69 4 388911322
ROD7 1975 368354297
ROD70 4 237246301
ROD71 2 368078907
ROD72 2 295232279
ROD73 2 276158786
ROD74 3 370764878
ROD75 3 367374895
ROD76 5 389069045
ROD77 20543 154840115
ROD8 1990 369693686
ROD9 1959 368016559
STS1 170407 86844848
STS10 202283 61376861
STS11 166964 59441018
STS2 143557 63324802
STS3 8291 4867412
STS4 108725 63673512
STS5 110380 70041358
STS6 106165 81422843
STS7 122522 86626105
STS8 198952 60928403
STS9 8742 2375975
SYN1 54443 100625796
SYN10 2 382762979
SYN11 2 332214168
SYN12 4 386933112
SYN13 1 271050050
SYN14 2 294093621
SYN15 3 329883353
SYN16 4 353920981
SYN17 2 328712085
SYN18 4 357672913
SYN19 1 207870274
SYN2 1 271050050
SYN20 2 382762979
SYN21 2 332214168
SYN22 8 392789107
SYN23 65482 196007195
SYN24 894 34300580
SYN25 9183 352928592
SYN26 17218 334475810
SYN27 109320 160587366
SYN28 32951 98219008
SYN29 12450 249805351
SYN3 2 294093621
SYN4 3 329883353
SYN5 4 353920981
SYN6 1 64242768
SYN7 3 371658272
SYN8 2 250483958
SYN9 1 207870274
TSA1 233360 79647647
TSA10 168600 151858390
TSA100 63252 114802277
TSA101 79841 41351312
TSA102 82721 28609319
TSA103 67721 19747702
TSA104 84021 22863253
TSA105 84236 21912832
TSA106 84446 20981295
TSA107 134042 46621688
TSA108 155667 149676184
TSA109 183730 101083950
TSA11 157771 129836062
TSA110 47348 107503283
TSA111 136867 166252974
TSA112 166495 124901244
TSA113 97423 237859520
TSA114 99257 234633653
TSA115 12708 5978473
TSA116 134189 172362066
TSA117 127781 180160426
TSA118 129595 177105775
TSA119 121186 168272985
TSA12 97052 81339890
TSA120 161588 123667649
TSA121 122311 187541168
TSA122 147961 145186533
TSA123 94592 61300137
TSA124 136202 168455642
TSA125 159235 124954199
TSA126 156460 125810552
TSA127 123500 121448801
TSA13 143856 166190060
TSA14 181434 128519001
TSA15 66290 19907089
TSA16 206960 109167065
TSA17 187358 103732845
TSA18 49536 65564276
TSA19 154726 149575015
TSA2 222146 88664556
TSA20 216942 100225854
TSA21 205832 104153678
TSA22 22790 12573568
TSA23 158218 126877468
TSA24 173111 148508009
TSA25 214615 84288799
TSA26 107130 75648765
TSA27 170538 70805259
TSA28 220418 88915025
TSA29 30772 20942513
TSA3 74968 22652895
TSA30 203801 105213489
TSA31 180385 145699249
TSA32 69536 30839236
TSA33 188098 125939281
TSA34 147167 171080849
TSA35 162247 142754513
TSA36 150874 162292386
TSA37 167242 151938086
TSA38 141140 134046809
TSA39 170081 156927702
TSA4 197157 115804961
TSA40 69193 96187349
TSA41 171877 122235123
TSA42 189649 128251295
TSA43 179093 130001300
TSA44 75703 42972422
TSA45 179829 148956459
TSA46 157580 110411669
TSA47 134660 95403465
TSA48 183454 131877937
TSA49 208660 102956314
TSA5 214836 133894002
TSA50 80586 111968754
TSA51 191615 109275606
TSA52 179744 117175661
TSA53 113718 119372897
TSA54 154655 135706982
TSA55 161499 91796698
TSA56 130858 143914823
TSA57 137645 81544936
TSA58 155441 162401639
TSA59 162402 156498800
TSA6 19260 21470091
TSA60 193245 120755121
TSA61 58830 96622246
TSA62 173904 118336485
TSA63 151844 162145055
TSA64 61002 124261245
TSA65 201330 152320116
TSA66 185417 143496051
TSA67 162494 121036165
TSA68 181441 137352733
TSA69 171437 97550710
TSA7 193297 53192465
TSA70 41533 39009849
TSA71 119065 123313318
TSA72 131964 141438855
TSA73 151655 115933671
TSA74 830 251943
TSA75 153005 102368390
TSA76 156511 143520695
TSA77 40571 33632062
TSA78 176683 138455592
TSA79 161599 158562361
TSA8 156340 122132095
TSA80 11806 9816655
TSA81 185669 115791752
TSA82 143352 147746909
TSA83 177238 144637760
TSA84 158786 177299010
TSA85 18050 12594011
TSA86 168396 128972709
TSA87 156485 150537294
TSA88 194698 125055752
TSA89 32435 22848386
TSA9 101339 69198839
TSA90 196286 138439609
TSA91 112986 113189975
TSA92 98986 206634893
TSA93 87112 229168164
TSA94 77344 247719367
TSA95 30093 107285833
TSA96 141033 144555977
TSA97 106053 76615758
TSA98 74413 65471527
TSA99 33768 32853514
UNA1 713 4436341
VRL1 132486 138609697
VRL10 121328 144536257
VRL100 9604 222284521
VRL101 2902 78043466
VRL102 9316 222045645
VRL103 9412 220624919
VRL104 8813 222061658
VRL105 3531 101249216
VRL106 7542 222798704
VRL107 8682 222281310
VRL108 7541 222039040
VRL109 8078 192527975
VRL11 44169 308093492
VRL110 7469 222617997
VRL111 7662 221922021
VRL112 7733 222030811
VRL113 2111 62913226
VRL114 8124 221657227
VRL115 7494 221582696
VRL116 8456 222515162
VRL117 7627 219699338
VRL118 7742 219688277
VRL119 7369 218154802
