Release Notes For GenBank Release 250

GBREL.TXT          Genetic Sequence Data Bank
                         June 15 2022

               NCBI-GenBank Flat File Release 250.0

                    Distribution Release Notes

 239017893 sequences,  1395628631187 bases, for traditional GenBank records
2454482793 sequences, 17237428495208 bases, for set-based (WGS/TSA/TLS) records

  This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://www.ncbi.nlm.nih.gov/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 250.0
1.2 Cutoff Date
1.3 Important Changes in Release 250.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 250.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use Submission Portal or BankIt for
sending sequence data.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       Email:  [email protected]

Updates and changes to existing GenBank records:

       https://www.ncbi.nlm.nih.gov/genbank/update/
       Email: [email protected]

URLs for GenBank's web-based submission tools:

	Submission Portal    https://submit.ncbi.nlm.nih.gov/
	BankIt               https://www.ncbi.nlm.nih.gov/WebSub/

See Section 1.5 for additional details about submitting data to GenBank.

*****************************************************************************

  GenBank Release 250.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

  GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:

        ftp://ftp.ncbi.nih.gov/genbank/wgs
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	
        ftp://ftp.ncbi.nih.gov/genbank/tsa
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	
        ftp://ftp.ncbi.nih.gov/genbank/tls
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls

See the README files in those areas for more information.

  Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:

	ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/

  Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.

1.2 Cutoff Date

  This full release, 250.0, incorporates data processed by the INSDC databases
as of Monday June 13 2022 at 10:58PM EDT. For more recent data, users are
advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotide' database (see Section 6.4 of this document).

1.3 Important Changes in Release 250.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 407 with this release:
  
  - the BCT division is now composed of 789 files (+41)
  - the INV division is now composed of 715 files (+77)
  - the MAM division is now composed of 133 files (+8)
  - the PAT division is now composed of 251 files (+1)
  - the PHG division is now composed of   6 files (+1)
  - the PLN division is now composed of 932 files (+51)
  - the PRI division is now composed of  57 files (+1)
  - the ROD division is now composed of 190 files (+113)
  - the VRL division is now composed of 711 files (+108)
  - the VRT division is now composed of 303 files (+6)

1.4 Upcoming Changes

  No changes to the GenBank flatfile format are planned at this time.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank utilizing the tools summarized below.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. General
information for submitting to Genbank is available online:

	https://www.ncbi.nlm.nih.gov/genbank/submit/

  To assist researchers in entering their own sequence data, GenBank
provides Web-based submission tools: Submission Portal and Bankit.

	Submission Portal    https://submit.ncbi.nlm.nih.gov/
	BankIt               https://www.ncbi.nlm.nih.gov/WebSub/

  Submission Portal provides an efficient submission pathway for high
frequency submission types (e.g., 16S rRNA, rRNA-ITS, metazoan COX1,
SARS-CoV-2, etc.).

  BankIt is an easy-to-use program that enables authors to enter one
or more sequences, annotate, and submit to GenBank. BankIt provides
a simple forms-based approach for submitting your sequence and the
relevant associated metadata to GenBank.

  Genbank also provides submission preparation tools which require uploading
via the Submission Portal or email to [email protected] when relevant:

	table2asn: https://www.ncbi.nlm.nih.gov/genbank/table2asn/

  table2asn is a command-line program that automates the creation of sequence
records for submission to GenBank. It is used primarily for submission of
complete genomes and large batches of sequences and is available by FTP
for use on MAC, PC and Unix platforms:

	https://ftp.ncbi.nlm.nih.gov/asn1-converters/by_program/table2asn/

  Genome Workbench offers a rich set of integrated tools for studying
and analyzing genetic data. The Submission Wizard allows you to prepare
submissions of single eukaryotic and prokaryotic genomes. You can also
use Genome Workbench to edit and visualize an ASN.1 file created by table2asn.

	Genome Workbench: https://www.ncbi.nlm.nih.gov/tools/gbench/

  Through the international collaboration of DNA sequence databases,
GenBank submissions are forwarded daily for inclusion in the European
Nucleotide Archive (ENA) and the DNA Databank of Japan (DDBJ).

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.

  SEQUIN.  As of January 2021, Sequin sequence submissions are no longer
accepted by GenBank, and the Sequin application is no longer distributed
by NCBI.  See: https://ncbiinsights.ncbi.nlm.nih.gov/tag/sequin/

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] .