VRL12 115608 146280929
VRL120 8025 222004980
VRL121 3795 112794498
VRL122 7552 221475547
VRL123 7476 222844210
VRL124 8221 222918521
VRL125 7420 219911494
VRL126 89 2636550
VRL127 7998 218661185
VRL128 8050 222033175
VRL129 7515 220517079
VRL13 22912 79806823
VRL130 7372 218255400
VRL131 5271 156729727
VRL132 12365 369630589
VRL133 12387 370295291
VRL134 12393 370567303
VRL135 12387 370375745
VRL136 12386 370331608
VRL137 5586 166998492
VRL138 12395 370498538
VRL139 12397 370509766
VRL14 114063 144977044
VRL140 12399 370543631
VRL141 7981 238501730
VRL142 12409 370814633
VRL143 12406 370727292
VRL144 12461 371963252
VRL145 5729 170739454
VRL146 7445 221929148
VRL147 8098 222400663
VRL148 7443 221836921
VRL149 2822 81682911
VRL15 112577 147962932
VRL150 7866 223142613
VRL151 7457 222064038
VRL152 7623 222204356
VRL153 8223 221504300
VRL154 3746 111046174
VRL155 7540 220700581
VRL156 7409 219864340
VRL157 7409 219748392
VRL158 3590 103896931
VRL159 7418 219162468
VRL16 26381 44261781
VRL160 7697 222457313
VRL161 7505 219936477
VRL162 7609 223003498
VRL163 4457 124453820
VRL164 7785 221768220
VRL165 7450 221517854
VRL166 7363 218046456
VRL167 7914 221352009
VRL168 3581 100001061
VRL169 7443 221912979
VRL17 91101 158468238
VRL170 7417 220600930
VRL171 7454 220827257
VRL172 5086 150632392
VRL173 7543 221951688
VRL174 7456 221885658
VRL175 7506 219511064
VRL176 2194 64908615
VRL177 7522 221905234
VRL178 7821 222009260
VRL179 7433 220989056
VRL18 96719 150178352
VRL180 2274 66973885
VRL181 7932 222743578
VRL182 7640 223204206
VRL183 7652 223012792
VRL184 6981 204378435
VRL185 7364 218005430
VRL186 7517 222137200
VRL187 7577 223123249
VRL188 7466 221928142
VRL189 7447 221890174
VRL19 60950 99685120
VRL190 7650 222223294
VRL191 7444 221345307
VRL192 2555 76203707
VRL193 7600 221963321
VRL194 7387 219036349
VRL195 7528 220390136
VRL196 7484 222868320
VRL197 4392 118249002
VRL198 7544 222762856
VRL199 7599 222161589
VRL2 126369 151544841
VRL20 92386 166033580
VRL200 7531 221998410
VRL201 7709 218272775
VRL202 3879 114936776
VRL203 8125 222364337
VRL204 7487 221727585
VRL205 7554 224454827
VRL206 7566 223242635
VRL207 4258 124206588
VRL208 7449 221692160
VRL209 7616 222834191
VRL21 91157 163934425
VRL210 7490 221796447
VRL211 7386 218501485
VRL212 3953 117754844
VRL213 7554 222044914
VRL214 7697 222321520
VRL215 8130 224280532
VRL216 7872 223343595
VRL217 3956 116705379
VRL218 7464 222080314
VRL219 7490 222594889
VRL22 53958 120920571
VRL220 7393 218103578
VRL221 7717 223065395
VRL222 4069 120922059
VRL223 7958 222527404
VRL224 7518 222707651
VRL225 7518 222968173
VRL226 7435 221496506
VRL227 3876 114816342
VRL228 7414 220622752
VRL229 7470 222561310
VRL23 83162 172791072
VRL230 7742 222677931
VRL231 7442 221821477
VRL232 3974 117648386
VRL233 7655 222793361
VRL234 7628 221984180
VRL235 7608 222028699
VRL236 7398 219950302
VRL237 3786 112382968
VRL238 7439 221699608
VRL239 7530 222221809
VRL24 86006 167276403
VRL240 7585 223159637
VRL241 7659 222806831
VRL242 3827 114219336
VRL243 7571 222990374
VRL244 7520 223859496
VRL245 7409 219895688
VRL246 7431 221519630
VRL247 3822 113932978
VRL248 7428 221230400
VRL249 7559 223148659
VRL25 69443 119007554
VRL250 7464 221536103
VRL251 7515 222210655
VRL252 3826 113908636
VRL253 7659 221180785
VRL254 7394 219525714
VRL255 7752 221553807
VRL256 8132 221678356
VRL257 7843 221538592
VRL258 8545 222106476
VRL259 3931 117080232
VRL26 82976 167625106
VRL260 7471 222005652
VRL261 7470 222505538
VRL262 7407 220280310
VRL263 7533 221831713
VRL264 8038 222110833
VRL265 7493 222860462
VRL266 3758 111960958
VRL267 7467 222117831
VRL268 7775 221258091
VRL269 7507 222664824
VRL27 83293 167298715
VRL270 7813 222508112
VRL271 3652 108885058
VRL272 7486 220741770
VRL273 7471 221335560
VRL274 7502 222614982
VRL275 7454 222163989
VRL276 3975 107569352
VRL277 7417 220524853
VRL278 7459 222111940
VRL279 7486 222616950
VRL28 50291 112116387
VRL280 7454 221806735
VRL281 6137 181927868
VRL282 7465 222365728
VRL283 7454 222177084
VRL284 7470 222275507
VRL285 2449 73009451
VRL286 7472 222482368
VRL287 7588 222584667
VRL288 7493 223013757
VRL289 3316 98852296
VRL29 89584 181521097
VRL290 7387 219060741
VRL291 7567 222144400
VRL292 7451 221661016
VRL293 4620 136483364
VRL294 7339 230790462
VRL295 7429 220589160
VRL296 7678 223123509
VRL297 4059 120604548
VRL298 7872 221794859