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 5525 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct395.seq - Bacterial sequence entries, part 395.
330. gbbct396.seq - Bacterial sequence entries, part 396.
331. gbbct397.seq - Bacterial sequence entries, part 397.
332. gbbct398.seq - Bacterial sequence entries, part 398.
333. gbbct399.seq - Bacterial sequence entries, part 399.
334. gbbct4.seq - Bacterial sequence entries, part 4.
335. gbbct40.seq - Bacterial sequence entries, part 40.
336. gbbct400.seq - Bacterial sequence entries, part 400.
337. gbbct401.seq - Bacterial sequence entries, part 401.
338. gbbct402.seq - Bacterial sequence entries, part 402.
339. gbbct403.seq - Bacterial sequence entries, part 403.
340. gbbct404.seq - Bacterial sequence entries, part 404.
341. gbbct405.seq - Bacterial sequence entries, part 405.
342. gbbct406.seq - Bacterial sequence entries, part 406.
343. gbbct407.seq - Bacterial sequence entries, part 407.
344. gbbct408.seq - Bacterial sequence entries, part 408.
345. gbbct409.seq - Bacterial sequence entries, part 409.
346. gbbct41.seq - Bacterial sequence entries, part 41.
347. gbbct410.seq - Bacterial sequence entries, part 410.
348. gbbct411.seq - Bacterial sequence entries, part 411.
349. gbbct412.seq - Bacterial sequence entries, part 412.
350. gbbct413.seq - Bacterial sequence entries, part 413.
351. gbbct414.seq - Bacterial sequence entries, part 414.
352. gbbct415.seq - Bacterial sequence entries, part 415.
353. gbbct416.seq - Bacterial sequence entries, part 416.
354. gbbct417.seq - Bacterial sequence entries, part 417.
355. gbbct418.seq - Bacterial sequence entries, part 418.
356. gbbct419.seq - Bacterial sequence entries, part 419.
357. gbbct42.seq - Bacterial sequence entries, part 42.
358. gbbct420.seq - Bacterial sequence entries, part 420.
359. gbbct421.seq - Bacterial sequence entries, part 421.
360. gbbct422.seq - Bacterial sequence entries, part 422.
361. gbbct423.seq - Bacterial sequence entries, part 423.
362. gbbct424.seq - Bacterial sequence entries, part 424.
363. gbbct425.seq - Bacterial sequence entries, part 425.
364. gbbct426.seq - Bacterial sequence entries, part 426.
365. gbbct427.seq - Bacterial sequence entries, part 427.
366. gbbct428.seq - Bacterial sequence entries, part 428.
367. gbbct429.seq - Bacterial sequence entries, part 429.
368. gbbct43.seq - Bacterial sequence entries, part 43.
369. gbbct430.seq - Bacterial sequence entries, part 430.
370. gbbct431.seq - Bacterial sequence entries, part 431.
371. gbbct432.seq - Bacterial sequence entries, part 432.
372. gbbct433.seq - Bacterial sequence entries, part 433.
373. gbbct434.seq - Bacterial sequence entries, part 434.
374. gbbct435.seq - Bacterial sequence entries, part 435.
375. gbbct436.seq - Bacterial sequence entries, part 436.
376. gbbct437.seq - Bacterial sequence entries, part 437.
377. gbbct438.seq - Bacterial sequence entries, part 438.
378. gbbct439.seq - Bacterial sequence entries, part 439.
379. gbbct44.seq - Bacterial sequence entries, part 44.
380. gbbct440.seq - Bacterial sequence entries, part 440.
381. gbbct441.seq - Bacterial sequence entries, part 441.
382. gbbct442.seq - Bacterial sequence entries, part 442.
383. gbbct443.seq - Bacterial sequence entries, part 443.
384. gbbct444.seq - Bacterial sequence entries, part 444.
385. gbbct445.seq - Bacterial sequence entries, part 445.
386. gbbct446.seq - Bacterial sequence entries, part 446.
387. gbbct447.seq - Bacterial sequence entries, part 447.
388. gbbct448.seq - Bacterial sequence entries, part 448.
389. gbbct449.seq - Bacterial sequence entries, part 449.
390. gbbct45.seq - Bacterial sequence entries, part 45.
391. gbbct450.seq - Bacterial sequence entries, part 450.
392. gbbct451.seq - Bacterial sequence entries, part 451.
393. gbbct452.seq - Bacterial sequence entries, part 452.
394. gbbct453.seq - Bacterial sequence entries, part 453.
395. gbbct454.seq - Bacterial sequence entries, part 454.
396. gbbct455.seq - Bacterial sequence entries, part 455.
397. gbbct456.seq - Bacterial sequence entries, part 456.
398. gbbct457.seq - Bacterial sequence entries, part 457.
399. gbbct458.seq - Bacterial sequence entries, part 458.
400. gbbct459.seq - Bacterial sequence entries, part 459.
401. gbbct46.seq - Bacterial sequence entries, part 46.
402. gbbct460.seq - Bacterial sequence entries, part 460.
403. gbbct461.seq - Bacterial sequence entries, part 461.
404. gbbct462.seq - Bacterial sequence entries, part 462.
405. gbbct463.seq - Bacterial sequence entries, part 463.
406. gbbct464.seq - Bacterial sequence entries, part 464.
407. gbbct465.seq - Bacterial sequence entries, part 465.
408. gbbct466.seq - Bacterial sequence entries, part 466.
409. gbbct467.seq - Bacterial sequence entries, part 467.
410. gbbct468.seq - Bacterial sequence entries, part 468.
411. gbbct469.seq - Bacterial sequence entries, part 469.
412. gbbct47.seq - Bacterial sequence entries, part 47.
413. gbbct470.seq - Bacterial sequence entries, part 470.
414. gbbct471.seq - Bacterial sequence entries, part 471.
415. gbbct472.seq - Bacterial sequence entries, part 472.
416. gbbct473.seq - Bacterial sequence entries, part 473.
417. gbbct474.seq - Bacterial sequence entries, part 474.
418. gbbct475.seq - Bacterial sequence entries, part 475.
419. gbbct476.seq - Bacterial sequence entries, part 476.
420. gbbct477.seq - Bacterial sequence entries, part 477.
421. gbbct478.seq - Bacterial sequence entries, part 478.
422. gbbct479.seq - Bacterial sequence entries, part 479.
423. gbbct48.seq - Bacterial sequence entries, part 48.
424. gbbct480.seq - Bacterial sequence entries, part 480.
425. gbbct481.seq - Bacterial sequence entries, part 481.
426. gbbct482.seq - Bacterial sequence entries, part 482.
427. gbbct483.seq - Bacterial sequence entries, part 483.
428. gbbct484.seq - Bacterial sequence entries, part 484.
429. gbbct485.seq - Bacterial sequence entries, part 485.
430. gbbct486.seq - Bacterial sequence entries, part 486.
431. gbbct487.seq - Bacterial sequence entries, part 487.
432. gbbct488.seq - Bacterial sequence entries, part 488.
433. gbbct489.seq - Bacterial sequence entries, part 489.
434. gbbct49.seq - Bacterial sequence entries, part 49.
435. gbbct490.seq - Bacterial sequence entries, part 490.
436. gbbct491.seq - Bacterial sequence entries, part 491.
437. gbbct492.seq - Bacterial sequence entries, part 492.
438. gbbct493.seq - Bacterial sequence entries, part 493.
439. gbbct494.seq - Bacterial sequence entries, part 494.
440. gbbct495.seq - Bacterial sequence entries, part 495.
441. gbbct496.seq - Bacterial sequence entries, part 496.
442. gbbct497.seq - Bacterial sequence entries, part 497.
443. gbbct498.seq - Bacterial sequence entries, part 498.
444. gbbct499.seq - Bacterial sequence entries, part 499.
445. gbbct5.seq - Bacterial sequence entries, part 5.
446. gbbct50.seq - Bacterial sequence entries, part 50.
447. gbbct500.seq - Bacterial sequence entries, part 500.
448. gbbct501.seq - Bacterial sequence entries, part 501.
449. gbbct502.seq - Bacterial sequence entries, part 502.
450. gbbct503.seq - Bacterial sequence entries, part 503.
451. gbbct504.seq - Bacterial sequence entries, part 504.
452. gbbct505.seq - Bacterial sequence entries, part 505.
453. gbbct506.seq - Bacterial sequence entries, part 506.
454. gbbct507.seq - Bacterial sequence entries, part 507.
455. gbbct508.seq - Bacterial sequence entries, part 508.
456. gbbct509.seq - Bacterial sequence entries, part 509.
457. gbbct51.seq - Bacterial sequence entries, part 51.
458. gbbct510.seq - Bacterial sequence entries, part 510.
459. gbbct511.seq - Bacterial sequence entries, part 511.
460. gbbct512.seq - Bacterial sequence entries, part 512.
461. gbbct513.seq - Bacterial sequence entries, part 513.
462. gbbct514.seq - Bacterial sequence entries, part 514.
463. gbbct515.seq - Bacterial sequence entries, part 515.
464. gbbct516.seq - Bacterial sequence entries, part 516.
465. gbbct517.seq - Bacterial sequence entries, part 517.
466. gbbct518.seq - Bacterial sequence entries, part 518.
467. gbbct519.seq - Bacterial sequence entries, part 519.
468. gbbct52.seq - Bacterial sequence entries, part 52.
469. gbbct520.seq - Bacterial sequence entries, part 520.
470. gbbct521.seq - Bacterial sequence entries, part 521.
471. gbbct522.seq - Bacterial sequence entries, part 522.
472. gbbct523.seq - Bacterial sequence entries, part 523.
473. gbbct524.seq - Bacterial sequence entries, part 524.
474. gbbct525.seq - Bacterial sequence entries, part 525.
475. gbbct526.seq - Bacterial sequence entries, part 526.
476. gbbct527.seq - Bacterial sequence entries, part 527.
477. gbbct528.seq - Bacterial sequence entries, part 528.
478. gbbct529.seq - Bacterial sequence entries, part 529.
479. gbbct53.seq - Bacterial sequence entries, part 53.
480. gbbct530.seq - Bacterial sequence entries, part 530.
481. gbbct531.seq - Bacterial sequence entries, part 531.
482. gbbct532.seq - Bacterial sequence entries, part 532.
483. gbbct533.seq - Bacterial sequence entries, part 533.
484. gbbct534.seq - Bacterial sequence entries, part 534.
485. gbbct535.seq - Bacterial sequence entries, part 535.
486. gbbct536.seq - Bacterial sequence entries, part 536.
487. gbbct537.seq - Bacterial sequence entries, part 537.
488. gbbct538.seq - Bacterial sequence entries, part 538.
489. gbbct539.seq - Bacterial sequence entries, part 539.
490. gbbct54.seq - Bacterial sequence entries, part 54.
491. gbbct540.seq - Bacterial sequence entries, part 540.
492. gbbct541.seq - Bacterial sequence entries, part 541.
493. gbbct542.seq - Bacterial sequence entries, part 542.
494. gbbct543.seq - Bacterial sequence entries, part 543.
495. gbbct544.seq - Bacterial sequence entries, part 544.
496. gbbct545.seq - Bacterial sequence entries, part 545.
497. gbbct546.seq - Bacterial sequence entries, part 546.
498. gbbct547.seq - Bacterial sequence entries, part 547.
499. gbbct548.seq - Bacterial sequence entries, part 548.
500. gbbct549.seq - Bacterial sequence entries, part 549.
501. gbbct55.seq - Bacterial sequence entries, part 55.
502. gbbct550.seq - Bacterial sequence entries, part 550.
503. gbbct551.seq - Bacterial sequence entries, part 551.
504. gbbct552.seq - Bacterial sequence entries, part 552.
505. gbbct553.seq - Bacterial sequence entries, part 553.
506. gbbct554.seq - Bacterial sequence entries, part 554.
507. gbbct555.seq - Bacterial sequence entries, part 555.
508. gbbct556.seq - Bacterial sequence entries, part 556.
509. gbbct557.seq - Bacterial sequence entries, part 557.
510. gbbct558.seq - Bacterial sequence entries, part 558.
511. gbbct559.seq - Bacterial sequence entries, part 559.
512. gbbct56.seq - Bacterial sequence entries, part 56.
513. gbbct560.seq - Bacterial sequence entries, part 560.
514. gbbct561.seq - Bacterial sequence entries, part 561.
515. gbbct562.seq - Bacterial sequence entries, part 562.
516. gbbct563.seq - Bacterial sequence entries, part 563.
517. gbbct564.seq - Bacterial sequence entries, part 564.
518. gbbct565.seq - Bacterial sequence entries, part 565.
519. gbbct566.seq - Bacterial sequence entries, part 566.
520. gbbct567.seq - Bacterial sequence entries, part 567.
521. gbbct568.seq - Bacterial sequence entries, part 568.
522. gbbct569.seq - Bacterial sequence entries, part 569.
523. gbbct57.seq - Bacterial sequence entries, part 57.
524. gbbct570.seq - Bacterial sequence entries, part 570.
525. gbbct571.seq - Bacterial sequence entries, part 571.
526. gbbct572.seq - Bacterial sequence entries, part 572.
527. gbbct573.seq - Bacterial sequence entries, part 573.
528. gbbct574.seq - Bacterial sequence entries, part 574.
529. gbbct575.seq - Bacterial sequence entries, part 575.
530. gbbct576.seq - Bacterial sequence entries, part 576.
531. gbbct577.seq - Bacterial sequence entries, part 577.
532. gbbct578.seq - Bacterial sequence entries, part 578.
533. gbbct579.seq - Bacterial sequence entries, part 579.
534. gbbct58.seq - Bacterial sequence entries, part 58.
535. gbbct580.seq - Bacterial sequence entries, part 580.
536. gbbct581.seq - Bacterial sequence entries, part 581.
537. gbbct582.seq - Bacterial sequence entries, part 582.
538. gbbct583.seq - Bacterial sequence entries, part 583.
539. gbbct584.seq - Bacterial sequence entries, part 584.
540. gbbct585.seq - Bacterial sequence entries, part 585.
541. gbbct586.seq - Bacterial sequence entries, part 586.
542. gbbct587.seq - Bacterial sequence entries, part 587.
543. gbbct588.seq - Bacterial sequence entries, part 588.
544. gbbct589.seq - Bacterial sequence entries, part 589.
545. gbbct59.seq - Bacterial sequence entries, part 59.
546. gbbct590.seq - Bacterial sequence entries, part 590.
547. gbbct591.seq - Bacterial sequence entries, part 591.
548. gbbct592.seq - Bacterial sequence entries, part 592.
549. gbbct593.seq - Bacterial sequence entries, part 593.
550. gbbct594.seq - Bacterial sequence entries, part 594.
551. gbbct595.seq - Bacterial sequence entries, part 595.
552. gbbct596.seq - Bacterial sequence entries, part 596.
553. gbbct597.seq - Bacterial sequence entries, part 597.
554. gbbct598.seq - Bacterial sequence entries, part 598.
555. gbbct599.seq - Bacterial sequence entries, part 599.
556. gbbct6.seq - Bacterial sequence entries, part 6.
557. gbbct60.seq - Bacterial sequence entries, part 60.
558. gbbct600.seq - Bacterial sequence entries, part 600.
559. gbbct601.seq - Bacterial sequence entries, part 601.
560. gbbct602.seq - Bacterial sequence entries, part 602.
561. gbbct603.seq - Bacterial sequence entries, part 603.
562. gbbct604.seq - Bacterial sequence entries, part 604.
563. gbbct605.seq - Bacterial sequence entries, part 605.
564. gbbct606.seq - Bacterial sequence entries, part 606.
565. gbbct607.seq - Bacterial sequence entries, part 607.
566. gbbct608.seq - Bacterial sequence entries, part 608.
567. gbbct609.seq - Bacterial sequence entries, part 609.
568. gbbct61.seq - Bacterial sequence entries, part 61.
569. gbbct610.seq - Bacterial sequence entries, part 610.
570. gbbct611.seq - Bacterial sequence entries, part 611.
571. gbbct612.seq - Bacterial sequence entries, part 612.
572. gbbct613.seq - Bacterial sequence entries, part 613.
573. gbbct614.seq - Bacterial sequence entries, part 614.
574. gbbct615.seq - Bacterial sequence entries, part 615.
575. gbbct616.seq - Bacterial sequence entries, part 616.
576. gbbct617.seq - Bacterial sequence entries, part 617.
577. gbbct618.seq - Bacterial sequence entries, part 618.
578. gbbct619.seq - Bacterial sequence entries, part 619.
579. gbbct62.seq - Bacterial sequence entries, part 62.
580. gbbct620.seq - Bacterial sequence entries, part 620.
581. gbbct621.seq - Bacterial sequence entries, part 621.
582. gbbct622.seq - Bacterial sequence entries, part 622.
583. gbbct623.seq - Bacterial sequence entries, part 623.
584. gbbct624.seq - Bacterial sequence entries, part 624.
585. gbbct625.seq - Bacterial sequence entries, part 625.
586. gbbct626.seq - Bacterial sequence entries, part 626.
587. gbbct627.seq - Bacterial sequence entries, part 627.
588. gbbct628.seq - Bacterial sequence entries, part 628.
589. gbbct629.seq - Bacterial sequence entries, part 629.
590. gbbct63.seq - Bacterial sequence entries, part 63.
591. gbbct630.seq - Bacterial sequence entries, part 630.
592. gbbct631.seq - Bacterial sequence entries, part 631.
593. gbbct632.seq - Bacterial sequence entries, part 632.
594. gbbct633.seq - Bacterial sequence entries, part 633.
595. gbbct634.seq - Bacterial sequence entries, part 634.
596. gbbct635.seq - Bacterial sequence entries, part 635.
597. gbbct636.seq - Bacterial sequence entries, part 636.
598. gbbct637.seq - Bacterial sequence entries, part 637.
599. gbbct638.seq - Bacterial sequence entries, part 638.
600. gbbct639.seq - Bacterial sequence entries, part 639.
601. gbbct64.seq - Bacterial sequence entries, part 64.
602. gbbct640.seq - Bacterial sequence entries, part 640.
603. gbbct641.seq - Bacterial sequence entries, part 641.
604. gbbct642.seq - Bacterial sequence entries, part 642.
605. gbbct643.seq - Bacterial sequence entries, part 643.
606. gbbct644.seq - Bacterial sequence entries, part 644.
607. gbbct645.seq - Bacterial sequence entries, part 645.
608. gbbct646.seq - Bacterial sequence entries, part 646.
609. gbbct647.seq - Bacterial sequence entries, part 647.
610. gbbct648.seq - Bacterial sequence entries, part 648.
611. gbbct649.seq - Bacterial sequence entries, part 649.
612. gbbct65.seq - Bacterial sequence entries, part 65.
613. gbbct650.seq - Bacterial sequence entries, part 650.
614. gbbct651.seq - Bacterial sequence entries, part 651.
615. gbbct652.seq - Bacterial sequence entries, part 652.
616. gbbct653.seq - Bacterial sequence entries, part 653.
617. gbbct654.seq - Bacterial sequence entries, part 654.
618. gbbct655.seq - Bacterial sequence entries, part 655.
619. gbbct656.seq - Bacterial sequence entries, part 656.
620. gbbct657.seq - Bacterial sequence entries, part 657.
621. gbbct658.seq - Bacterial sequence entries, part 658.
622. gbbct659.seq - Bacterial sequence entries, part 659.
623. gbbct66.seq - Bacterial sequence entries, part 66.
624. gbbct660.seq - Bacterial sequence entries, part 660.
625. gbbct661.seq - Bacterial sequence entries, part 661.
626. gbbct662.seq - Bacterial sequence entries, part 662.
627. gbbct663.seq - Bacterial sequence entries, part 663.
628. gbbct664.seq - Bacterial sequence entries, part 664.
629. gbbct665.seq - Bacterial sequence entries, part 665.
630. gbbct666.seq - Bacterial sequence entries, part 666.
631. gbbct667.seq - Bacterial sequence entries, part 667.
632. gbbct668.seq - Bacterial sequence entries, part 668.
633. gbbct669.seq - Bacterial sequence entries, part 669.
634. gbbct67.seq - Bacterial sequence entries, part 67.
635. gbbct670.seq - Bacterial sequence entries, part 670.
636. gbbct671.seq - Bacterial sequence entries, part 671.
637. gbbct672.seq - Bacterial sequence entries, part 672.
638. gbbct673.seq - Bacterial sequence entries, part 673.
639. gbbct674.seq - Bacterial sequence entries, part 674.
640. gbbct675.seq - Bacterial sequence entries, part 675.
641. gbbct676.seq - Bacterial sequence entries, part 676.
642. gbbct677.seq - Bacterial sequence entries, part 677.
643. gbbct678.seq - Bacterial sequence entries, part 678.
644. gbbct679.seq - Bacterial sequence entries, part 679.
645. gbbct68.seq - Bacterial sequence entries, part 68.
646. gbbct680.seq - Bacterial sequence entries, part 680.
647. gbbct681.seq - Bacterial sequence entries, part 681.
648. gbbct682.seq - Bacterial sequence entries, part 682.
649. gbbct683.seq - Bacterial sequence entries, part 683.
650. gbbct684.seq - Bacterial sequence entries, part 684.
651. gbbct685.seq - Bacterial sequence entries, part 685.
652. gbbct686.seq - Bacterial sequence entries, part 686.
653. gbbct687.seq - Bacterial sequence entries, part 687.
654. gbbct688.seq - Bacterial sequence entries, part 688.
655. gbbct689.seq - Bacterial sequence entries, part 689.
656. gbbct69.seq - Bacterial sequence entries, part 69.
657. gbbct690.seq - Bacterial sequence entries, part 690.
658. gbbct691.seq - Bacterial sequence entries, part 691.
659. gbbct692.seq - Bacterial sequence entries, part 692.
660. gbbct693.seq - Bacterial sequence entries, part 693.
661. gbbct694.seq - Bacterial sequence entries, part 694.
662. gbbct695.seq - Bacterial sequence entries, part 695.
663. gbbct696.seq - Bacterial sequence entries, part 696.
664. gbbct697.seq - Bacterial sequence entries, part 697.
665. gbbct698.seq - Bacterial sequence entries, part 698.
666. gbbct699.seq - Bacterial sequence entries, part 699.
667. gbbct7.seq - Bacterial sequence entries, part 7.
668. gbbct70.seq - Bacterial sequence entries, part 70.
669. gbbct700.seq - Bacterial sequence entries, part 700.
670. gbbct701.seq - Bacterial sequence entries, part 701.
671. gbbct702.seq - Bacterial sequence entries, part 702.
672. gbbct703.seq - Bacterial sequence entries, part 703.
673. gbbct704.seq - Bacterial sequence entries, part 704.
674. gbbct705.seq - Bacterial sequence entries, part 705.
675. gbbct706.seq - Bacterial sequence entries, part 706.
676. gbbct707.seq - Bacterial sequence entries, part 707.
677. gbbct708.seq - Bacterial sequence entries, part 708.
678. gbbct709.seq - Bacterial sequence entries, part 709.
679. gbbct71.seq - Bacterial sequence entries, part 71.
680. gbbct710.seq - Bacterial sequence entries, part 710.
681. gbbct711.seq - Bacterial sequence entries, part 711.
682. gbbct712.seq - Bacterial sequence entries, part 712.
683. gbbct713.seq - Bacterial sequence entries, part 713.
684. gbbct714.seq - Bacterial sequence entries, part 714.
685. gbbct715.seq - Bacterial sequence entries, part 715.
686. gbbct716.seq - Bacterial sequence entries, part 716.
687. gbbct717.seq - Bacterial sequence entries, part 717.
688. gbbct718.seq - Bacterial sequence entries, part 718.
689. gbbct719.seq - Bacterial sequence entries, part 719.
690. gbbct72.seq - Bacterial sequence entries, part 72.
691. gbbct720.seq - Bacterial sequence entries, part 720.
692. gbbct721.seq - Bacterial sequence entries, part 721.
693. gbbct722.seq - Bacterial sequence entries, part 722.
694. gbbct723.seq - Bacterial sequence entries, part 723.
695. gbbct724.seq - Bacterial sequence entries, part 724.
696. gbbct725.seq - Bacterial sequence entries, part 725.
697. gbbct726.seq - Bacterial sequence entries, part 726.
698. gbbct727.seq - Bacterial sequence entries, part 727.
699. gbbct728.seq - Bacterial sequence entries, part 728.
700. gbbct729.seq - Bacterial sequence entries, part 729.
701. gbbct73.seq - Bacterial sequence entries, part 73.
702. gbbct730.seq - Bacterial sequence entries, part 730.
703. gbbct731.seq - Bacterial sequence entries, part 731.
704. gbbct732.seq - Bacterial sequence entries, part 732.
705. gbbct733.seq - Bacterial sequence entries, part 733.
706. gbbct734.seq - Bacterial sequence entries, part 734.
707. gbbct735.seq - Bacterial sequence entries, part 735.
708. gbbct736.seq - Bacterial sequence entries, part 736.
709. gbbct737.seq - Bacterial sequence entries, part 737.
710. gbbct738.seq - Bacterial sequence entries, part 738.
711. gbbct739.seq - Bacterial sequence entries, part 739.
712. gbbct74.seq - Bacterial sequence entries, part 74.
713. gbbct740.seq - Bacterial sequence entries, part 740.
714. gbbct741.seq - Bacterial sequence entries, part 741.
715. gbbct742.seq - Bacterial sequence entries, part 742.
716. gbbct743.seq - Bacterial sequence entries, part 743.
717. gbbct744.seq - Bacterial sequence entries, part 744.
718. gbbct745.seq - Bacterial sequence entries, part 745.
719. gbbct746.seq - Bacterial sequence entries, part 746.
720. gbbct747.seq - Bacterial sequence entries, part 747.