VRL299 7389 220134105
VRL3 95628 166513942
VRL30 46734 284894571
VRL300 7444 221811911
VRL301 5591 166512557
VRL302 7461 222056987
VRL303 8068 223312677
VRL304 7440 220451952
VRL305 5863 174321788
VRL306 7486 222639444
VRL307 7513 223486309
VRL308 7485 223089412
VRL309 7420 220625225
VRL31 74761 191343912
VRL310 385 11469963
VRL311 7816 220540132
VRL312 7493 220630487
VRL313 7486 222931352
VRL314 4099 120184361
VRL315 7488 222682136
VRL316 7399 219409059
VRL317 7500 222892674
VRL318 2738 81458097
VRL319 7515 222784132
VRL32 39108 95885168
VRL320 7439 221569606
VRL321 7432 220977798
VRL322 2363 70288052
VRL323 7595 221885134
VRL324 7613 222476647
VRL325 7513 222088032
VRL326 7788 221357770
VRL327 1073 31963862
VRL328 7613 221027764
VRL329 7421 219962901
VRL33 67818 182233307
VRL330 7422 220586961
VRL331 6798 201224437
VRL332 7690 222066669
VRL333 7443 221600112
VRL334 8314 219362205
VRL335 6997 204328724
VRL336 7347 218645849
VRL337 7524 222180732
VRL338 7504 221320199
VRL339 7503 223190595
VRL34 77759 185915643
VRL340 1788 53266896
VRL341 7474 222333269
VRL342 7721 222685392
VRL343 7398 219559403
VRL344 2630 77486023
VRL345 7476 220943531
VRL346 7418 220176798
VRL347 7412 220909937
VRL348 6642 196968000
VRL349 7463 221935624
VRL35 66050 155541072
VRL350 7489 221961771
VRL351 7380 218820519
VRL352 3247 96425967
VRL353 7488 222630526
VRL354 7484 222227019
VRL355 7408 220579018
VRL356 7441 221626760
VRL357 4152 123675864
VRL358 12227 365134813
VRL359 12350 369060953
VRL36 75308 192142595
VRL360 6272 187335258
VRL361 1904 56895892
VRL362 12416 370999133
VRL363 12620 376679612
VRL364 12646 377334516
VRL365 6326 188551443
VRL366 12644 377150765
VRL367 12737 379563236
VRL368 12746 379824679
VRL369 6993 208588755
VRL37 83727 171358611
VRL370 12709 378807132
VRL371 12647 377290665
VRL372 12574 375102346
VRL373 4222 125961479
VRL374 12564 374661513
VRL375 12555 374648072
VRL376 12593 375607497
VRL377 3539 105741631
VRL378 12496 373026630
VRL379 12436 371564102
VRL38 71497 144065439
VRL380 12409 370809463
VRL381 6381 190618512
VRL382 12423 371012608
VRL383 12405 370740452
VRL384 12392 370374905
VRL385 3440 102817301
VRL386 12465 372209245
VRL387 12442 371607689
VRL388 12299 368810083
VRL389 2806 83861994
VRL39 79136 176554792
VRL390 3626 108345075
VRL391 12557 374750020
VRL392 12418 371047324
VRL393 12134 362654303
VRL394 3004 89783407
VRL395 12424 371227079
VRL396 12263 366510802
VRL397 12386 370106363
VRL398 11570 345802381
VRL399 12375 369587244
VRL4 6706 11235133
VRL40 67290 183074252
VRL400 12426 370070368
VRL401 12384 370151016
VRL402 3495 104468404
VRL403 12292 367439274
VRL404 12514 373153624
VRL405 12368 369295206
VRL406 8833 264003439
VRL407 12371 369579323
VRL408 12404 370568362
VRL409 12579 375437606
VRL41 43083 197581275
VRL410 12370 369707288
VRL411 6797 203036654
VRL412 12355 369205246
VRL413 12447 371794297
VRL414 12374 369837453
VRL415 12441 371574322
VRL416 1304 38939393
VRL417 12301 367635353
VRL418 12375 369821506
VRL419 12376 369854194
VRL42 18296 127463271
VRL420 9922 296540679
VRL421 12418 371109515
VRL422 12357 369316303
VRL423 12364 369502706
VRL424 8756 261662439
VRL425 12393 370339041
VRL426 12368 369650514
VRL427 12373 369795214
VRL428 6046 180698022
VRL429 12089 361310448
VRL43 24830 218202662
VRL430 11884 355177935
VRL431 12279 366995197
VRL432 7714 230555608
VRL433 12426 371211123
VRL434 12379 369967283
VRL435 12251 366159944
VRL436 7030 210107919
VRL437 12359 369372942
VRL438 12294 367118496
VRL439 12394 370393066
VRL44 15180 218986867
VRL440 7073 210990270
VRL441 12642 376819849
VRL442 12414 370878618
VRL443 12517 373639171
VRL444 7124 212800018
VRL445 12403 370589885
VRL446 12270 366536120
VRL447 12478 372449167
VRL448 7068 211235830
VRL449 12365 369496976
VRL45 34590 206569980
VRL450 12365 369553588
VRL451 12441 370717930
VRL452 6841 204455992
VRL453 12316 368095955
VRL454 12268 366636517
VRL455 12526 373957748
VRL456 12543 374130091
VRL457 2321 69369299
VRL458 12386 370181961
VRL459 12404 370699857
VRL46 8753 123895254
VRL460 12379 369973392
VRL461 12385 370123029
VRL462 1863 55652588
VRL463 12303 367442832
VRL464 12550 374275115
VRL465 12553 374457502
VRL466 12537 374049548
VRL467 2385 71143393
VRL468 12535 374034831
VRL469 12441 371636611
VRL47 17294 219386671
VRL470 12435 371431173
VRL471 2860 85477522
VRL472 12443 371725824
VRL473 12258 366176644