721. gbbct748.seq - Bacterial sequence entries, part 748.
722. gbbct749.seq - Bacterial sequence entries, part 749.
723. gbbct75.seq - Bacterial sequence entries, part 75.
724. gbbct750.seq - Bacterial sequence entries, part 750.
725. gbbct751.seq - Bacterial sequence entries, part 751.
726. gbbct752.seq - Bacterial sequence entries, part 752.
727. gbbct753.seq - Bacterial sequence entries, part 753.
728. gbbct754.seq - Bacterial sequence entries, part 754.
729. gbbct755.seq - Bacterial sequence entries, part 755.
730. gbbct756.seq - Bacterial sequence entries, part 756.
731. gbbct757.seq - Bacterial sequence entries, part 757.
732. gbbct758.seq - Bacterial sequence entries, part 758.
733. gbbct759.seq - Bacterial sequence entries, part 759.
734. gbbct76.seq - Bacterial sequence entries, part 76.
735. gbbct760.seq - Bacterial sequence entries, part 760.
736. gbbct761.seq - Bacterial sequence entries, part 761.
737. gbbct762.seq - Bacterial sequence entries, part 762.
738. gbbct763.seq - Bacterial sequence entries, part 763.
739. gbbct764.seq - Bacterial sequence entries, part 764.
740. gbbct765.seq - Bacterial sequence entries, part 765.
741. gbbct766.seq - Bacterial sequence entries, part 766.
742. gbbct767.seq - Bacterial sequence entries, part 767.
743. gbbct768.seq - Bacterial sequence entries, part 768.
744. gbbct769.seq - Bacterial sequence entries, part 769.
745. gbbct77.seq - Bacterial sequence entries, part 77.
746. gbbct770.seq - Bacterial sequence entries, part 770.
747. gbbct771.seq - Bacterial sequence entries, part 771.
748. gbbct772.seq - Bacterial sequence entries, part 772.
749. gbbct773.seq - Bacterial sequence entries, part 773.
750. gbbct774.seq - Bacterial sequence entries, part 774.
751. gbbct775.seq - Bacterial sequence entries, part 775.
752. gbbct776.seq - Bacterial sequence entries, part 776.
753. gbbct777.seq - Bacterial sequence entries, part 777.
754. gbbct778.seq - Bacterial sequence entries, part 778.
755. gbbct779.seq - Bacterial sequence entries, part 779.
756. gbbct78.seq - Bacterial sequence entries, part 78.
757. gbbct780.seq - Bacterial sequence entries, part 780.
758. gbbct781.seq - Bacterial sequence entries, part 781.
759. gbbct782.seq - Bacterial sequence entries, part 782.
760. gbbct783.seq - Bacterial sequence entries, part 783.
761. gbbct784.seq - Bacterial sequence entries, part 784.
762. gbbct785.seq - Bacterial sequence entries, part 785.
763. gbbct786.seq - Bacterial sequence entries, part 786.
764. gbbct787.seq - Bacterial sequence entries, part 787.
765. gbbct788.seq - Bacterial sequence entries, part 788.
766. gbbct789.seq - Bacterial sequence entries, part 789.
767. gbbct79.seq - Bacterial sequence entries, part 79.
768. gbbct8.seq - Bacterial sequence entries, part 8.
769. gbbct80.seq - Bacterial sequence entries, part 80.
770. gbbct81.seq - Bacterial sequence entries, part 81.
771. gbbct82.seq - Bacterial sequence entries, part 82.
772. gbbct83.seq - Bacterial sequence entries, part 83.
773. gbbct84.seq - Bacterial sequence entries, part 84.
774. gbbct85.seq - Bacterial sequence entries, part 85.
775. gbbct86.seq - Bacterial sequence entries, part 86.
776. gbbct87.seq - Bacterial sequence entries, part 87.
777. gbbct88.seq - Bacterial sequence entries, part 88.
778. gbbct89.seq - Bacterial sequence entries, part 89.
779. gbbct9.seq - Bacterial sequence entries, part 9.
780. gbbct90.seq - Bacterial sequence entries, part 90.
781. gbbct91.seq - Bacterial sequence entries, part 91.
782. gbbct92.seq - Bacterial sequence entries, part 92.
783. gbbct93.seq - Bacterial sequence entries, part 93.
784. gbbct94.seq - Bacterial sequence entries, part 94.
785. gbbct95.seq - Bacterial sequence entries, part 95.
786. gbbct96.seq - Bacterial sequence entries, part 96.
787. gbbct97.seq - Bacterial sequence entries, part 97.
788. gbbct98.seq - Bacterial sequence entries, part 98.
789. gbbct99.seq - Bacterial sequence entries, part 99.
790. gbchg.txt - Accession numbers of entries updated since the previous release.
791. gbcon1.seq - Constructed sequence entries, part 1.
792. gbcon10.seq - Constructed sequence entries, part 10.
793. gbcon100.seq - Constructed sequence entries, part 100.
794. gbcon101.seq - Constructed sequence entries, part 101.
795. gbcon102.seq - Constructed sequence entries, part 102.
796. gbcon103.seq - Constructed sequence entries, part 103.
797. gbcon104.seq - Constructed sequence entries, part 104.
798. gbcon105.seq - Constructed sequence entries, part 105.
799. gbcon106.seq - Constructed sequence entries, part 106.
800. gbcon107.seq - Constructed sequence entries, part 107.
801. gbcon108.seq - Constructed sequence entries, part 108.
802. gbcon109.seq - Constructed sequence entries, part 109.
803. gbcon11.seq - Constructed sequence entries, part 11.
804. gbcon110.seq - Constructed sequence entries, part 110.
805. gbcon111.seq - Constructed sequence entries, part 111.
806. gbcon112.seq - Constructed sequence entries, part 112.
807. gbcon113.seq - Constructed sequence entries, part 113.
808. gbcon114.seq - Constructed sequence entries, part 114.
809. gbcon115.seq - Constructed sequence entries, part 115.
810. gbcon116.seq - Constructed sequence entries, part 116.
811. gbcon117.seq - Constructed sequence entries, part 117.
812. gbcon118.seq - Constructed sequence entries, part 118.
813. gbcon119.seq - Constructed sequence entries, part 119.
814. gbcon12.seq - Constructed sequence entries, part 12.
815. gbcon120.seq - Constructed sequence entries, part 120.
816. gbcon121.seq - Constructed sequence entries, part 121.
817. gbcon122.seq - Constructed sequence entries, part 122.
818. gbcon123.seq - Constructed sequence entries, part 123.
819. gbcon124.seq - Constructed sequence entries, part 124.
820. gbcon125.seq - Constructed sequence entries, part 125.
821. gbcon126.seq - Constructed sequence entries, part 126.
822. gbcon127.seq - Constructed sequence entries, part 127.
823. gbcon128.seq - Constructed sequence entries, part 128.
824. gbcon129.seq - Constructed sequence entries, part 129.
825. gbcon13.seq - Constructed sequence entries, part 13.
826. gbcon130.seq - Constructed sequence entries, part 130.
827. gbcon131.seq - Constructed sequence entries, part 131.
828. gbcon132.seq - Constructed sequence entries, part 132.
829. gbcon133.seq - Constructed sequence entries, part 133.
830. gbcon134.seq - Constructed sequence entries, part 134.
831. gbcon135.seq - Constructed sequence entries, part 135.
832. gbcon136.seq - Constructed sequence entries, part 136.
833. gbcon137.seq - Constructed sequence entries, part 137.
834. gbcon138.seq - Constructed sequence entries, part 138.
835. gbcon139.seq - Constructed sequence entries, part 139.
836. gbcon14.seq - Constructed sequence entries, part 14.
837. gbcon140.seq - Constructed sequence entries, part 140.
838. gbcon141.seq - Constructed sequence entries, part 141.
839. gbcon142.seq - Constructed sequence entries, part 142.
840. gbcon143.seq - Constructed sequence entries, part 143.
841. gbcon144.seq - Constructed sequence entries, part 144.
842. gbcon145.seq - Constructed sequence entries, part 145.
843. gbcon146.seq - Constructed sequence entries, part 146.
844. gbcon147.seq - Constructed sequence entries, part 147.
845. gbcon148.seq - Constructed sequence entries, part 148.
846. gbcon149.seq - Constructed sequence entries, part 149.
847. gbcon15.seq - Constructed sequence entries, part 15.
848. gbcon150.seq - Constructed sequence entries, part 150.
849. gbcon151.seq - Constructed sequence entries, part 151.
850. gbcon152.seq - Constructed sequence entries, part 152.
851. gbcon153.seq - Constructed sequence entries, part 153.
852. gbcon154.seq - Constructed sequence entries, part 154.
853. gbcon155.seq - Constructed sequence entries, part 155.
854. gbcon156.seq - Constructed sequence entries, part 156.
855. gbcon157.seq - Constructed sequence entries, part 157.
856. gbcon158.seq - Constructed sequence entries, part 158.
857. gbcon159.seq - Constructed sequence entries, part 159.
858. gbcon16.seq - Constructed sequence entries, part 16.
859. gbcon160.seq - Constructed sequence entries, part 160.
860. gbcon161.seq - Constructed sequence entries, part 161.
861. gbcon162.seq - Constructed sequence entries, part 162.
862. gbcon163.seq - Constructed sequence entries, part 163.
863. gbcon164.seq - Constructed sequence entries, part 164.
864. gbcon165.seq - Constructed sequence entries, part 165.
865. gbcon166.seq - Constructed sequence entries, part 166.
866. gbcon167.seq - Constructed sequence entries, part 167.
867. gbcon168.seq - Constructed sequence entries, part 168.
868. gbcon169.seq - Constructed sequence entries, part 169.
869. gbcon17.seq - Constructed sequence entries, part 17.
870. gbcon170.seq - Constructed sequence entries, part 170.
871. gbcon171.seq - Constructed sequence entries, part 171.
872. gbcon172.seq - Constructed sequence entries, part 172.
873. gbcon173.seq - Constructed sequence entries, part 173.
874. gbcon174.seq - Constructed sequence entries, part 174.
875. gbcon175.seq - Constructed sequence entries, part 175.
876. gbcon176.seq - Constructed sequence entries, part 176.
877. gbcon177.seq - Constructed sequence entries, part 177.
878. gbcon178.seq - Constructed sequence entries, part 178.
879. gbcon179.seq - Constructed sequence entries, part 179.
880. gbcon18.seq - Constructed sequence entries, part 18.
881. gbcon180.seq - Constructed sequence entries, part 180.
882. gbcon181.seq - Constructed sequence entries, part 181.
883. gbcon182.seq - Constructed sequence entries, part 182.
884. gbcon183.seq - Constructed sequence entries, part 183.
885. gbcon184.seq - Constructed sequence entries, part 184.
886. gbcon185.seq - Constructed sequence entries, part 185.
887. gbcon186.seq - Constructed sequence entries, part 186.
888. gbcon187.seq - Constructed sequence entries, part 187.
889. gbcon188.seq - Constructed sequence entries, part 188.
890. gbcon189.seq - Constructed sequence entries, part 189.
891. gbcon19.seq - Constructed sequence entries, part 19.
892. gbcon190.seq - Constructed sequence entries, part 190.
893. gbcon191.seq - Constructed sequence entries, part 191.
894. gbcon192.seq - Constructed sequence entries, part 192.
895. gbcon193.seq - Constructed sequence entries, part 193.
896. gbcon194.seq - Constructed sequence entries, part 194.
897. gbcon195.seq - Constructed sequence entries, part 195.
898. gbcon196.seq - Constructed sequence entries, part 196.
899. gbcon197.seq - Constructed sequence entries, part 197.
900. gbcon198.seq - Constructed sequence entries, part 198.
901. gbcon199.seq - Constructed sequence entries, part 199.
902. gbcon2.seq - Constructed sequence entries, part 2.
903. gbcon20.seq - Constructed sequence entries, part 20.
904. gbcon200.seq - Constructed sequence entries, part 200.
905. gbcon201.seq - Constructed sequence entries, part 201.
906. gbcon202.seq - Constructed sequence entries, part 202.
907. gbcon203.seq - Constructed sequence entries, part 203.
908. gbcon204.seq - Constructed sequence entries, part 204.
909. gbcon205.seq - Constructed sequence entries, part 205.
910. gbcon206.seq - Constructed sequence entries, part 206.
911. gbcon207.seq - Constructed sequence entries, part 207.
912. gbcon208.seq - Constructed sequence entries, part 208.
913. gbcon209.seq - Constructed sequence entries, part 209.