VRL474 12306 367525079
VRL475 3086 92158095
VRL476 12438 371489297
VRL477 12504 373092777
VRL478 12490 372697626
VRL479 3088 92210538
VRL48 23617 214419311
VRL480 12510 373265676
VRL481 12420 370827926
VRL482 12443 371506986
VRL483 12437 371357601
VRL484 3764 112247809
VRL485 12405 370311975
VRL486 12363 369369188
VRL487 12395 370180580
VRL488 6345 189542854
VRL489 12395 370229634
VRL49 15179 218700318
VRL490 12367 369365421
VRL491 12385 369958781
VRL492 12448 371548976
VRL493 7783 232264057
VRL494 12432 371098802
VRL495 12388 370010826
VRL496 12289 367173284
VRL497 9754 291431014
VRL498 12312 367829989
VRL499 12335 368427907
VRL5 94614 149040310
VRL50 7550 129185518
VRL500 12286 367061485
VRL501 12339 368511869
VRL502 12363 369115817
VRL503 12399 370113007
VRL504 3017 90008892
VRL505 12464 371661980
VRL506 12501 372901334
VRL507 12395 370014803
VRL508 12412 370520919
VRL509 12348 368859708
VRL51 12896 220242896
VRL510 11629 347387233
VRL511 12361 369254058
VRL512 12353 368972183
VRL513 12337 368529088
VRL514 12361 369236088
VRL515 9560 285570915
VRL516 12369 369455793
VRL517 12392 370173758
VRL518 12355 369052646
VRL519 12431 371388767
VRL52 9804 220052071
VRL520 1917 57276013
VRL521 12458 372206561
VRL522 12612 376883026
VRL523 12367 369403103
VRL524 26647 345943387
VRL525 14119 15048558
VRL53 9610 221399826
VRL54 4632 113916422
VRL55 8698 223470727
VRL56 9015 221070506
VRL57 8371 222436148
VRL58 9328 222004802
VRL59 3479 79550921
VRL6 87219 144400840
VRL60 9888 221455812
VRL61 12896 218142746
VRL62 7816 221611939
VRL63 10234 220218392
VRL64 2493 70112568
VRL65 7489 220957043
VRL66 7819 222187149
VRL67 9095 219451696
VRL68 18432 213002794
VRL69 2350 66151494
VRL7 93293 144785513
VRL70 7743 220603815
VRL71 7520 221225190
VRL72 8140 220618340
VRL73 6505 180428856
VRL74 7812 221568853
VRL75 8194 220501770
VRL76 7585 219666802
VRL77 5926 156423669
VRL78 12259 219269286
VRL79 7660 219862964
VRL8 130392 141314381
VRL80 8154 221748380
VRL81 4895 140334941
VRL82 7426 220837377
VRL83 7607 222381495
VRL84 7650 222859399
VRL85 660 18411872
VRL86 8294 222081979
VRL87 7744 222183480
VRL88 7422 220963206
VRL89 3088 82460767
VRL9 70173 88317844
VRL90 7738 222285339
VRL91 8780 221768549
VRL92 7673 220837906
VRL93 3072 79671429
VRL94 9233 219150933
VRL95 8099 222013270
VRL96 8196 223135312
VRL97 3682 97835088
VRL98 9410 222017864
VRL99 8962 223160239
VRT1 70035 272442614
VRT10 37396 74041240
VRT100 1 839681426
VRT101 1 825560060
VRT102 1 595904407
VRT103 1 486875112
VRT104 1 387033265
VRT105 1 371528181
VRT106 1 313513962
VRT107 1 277530821
VRT108 1 268302114
VRT109 3 319484498
VRT11 18698 27611025
VRT110 5 386368861
VRT111 7 393936069
VRT112 7 384166854
VRT113 1 46063367
VRT114 7 344525641
VRT115 6 384186008
VRT116 8 388949147
VRT117 332 334400544
VRT118 1 222115097
VRT119 3 377547369
VRT12 5986 380511905
VRT120 10 383496928
VRT121 33 389650655
VRT122 6 59236435
VRT123 1 772932187
VRT124 1 662004353
VRT125 1 535506559
VRT126 1 376147139
VRT127 1 364230008
VRT128 1 346409914
VRT129 1 311292523
VRT13 3363 217068541
VRT130 1 247732340
VRT131 1 228143320
VRT132 1 221182781
VRT133 2 321892640
VRT134 490 332426844
VRT135 12 378048109
VRT136 9 378909870
VRT137 6 345737823
VRT138 2 137693511
VRT139 7 385107928
VRT14 4685 4674270
VRT140 8 360581972
VRT141 10 364952837
VRT142 4 133261911
VRT143 8 359905961
VRT144 5 370674748
VRT145 9 378247816
VRT146 6 166907986
VRT147 14 379842153
VRT148 15 375595384
VRT149 41 289507176
VRT15 1171 26255719
VRT150 11 366984719
VRT151 14 374291772
VRT152 10 185283047
VRT153 1 550518975
VRT154 1 529596002
VRT155 1 413748038
VRT156 1 326378286
VRT157 1 272612222
VRT158 1 260396842
VRT159 1 197956435
VRT16 293 13983146
VRT160 2 384149701
VRT161 2 288058306
VRT162 4 353983664
VRT163 461 371881983
VRT164 2 310725315
VRT165 2 280326572
VRT166 3 371471404
VRT167 3 354148189
VRT168 3 303679844
VRT169 4 341249946
VRT17 37 392789976
VRT170 382 371460784
VRT171 13 392880011
VRT172 13 164097178
VRT173 1 313568160
VRT174 1 289498315
VRT175 1 277254249
VRT176 1 244324502
VRT177 1 233859027
VRT178 1 225974235
VRT179 1 211674833
VRT18 13 392458500
VRT180 1 199962141
VRT181 2 390673241
VRT182 2 334991523
VRT183 2 324316137
VRT184 2 292002398
VRT185 1 133841611
VRT186 3 336899598
VRT187 28 389500106
VRT188 6 332993899
VRT189 6 378599539
VRT19 12 379958897
VRT190 1 47256133
VRT191 6 330076811
VRT192 7 362796652
VRT193 8 365387335
VRT194 20 273534543
VRT195 9 378695651
VRT196 11 392251032
VRT197 205 341394663
VRT198 7 347210350
VRT199 7 370650631
VRT2 72834 271575692
VRT20 11 316368323
VRT200 8 391548385
VRT201 6 385659507
VRT202 7 341110862
VRT203 1 55350661
VRT204 8 387616857
VRT205 3 259325358
VRT206 5 392602723
VRT207 41 394037361
VRT208 3 148003845
VRT209 7 387415360
VRT21 13 385338369
VRT210 7 365756282
VRT211 6 352657526
VRT212 5 346047628
VRT213 2 134650353
VRT214 5 356250620
VRT215 6 374573269
VRT216 6 364137996
VRT217 7 343458516
VRT218 2 121348818
VRT219 7 358240592
VRT22 14 372163844
VRT220 8 383435354
VRT221 8 365970383
VRT222 6 357597984
VRT223 7 355728138
VRT224 8 362648569
VRT225 7 390172982
VRT226 8 391413434
VRT227 8 377681388
VRT228 1 42933508
VRT229 100 376541917
VRT23 14 352781625
VRT230 20 391000381
VRT231 13 383659375
VRT232 58 386123281
VRT233 11 394338841
VRT234 11 274288418
VRT235 1 843366180
VRT236 1 842558404
VRT237 1 707956555
VRT238 1 635713434
VRT239 1 567300182
VRT24 19 384683297
VRT240 1 439630435
VRT241 1 236595445
VRT242 1 231667822
VRT243 2 382351630
VRT244 2 103223822
VRT245 1 690654357
VRT246 1 541439571
VRT247 1 495417988
VRT248 1 481763206
VRT249 1 429350720
VRT25 16 379729070
VRT250 1 224823088
VRT251 1 212589178
VRT252 2 374746477
VRT253 2 318111367
VRT254 32 270969991
VRT255 2 352563619
VRT256 7 386835620
VRT257 4317 352826229
VRT258 19 370712563
VRT259 15988 152796988
VRT26 16 381718727
VRT260 139272 132691865
VRT261 144342 125825665
VRT262 134915 127746545
VRT263 134435 136057221
VRT264 14399 299590150
VRT265 4 348720001
VRT266 9 372442387
VRT267 49 372917903
VRT268 1 30388259
VRT269 14 376657571
VRT27 2 51507477
VRT270 16 394062851
VRT271 16 377073984
VRT272 8 278699154
VRT273 13 345916081
VRT274 3 386677656
VRT275 5 363840571
VRT276 25 336198071
VRT277 10 365551181
VRT278 392 383359217
VRT279 3 345650541
VRT28 6 344600068
VRT280 4 347682430
VRT281 8 375481157
VRT282 12 376742698
VRT283 33 366827136
VRT284 11 349043615
VRT285 35 386781479
VRT286 3 345588977
VRT287 4 349532575
VRT288 6 304738240
VRT289 7 374752607
VRT29 7 384846875
VRT290 9 383055365
VRT291 13 380263163
VRT292 12960 218175336
VRT3 9008 334464140
VRT30 7 359521465
VRT31 33 269170512
VRT32 147 10842596
VRT33 586 15797052
VRT34 2343 67436863
VRT35 19198 357652178
VRT36 54118 304770597
VRT37 158584 137207847
VRT38 18224 13419263
VRT39 117629 200713630
VRT4 3 141387178
VRT40 84194 68231834
VRT41 2 304060631
VRT42 6 387303573
VRT43 28 305102738
VRT44 156410 129471546
VRT45 39757 26634912
VRT46 185379 123415254
VRT47 150001 106613745
VRT48 168310 113419801
VRT49 8481 7272582
VRT5 8 354279535
VRT50 133023 105741590
VRT51 156289 117906091
VRT52 142141 87372543
VRT53 188438 120029711
VRT54 103319 61435964
VRT55 157460 119214188
VRT56 158781 124790808
VRT57 126 382297511
VRT58 350 387645775
VRT59 1714 380142254
VRT6 11 387350249
VRT60 93605 262107503
VRT61 145106 21008965
VRT62 75789 25336814
VRT63 13375 365641119
VRT64 20 379347618
VRT65 269 392772876
VRT66 3056 391160250
VRT67 3483 231235844
VRT68 6925 378855996
VRT69 16 388667304
VRT7 11 393947221
VRT70 16 378559418
VRT71 12 379509384
VRT72 7 285874095
VRT73 12 387522266
VRT74 18 375242791
VRT75 16 386329687
VRT76 229 277860126
VRT77 17 367327734
VRT78 15 385834222
VRT79 7 149460915
VRT8 30744 333424138
VRT80 1 356776219
VRT81 1 350268637
VRT82 1 316334699
VRT83 1 337490635
VRT84 1 252032905
VRT85 1 217689105
VRT86 1 199443007
VRT87 1 198537509
VRT88 2 368166310
VRT89 2 330550494
VRT9 74952 70629182
VRT90 1 146904662
VRT91 3 319096504
VRT92 7 379783228
VRT93 11 374771935
VRT94 13 379441801
VRT95 3 70710155
VRT96 16 344076996
VRT97 10 385210617
VRT98 15 392781064
VRT99 22 370094349
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 248.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:
Entries Bases Species
1942689 187052173729 Triticum aestivum
3974099 118331089628 Severe acute respiratory syndrome coronavirus 2
1347437 101344326581 Hordeum vulgare subsp. vulgare
27470955 27779877370 Homo sapiens
151942 14143035205 Escherichia coli
1730279 10890134987 Danio rerio
29651 10857487592 Avena sativa
2241654 10650574866 Bos taurus
10031524 10460651943 Mus musculus
23092 9981509194 Triticum turgidum subsp. durum
21926 7509512047 Klebsiella pneumoniae
4219701 7411318899 Zea mays
21523 6749236152 Secale cereale