914. gbcon21.seq - Constructed sequence entries, part 21.
915. gbcon210.seq - Constructed sequence entries, part 210.
916. gbcon211.seq - Constructed sequence entries, part 211.
917. gbcon212.seq - Constructed sequence entries, part 212.
918. gbcon213.seq - Constructed sequence entries, part 213.
919. gbcon214.seq - Constructed sequence entries, part 214.
920. gbcon215.seq - Constructed sequence entries, part 215.
921. gbcon216.seq - Constructed sequence entries, part 216.
922. gbcon217.seq - Constructed sequence entries, part 217.
923. gbcon218.seq - Constructed sequence entries, part 218.
924. gbcon219.seq - Constructed sequence entries, part 219.
925. gbcon22.seq - Constructed sequence entries, part 22.
926. gbcon220.seq - Constructed sequence entries, part 220.
927. gbcon221.seq - Constructed sequence entries, part 221.
928. gbcon222.seq - Constructed sequence entries, part 222.
929. gbcon223.seq - Constructed sequence entries, part 223.
930. gbcon224.seq - Constructed sequence entries, part 224.
931. gbcon225.seq - Constructed sequence entries, part 225.
932. gbcon226.seq - Constructed sequence entries, part 226.
933. gbcon227.seq - Constructed sequence entries, part 227.
934. gbcon228.seq - Constructed sequence entries, part 228.
935. gbcon229.seq - Constructed sequence entries, part 229.
936. gbcon23.seq - Constructed sequence entries, part 23.
937. gbcon230.seq - Constructed sequence entries, part 230.
938. gbcon231.seq - Constructed sequence entries, part 231.
939. gbcon232.seq - Constructed sequence entries, part 232.
940. gbcon233.seq - Constructed sequence entries, part 233.
941. gbcon234.seq - Constructed sequence entries, part 234.
942. gbcon235.seq - Constructed sequence entries, part 235.
943. gbcon236.seq - Constructed sequence entries, part 236.
944. gbcon237.seq - Constructed sequence entries, part 237.
945. gbcon238.seq - Constructed sequence entries, part 238.
946. gbcon239.seq - Constructed sequence entries, part 239.
947. gbcon24.seq - Constructed sequence entries, part 24.
948. gbcon240.seq - Constructed sequence entries, part 240.
949. gbcon241.seq - Constructed sequence entries, part 241.
950. gbcon242.seq - Constructed sequence entries, part 242.
951. gbcon243.seq - Constructed sequence entries, part 243.
952. gbcon244.seq - Constructed sequence entries, part 244.
953. gbcon245.seq - Constructed sequence entries, part 245.
954. gbcon246.seq - Constructed sequence entries, part 246.
955. gbcon247.seq - Constructed sequence entries, part 247.
956. gbcon248.seq - Constructed sequence entries, part 248.
957. gbcon249.seq - Constructed sequence entries, part 249.
958. gbcon25.seq - Constructed sequence entries, part 25.
959. gbcon250.seq - Constructed sequence entries, part 250.
960. gbcon251.seq - Constructed sequence entries, part 251.
961. gbcon252.seq - Constructed sequence entries, part 252.
962. gbcon253.seq - Constructed sequence entries, part 253.
963. gbcon254.seq - Constructed sequence entries, part 254.
964. gbcon255.seq - Constructed sequence entries, part 255.
965. gbcon256.seq - Constructed sequence entries, part 256.
966. gbcon257.seq - Constructed sequence entries, part 257.
967. gbcon258.seq - Constructed sequence entries, part 258.
968. gbcon259.seq - Constructed sequence entries, part 259.
969. gbcon26.seq - Constructed sequence entries, part 26.
970. gbcon27.seq - Constructed sequence entries, part 27.
971. gbcon28.seq - Constructed sequence entries, part 28.
972. gbcon29.seq - Constructed sequence entries, part 29.
973. gbcon3.seq - Constructed sequence entries, part 3.
974. gbcon30.seq - Constructed sequence entries, part 30.
975. gbcon31.seq - Constructed sequence entries, part 31.
976. gbcon32.seq - Constructed sequence entries, part 32.
977. gbcon33.seq - Constructed sequence entries, part 33.
978. gbcon34.seq - Constructed sequence entries, part 34.
979. gbcon35.seq - Constructed sequence entries, part 35.
980. gbcon36.seq - Constructed sequence entries, part 36.
981. gbcon37.seq - Constructed sequence entries, part 37.
982. gbcon38.seq - Constructed sequence entries, part 38.
983. gbcon39.seq - Constructed sequence entries, part 39.
984. gbcon4.seq - Constructed sequence entries, part 4.
985. gbcon40.seq - Constructed sequence entries, part 40.
986. gbcon41.seq - Constructed sequence entries, part 41.
987. gbcon42.seq - Constructed sequence entries, part 42.
988. gbcon43.seq - Constructed sequence entries, part 43.
989. gbcon44.seq - Constructed sequence entries, part 44.
990. gbcon45.seq - Constructed sequence entries, part 45.
991. gbcon46.seq - Constructed sequence entries, part 46.
992. gbcon47.seq - Constructed sequence entries, part 47.
993. gbcon48.seq - Constructed sequence entries, part 48.
994. gbcon49.seq - Constructed sequence entries, part 49.
995. gbcon5.seq - Constructed sequence entries, part 5.
996. gbcon50.seq - Constructed sequence entries, part 50.
997. gbcon51.seq - Constructed sequence entries, part 51.
998. gbcon52.seq - Constructed sequence entries, part 52.
999. gbcon53.seq - Constructed sequence entries, part 53.
1000. gbcon54.seq - Constructed sequence entries, part 54.
1001. gbcon55.seq - Constructed sequence entries, part 55.
1002. gbcon56.seq - Constructed sequence entries, part 56.
1003. gbcon57.seq - Constructed sequence entries, part 57.
1004. gbcon58.seq - Constructed sequence entries, part 58.
1005. gbcon59.seq - Constructed sequence entries, part 59.
1006. gbcon6.seq - Constructed sequence entries, part 6.
1007. gbcon60.seq - Constructed sequence entries, part 60.
1008. gbcon61.seq - Constructed sequence entries, part 61.
1009. gbcon62.seq - Constructed sequence entries, part 62.
1010. gbcon63.seq - Constructed sequence entries, part 63.
1011. gbcon64.seq - Constructed sequence entries, part 64.
1012. gbcon65.seq - Constructed sequence entries, part 65.
1013. gbcon66.seq - Constructed sequence entries, part 66.
1014. gbcon67.seq - Constructed sequence entries, part 67.
1015. gbcon68.seq - Constructed sequence entries, part 68.
1016. gbcon69.seq - Constructed sequence entries, part 69.
1017. gbcon7.seq - Constructed sequence entries, part 7.
1018. gbcon70.seq - Constructed sequence entries, part 70.
1019. gbcon71.seq - Constructed sequence entries, part 71.
1020. gbcon72.seq - Constructed sequence entries, part 72.
1021. gbcon73.seq - Constructed sequence entries, part 73.
1022. gbcon74.seq - Constructed sequence entries, part 74.
1023. gbcon75.seq - Constructed sequence entries, part 75.
1024. gbcon76.seq - Constructed sequence entries, part 76.
1025. gbcon77.seq - Constructed sequence entries, part 77.
1026. gbcon78.seq - Constructed sequence entries, part 78.
1027. gbcon79.seq - Constructed sequence entries, part 79.
1028. gbcon8.seq - Constructed sequence entries, part 8.
1029. gbcon80.seq - Constructed sequence entries, part 80.
1030. gbcon81.seq - Constructed sequence entries, part 81.
1031. gbcon82.seq - Constructed sequence entries, part 82.
1032. gbcon83.seq - Constructed sequence entries, part 83.
1033. gbcon84.seq - Constructed sequence entries, part 84.
1034. gbcon85.seq - Constructed sequence entries, part 85.
1035. gbcon86.seq - Constructed sequence entries, part 86.
1036. gbcon87.seq - Constructed sequence entries, part 87.
1037. gbcon88.seq - Constructed sequence entries, part 88.
1038. gbcon89.seq - Constructed sequence entries, part 89.
1039. gbcon9.seq - Constructed sequence entries, part 9.
1040. gbcon90.seq - Constructed sequence entries, part 90.
1041. gbcon91.seq - Constructed sequence entries, part 91.
1042. gbcon92.seq - Constructed sequence entries, part 92.
1043. gbcon93.seq - Constructed sequence entries, part 93.
1044. gbcon94.seq - Constructed sequence entries, part 94.
1045. gbcon95.seq - Constructed sequence entries, part 95.
1046. gbcon96.seq - Constructed sequence entries, part 96.
1047. gbcon97.seq - Constructed sequence entries, part 97.
1048. gbcon98.seq - Constructed sequence entries, part 98.
1049. gbcon99.seq - Constructed sequence entries, part 99.
1050. gbdel.txt - Accession numbers of entries deleted since the previous release.
1051. gbenv1.seq - Environmental sampling sequence entries, part 1.
1052. gbenv10.seq - Environmental sampling sequence entries, part 10.
1053. gbenv11.seq - Environmental sampling sequence entries, part 11.
1054. gbenv12.seq - Environmental sampling sequence entries, part 12.
1055. gbenv13.seq - Environmental sampling sequence entries, part 13.
1056. gbenv14.seq - Environmental sampling sequence entries, part 14.
1057. gbenv15.seq - Environmental sampling sequence entries, part 15.
1058. gbenv16.seq - Environmental sampling sequence entries, part 16.
1059. gbenv17.seq - Environmental sampling sequence entries, part 17.
1060. gbenv18.seq - Environmental sampling sequence entries, part 18.
1061. gbenv19.seq - Environmental sampling sequence entries, part 19.
1062. gbenv2.seq - Environmental sampling sequence entries, part 2.
1063. gbenv20.seq - Environmental sampling sequence entries, part 20.
1064. gbenv21.seq - Environmental sampling sequence entries, part 21.
1065. gbenv22.seq - Environmental sampling sequence entries, part 22.
1066. gbenv23.seq - Environmental sampling sequence entries, part 23.
1067. gbenv24.seq - Environmental sampling sequence entries, part 24.
1068. gbenv25.seq - Environmental sampling sequence entries, part 25.
1069. gbenv26.seq - Environmental sampling sequence entries, part 26.
1070. gbenv27.seq - Environmental sampling sequence entries, part 27.
1071. gbenv28.seq - Environmental sampling sequence entries, part 28.
1072. gbenv29.seq - Environmental sampling sequence entries, part 29.
1073. gbenv3.seq - Environmental sampling sequence entries, part 3.
1074. gbenv30.seq - Environmental sampling sequence entries, part 30.
1075. gbenv31.seq - Environmental sampling sequence entries, part 31.
1076. gbenv32.seq - Environmental sampling sequence entries, part 32.
1077. gbenv33.seq - Environmental sampling sequence entries, part 33.
1078. gbenv34.seq - Environmental sampling sequence entries, part 34.
1079. gbenv35.seq - Environmental sampling sequence entries, part 35.
1080. gbenv36.seq - Environmental sampling sequence entries, part 36.
1081. gbenv37.seq - Environmental sampling sequence entries, part 37.
1082. gbenv38.seq - Environmental sampling sequence entries, part 38.
1083. gbenv39.seq - Environmental sampling sequence entries, part 39.
1084. gbenv4.seq - Environmental sampling sequence entries, part 4.
1085. gbenv40.seq - Environmental sampling sequence entries, part 40.
1086. gbenv41.seq - Environmental sampling sequence entries, part 41.
1087. gbenv42.seq - Environmental sampling sequence entries, part 42.
1088. gbenv43.seq - Environmental sampling sequence entries, part 43.
1089. gbenv44.seq - Environmental sampling sequence entries, part 44.
1090. gbenv45.seq - Environmental sampling sequence entries, part 45.
1091. gbenv46.seq - Environmental sampling sequence entries, part 46.
1092. gbenv47.seq - Environmental sampling sequence entries, part 47.
1093. gbenv48.seq - Environmental sampling sequence entries, part 48.
1094. gbenv49.seq - Environmental sampling sequence entries, part 49.
1095. gbenv5.seq - Environmental sampling sequence entries, part 5.
1096. gbenv50.seq - Environmental sampling sequence entries, part 50.