2202561 6548834711 Rattus norvegicus
448 5920478160 Aegilops longissima
1471246 5776368607 Canis lupus familiaris
261 5272471377 Aegilops sharonensis
126 5271947897 Aegilops speltoides subsp. speltoides
54 5178626132 Rhinatrema bivittatum
3309235 5084672053 Sus scrofa
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
187 Dec 2011 135117731375 146413798
188 Feb 2012 137384889783 149819246
189 Apr 2012 139266481398 151824421
190 Jun 2012 141343240755 154130210
191 Aug 2012 143081765233 156424033
192 Oct 2012 145430961262 157889737
193 Dec 2012 148390863904 161140325
194 Feb 2013 150141354858 162886727
195 Apr 2013 151178979155 164136731
196 Jun 2013 152599230112 165740164
197 Aug 2013 154192921011 167295840
198 Oct 2013 155176494699 168335396
199 Dec 2013 156230531562 169331407
200 Feb 2014 157943793171 171123749
201 Apr 2014 159813411760 171744486
202 Jun 2014 161822845643 173353076
203 Aug 2014 165722980375 174108750
204 Oct 2014 181563676918 178322253
205 Dec 2014 184938063614 179295769
206 Feb 2015 187893826750 181336445
207 Apr 2015 189739230107 182188746
208 Jun 2015 193921042946 185019352
209 Aug 2015 199823644287 187066846
210 Oct 2015 202237081559 188372017
211 Dec 2015 203939111071 189232925
212 Feb 2016 207018196067 190250235
213 Apr 2016 211423912047 193739511
214 Jun 2016 213200907819 194463572
215 Aug 2016 217971437647 196120831
216 Oct 2016 220731315250 197390691
217 Dec 2016 224973060433 198565475
218 Feb 2017 228719437638 199341377
219 Apr 2017 231824951552 200877884
220 Jun 2017 234997362623 201663568
221 Aug 2017 240343378258 203180606
222 Oct 2017 244914705468 203953682
223 Dec 2017 249722163594 206293625
224 Feb 2018 253630708098 207040555
225 Apr 2018 260189141631 208452303
226 Jun 2018 263957884539 209775348
227 Aug 2018 260806936411 208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
228 Oct 2018 279668290132 209656636
229 Dec 2018 285688542186 211281415
230 Feb 2019 303709510632 212260377
231 Apr 2019 321680566570 212775414
232 Jun 2019 329835282370 213383758
233 Aug 2019 366733917629 213865349
234 Oct 2019 386197018538 216763706
235 Dec 2019 388417258009 215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
236 Feb 2020 399376854872 216214215
237 Apr 2020 415770027949 216531829
238 Jun 2020 427823258901 217122233
239 Aug 2020 654057069549 218642238
240 Oct 2020 698688094046 219055207
241 Dec 2020 723003822007 221467827
242 Feb 2021 776291211106 226241476
243 Apr 2021 832400799511 227123201
244 Jun 2021 866009790959 227888889
245 Aug 2021 940513260726 231982592
246 Oct 2021 1014763752113 233642893
247 Dec 2021 1053275115030 234557297
248 Feb 2022 1173984081721 236338284
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
187 Dec 2011 239868309609 73729553
188 Feb 2012 261370512675 78656704
189 Apr 2012 272693351548 80905298
190 Jun 2012 287577367116 82076779
191 Aug 2012 308196411905 84020064
192 Oct 2012 333881846451 86480509
193 Dec 2012 356002922838 92767765
194 Feb 2013 390900990416 103101291
195 Apr 2013 418026593606 110509314
196 Jun 2013 453829752320 112488036
197 Aug 2013 500420412665 124812020
198 Oct 2013 535842167741 130203205
199 Dec 2013 556764321498 133818570
200 Feb 2014 591378698544 139725795
201 Apr 2014 621015432437 143446790
202 Jun 2014 719581958743 175779064
203 Aug 2014 774052098731 189080419
204 Oct 2014 805549167708 196049974
205 Dec 2014 848977922022 200301550
206 Feb 2015 873281414087 205465046
207 Apr 2015 969102906813 243779199
208 Jun 2015 1038937210221 258702138
209 Aug 2015 1163275601001 302955543
210 Oct 2015 1222635267498 309198943
211 Dec 2015 1297865618365 317122157
212 Feb 2016 1399865495608 333012760
213 Apr 2016 1452207704949 338922537
214 Jun 2016 1556175944648 350278081
215 Aug 2016 1637224970324 359796497
216 Oct 2016 1676238489250 363213315
217 Dec 2016 1817189565845 395301176
218 Feb 2017 1892966308635 409490397
219 Apr 2017 2035032639807 451840147
220 Jun 2017 2164683993369 487891767
221 Aug 2017 2242294609510 499965722
222 Oct 2017 2318156361999 508825331
223 Dec 2017 2466098053327 551063065
224 Feb 2018 2608532210351 564286852
225 Apr 2018 2784740996536 621379029
226 Jun 2018 2944617324086 639804105
227 Aug 2018 3204855013281 665309765
228 Oct 2018 3444172142207 722438528
229 Dec 2018 3656719423096 773773190
230 Feb 2019 4164513961679 945019312
231 Apr 2019 4421986382065 993732214
232 Jun 2019 4847677297950 1022913321