1097. gbenv51.seq - Environmental sampling sequence entries, part 51.
1098. gbenv52.seq - Environmental sampling sequence entries, part 52.
1099. gbenv53.seq - Environmental sampling sequence entries, part 53.
1100. gbenv54.seq - Environmental sampling sequence entries, part 54.
1101. gbenv55.seq - Environmental sampling sequence entries, part 55.
1102. gbenv56.seq - Environmental sampling sequence entries, part 56.
1103. gbenv57.seq - Environmental sampling sequence entries, part 57.
1104. gbenv58.seq - Environmental sampling sequence entries, part 58.
1105. gbenv59.seq - Environmental sampling sequence entries, part 59.
1106. gbenv6.seq - Environmental sampling sequence entries, part 6.
1107. gbenv60.seq - Environmental sampling sequence entries, part 60.
1108. gbenv61.seq - Environmental sampling sequence entries, part 61.
1109. gbenv62.seq - Environmental sampling sequence entries, part 62.
1110. gbenv63.seq - Environmental sampling sequence entries, part 63.
1111. gbenv64.seq - Environmental sampling sequence entries, part 64.
1112. gbenv65.seq - Environmental sampling sequence entries, part 65.
1113. gbenv66.seq - Environmental sampling sequence entries, part 66.
1114. gbenv67.seq - Environmental sampling sequence entries, part 67.
1115. gbenv68.seq - Environmental sampling sequence entries, part 68.
1116. gbenv69.seq - Environmental sampling sequence entries, part 69.
1117. gbenv7.seq - Environmental sampling sequence entries, part 7.
1118. gbenv70.seq - Environmental sampling sequence entries, part 70.
1119. gbenv8.seq - Environmental sampling sequence entries, part 8.
1120. gbenv9.seq - Environmental sampling sequence entries, part 9.
1121. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
1122. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
1123. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
1124. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
1125. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
1126. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
1127. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
1128. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
1129. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
1130. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
1131. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
1132. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
1133. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
1134. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
1135. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
1136. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
1137. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
1138. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
1139. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
1140. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
1141. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
1142. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
1143. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
1144. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
1145. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
1146. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
1147. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
1148. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
1149. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
1150. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
1151. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
1152. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
1153. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
1154. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
1155. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
1156. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
1157. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
1158. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
1159. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
1160. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
1161. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
1162. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
1163. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
1164. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
1165. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
1166. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
1167. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
1168. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
1169. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
1170. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
1171. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
1172. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
1173. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
1174. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
1175. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
1176. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
1177. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
1178. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
1179. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
1180. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
1181. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
1182. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
1183. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
1184. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
1185. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
1186. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
1187. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
1188. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
1189. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
1190. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
1191. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
1192. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
1193. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
1194. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
1195. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
1196. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
1197. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
1198. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
1199. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
1200. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
1201. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
1202. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
1203. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
1204. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
1205. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
1206. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
1207. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
1208. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
1209. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
1210. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
1211. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
1212. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
1213. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
1214. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
1215. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
1216. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
1217. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
1218. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
1219. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
1220. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
1221. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
1222. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
1223. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
1224. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
1225. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
1226. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
1227. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
1228. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
1229. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
1230. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
1231. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
1232. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
1233. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
1234. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
1235. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
1236. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
1237. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
1238. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
1239. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
1240. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
1241. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
1242. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
1243. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
1244. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
1245. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
1246. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
1247. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
1248. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
1249. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
1250. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
1251. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
1252. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
1253. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
1254. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
1255. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
1256. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
1257. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
1258. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
1259. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
1260. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
1261. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
1262. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
1263. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
1264. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
1265. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
1266. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
1267. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
1268. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
1269. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
1270. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
1271. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
1272. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
1273. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
1274. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
1275. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
1276. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
1277. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
1278. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
1279. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
1280. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
1281. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
1282. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
1283. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
1284. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
1285. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