233 Aug 2019 5585922333160 1075272215
234 Oct 2019 5985250251028 1097629174
235 Dec 2019 6277551200690 1127023870
236 Feb 2020 6968991265752 1206720688
237 Apr 2020 7788133221338 1267547429
238 Jun 2020 8114046262158 1302852615
239 Aug 2020 8841649410652 1408122887
240 Oct 2020 9215815569509 1432874252
241 Dec 2020 11830842428018 1517995689
242 Feb 2021 12270717209612 1563938043
243 Apr 2021 12732048052023 1590670459
244 Jun 2021 13442974346437 1632796606
245 Aug 2021 13888187863722 1653427055
246 Oct 2021 14599101574547 1721064101
247 Dec 2021 14922033922302 1734664952
248 Feb 2022 15428122140820 1750505007
The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.
TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).
Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.
Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tsa
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.
Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.
Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.
Release Date Base Pairs Entries
201 Apr 2014 23632325832 29734989
202 Jun 2014 31707343431 38011942
203 Aug 2014 33676182560 40556905
204 Oct 2014 36279458440 43567759
205 Dec 2014 46056420903 62635617
206 Feb 2015 49765340047 66706014
207 Apr 2015 55796332435 71989588
208 Jun 2015 60697472570 76974601
209 Aug 2015 69360654413 87827013
210 Oct 2015 70917172944 81790031
211 Dec 2015 77583339176 87488539
212 Feb 2016 81932555094 92132318
213 Apr 2016 87811163676 98147566
214 Jun 2016 94413958919 104677061
215 Aug 2016 103399742586 113179607
216 Oct 2016 113209225762 124199597
217 Dec 2016 125328824508 142094337
218 Feb 2017 133517212104 151431485
219 Apr 2017 149038907599 165068542
220 Jun 2017 158112969073 176812130
221 Aug 2017 167045663417 186777106
222 Oct 2017 172909268535 192754804
223 Dec 2017 181394660188 201559502
224 Feb 2018 193940551226 214324264
225 Apr 2018 205232396043 227364990
226 Jun 2018 216556686631 238788334
227 Aug 2018 225520004678 249295386
228 Oct 2018 235875573598 259927414
229 Dec 2018 248592892188 274845473
230 Feb 2019 263936885705 294772430
231 Apr 2019 277118019688 311247136
232 Jun 2019 285390240861 319927264
233 Aug 2019 294727165179 331347807
234 Oct 2019 305371891408 342811151
235 Dec 2019 325433016129 367193844
236 Feb 2020 340994289065 386644871
237 Apr 2020 349692751528 396392280
238 Jun 2020 359947709062 409725050
239 Aug 2020 366968951160 417524567
240 Oct 2020 382996662270 435968379
241 Dec 2020 392206975386 446397378
242 Feb 2021 407605409948 463151000
243 Apr 2021 425076483459 481154920
244 Jun 2021 436594941165 494641358
245 Aug 2021 440578422611 498305045
246 Oct 2021 449891016597 508319391
247 Dec 2021 455870853358 514158576
248 Feb 2022 465013156502 524464601
The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.
Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
ftp://ftp.ncbi.nih.gov/genbank/tls
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.
Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.
Release Date Base Pairs Entries
217 Dec 2016 584697919 1268690
218 Feb 2017 636923295 1438349
219 Apr 2017 636923295 1438349 (unchanged)
220 Jun 2017 824191338 1628475
221 Aug 2017 824191338 1628475 (unchanged)
222 Oct 2017 2993818315 9479460
223 Dec 2017 4458042616 12695198
224 Feb 2018 4531966831 12819978
225 Apr 2018 5612769448 14782654
226 Jun 2018 5896511468 15393041
227 Aug 2018 6077824493 15822538
228 Oct 2018 8435112913 20752288
229 Dec 2018 8511829281 20924588
230 Feb 2019 9146836085 23259929
231 Apr 2019 9623321565 24240761
232 Jun 2019 10182427815 25530139
233 Aug 2019 10531800829 26363945
234 Oct 2019 10848455369 27460978
235 Dec 2019 11280596614 28227180
236 Feb 2020 13669678196 34037371
237 Apr 2020 24615270313 65521132
238 Jun 2020 27500635128 75063181
239 Aug 2020 27825059498 75682157
240 Oct 2020 28814798868 78177358
241 Dec 2020 33036509446 88039152
242 Feb 2021 33634122995 90130561
243 Apr 2021 37998534461 102395753
244 Jun 2021 38198113354 102662929
245 Aug 2021 39930167315 106995218
246 Oct 2021 40168874815 107569935
247 Dec 2021 41143480750 109379021
248 Feb 2022 41321107981 109809966
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
February 15 2022
NCBI-GenBank Flat File Release 248.0
Bacterial Sequences (Part 1)
51396 loci, 92682287 bases, from 51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.
NOTE : Presentation of GI sequence identifiers in the GenBank
flatfile format was discontinued as of March 2017.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, possibly 'LINEAGE'. But because changes like this can be
very disruptive for customers, implementation has not yet been scheduled.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
3.4.4.1 : Important notice about parsing the LOCUS line
Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.
Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.
Consider this LOCUS line for a typical complete bacterial genome:
LOCUS CP032762 5868661 bp DNA circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:
LOCUS AZZZAA02123456789 9999999999 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:
LOCUS AZZZAA0212345678910000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:
LOCUS AZZZAA02123456789 10000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.
3.4.4.2 : Data elements of the LOCUS line
The data elements of the LOCUS line format and their typical/historical
column positions are as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus Name (usually identical to the Accession Number)
29-29 space
30-40 Sequence Length, right-justified
41-41 space
42-43 'bp'
44-44 space
45-47 Strandedness : spaces (if not known), ss- (single-stranded),
ds- (double-stranded), or ms- (mixed-stranded)
48-53 Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA).
Left justified.
54-55 space
56-63 Molecule Topology : 'linear' followed by two spaces,
or 'circular'
64-64 space
65-67 Division Code
68-68 space
69-79 Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.
The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :
LOCUS HUMPDNRC 273 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S125 polymorphic dinucleotide repeat.
ACCESSION L10620
LOCUS HUMPDNRG 169 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S114 polymorphic dinucleotide repeat.
ACCESSION L10624
But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:
LOCUS AF035771 1357 bp mRNA linear PRI 30-JUN-1998
DEFINITION Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
complete cds.
ACCESSION AF035771
The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :
PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags)
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites)
GSS - GSS sequences (Genome Survey Sequences)
HTG - HTGS sequences (High Throughput Genomic sequences)
HTC - HTC sequences (High Throughput cDNA sequences)
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences
The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1
^^^^^^^^^^
Compound
Accession.Version
Number
A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:
http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS ANHA01000001 503 bp DNA linear BCT 23-NOV-2012
DEFINITION Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION ANHA01000001 ANHA01000000
VERSION ANHA01000001.1
DBLINK BioProject: PRJNA177352
BioSample: SAMN01795900
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK BioProject:PRJNA174162,PRJNA999998,PRJNA999999
And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.
As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".
DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:
http://www.ncbi.nlm.nih.gov/bioproject
At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:
http://www.ncbi.nlm.nih.gov/books/NBK54016/
DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:
http://www.ncbi.nlm.nih.gov/assembly
At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:
http://www.ncbi.nlm.nih.gov/assembly/help/
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:
http://www.insdc.org/documents/feature-table
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.2
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
The list of valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.3
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS KZ271580 141308 bp DNA linear CON 17-AUG-2017
DEFINITION Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION KZ271580 LQNL01000000
VERSION KZ271580.1
DBLINK BioProject: PRJNA230512
BioSample: SAMN04226856
KEYWORDS WGS; HIGH_QUALITY_DRAFT.
...
mRNA complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/product="hypothetical protein"
CDS complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/codon_start=1
/product="hypothetical protein"
/protein_id="OZC04795.1"
/db_xref="GI:1233056989"
/translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Scaffold/CON-division join() sequence
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.
The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] .
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Sayers E, Cavanaugh M, Clark K, Ostell J, Pruitt K,
Karsch-Mizrachi I, "GenBank", Nucleic Acids Research,
Volume 47, Issue D1, January 2019, pp. D94-D99
PMID: 30365038
PMCID: PMC6323954
DOI: 10.1093/nar/gky989
The following statement is an example of how one might cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'
(1) Sayers, E. et al, Nucleic Acids Res. 47(D1):D94-D99 (2019)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: Simply direct your web browser of choice to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] .
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 218.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
Vincent Calhoun, Andreina Castillo Siri, Larry Chlumsky, Karen Clark,
Scott Durkin, Francescopaolo di Cello, Michel Eschenbrenner,
Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Augustus Tilley,
Beverly Underwood, Simone Walker and Linda Yankie
Data Management and Preparation
Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
Sergiy Gotvyanskyy, Eugene Gribov, Jonathan Kans, Leonid Khotomliansky,
Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh, Alex Kotliarov,
Frank Ludwig, Anatoly Mnev, Vasuki Palanigobu,
Anton Perkov, Andriy Petrow, Sergey Petrunin, Wenyao Shi, Denis Sinyakov,
Thomas Smith, Vladimir Soussov, Elena Starchenko, Hanzhen Sun,
Andrei Vereshchagin, Jewen Xiao, Eugene Yaschenko, Liwei Zhou
Database Administration
Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
Benjamin Slade, Constantin Vasilyev
Customer Support
Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian
Project Direction
Steve Sherry : Acting Director, NCBI
Kim Pruitt : Branch Chief, NCBI/IEB
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