1286. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
1287. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
1288. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
1289. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
1290. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
1291. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
1292. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
1293. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
1294. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
1295. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
1296. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
1297. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
1298. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
1299. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
1300. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
1301. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
1302. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
1303. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
1304. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
1305. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
1306. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
1307. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
1308. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
1309. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
1310. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
1311. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
1312. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
1313. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
1314. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
1315. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
1316. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
1317. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
1318. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
1319. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
1320. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
1321. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
1322. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
1323. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
1324. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
1325. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
1326. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
1327. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
1328. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
1329. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
1330. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
1331. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
1332. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
1333. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
1334. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
1335. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
1336. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
1337. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
1338. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
1339. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
1340. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
1341. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
1342. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
1343. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
1344. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
1345. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
1346. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
1347. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
1348. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1349. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1350. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1351. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1352. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1353. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1354. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1355. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1356. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1357. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1358. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1359. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1360. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1361. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1362. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1363. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1364. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1365. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1366. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1367. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1368. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1369. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1370. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1371. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1372. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1373. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1374. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1375. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1376. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1377. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1378. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1379. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1380. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1381. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1382. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1383. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1384. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1385. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1386. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1387. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1388. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1389. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1390. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1391. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1392. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1393. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1394. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1395. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1396. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1397. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1398. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1399. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1400. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1401. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1402. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1403. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1404. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1405. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1406. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1407. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1408. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1409. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1410. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1411. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1412. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1413. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1414. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1415. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1416. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1417. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1418. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1419. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1420. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1421. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1422. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1423. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1424. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1425. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1426. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1427. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1428. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1429. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1430. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1431. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1432. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1433. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1434. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1435. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1436. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1437. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1438. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1439. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1440. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1441. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1442. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1443. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1444. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1445. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1446. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1447. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1448. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1449. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1450. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1451. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1452. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1453. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1454. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1455. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1456. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1457. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1458. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1459. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1460. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1461. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1462. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1463. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1464. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1465. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1466. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1467. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1468. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1469. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1470. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1471. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1472. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1473. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1474. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1475. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1476. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1477. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1478. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1479. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1480. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1481. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1482. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1483. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1484. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1485. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1486. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1487. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1488. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1489. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1490. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1491. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1492. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1493. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1494. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1495. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1496. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1497. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1498. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1499. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1500. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1501. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1502. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1503. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1504. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1505. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1506. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1507. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1508. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1509. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1510. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1511. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1512. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1513. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1514. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1515. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1516. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1517. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1518. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1519. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1520. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1521. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1522. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1523. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1524. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1525. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1526. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1527. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1528. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1529. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1530. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1531. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1532. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1533. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1534. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1535. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1536. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1537. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1538. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1539. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1540. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1541. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1542. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1543. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1544. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1545. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1546. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1547. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1548. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
1549. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
1550. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
1551. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
1552. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
1553. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
1554. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1555. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
1556. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
1557. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
1558. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
1559. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
1560. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
1561. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
1562. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
1563. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
1564. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
1565. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1566. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1567. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
1568. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
1569. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
1570. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
1571. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
1572. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
1573. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
1574. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
1575. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
1576. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
1577. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1578. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
1579. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
1580. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
1581. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
1582. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
1583. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
1584. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
1585. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
1586. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
1587. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
1588. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1589. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
1590. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
1591. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
1592. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
1593. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
1594. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
1595. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
1596. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
1597. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
1598. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
1599. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1600. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
1601. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
1602. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
1603. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
1604. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
1605. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
1606. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
1607. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
1608. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
1609. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
1610. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1611. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
1612. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
1613. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
1614. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
1615. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
1616. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
1617. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
1618. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
1619. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
1620. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
1621. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1622. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
1623. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
1624. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
1625. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
1626. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
1627. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
1628. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
1629. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
1630. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
1631. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
1632. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1633. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
1634. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
1635. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
1636. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
1637. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
1638. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
1639. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
1640. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
1641. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
1642. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
1643. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1644. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
1645. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
1646. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
1647. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
1648. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
1649. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
1650. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
1651. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
1652. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1653. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1654. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1655. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1656. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1657. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1658. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1659. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1660. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1661. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1662. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1663. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1664. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1665. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1666. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1667. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1668. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1669. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1670. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1671. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1672. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1673. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1674. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1675. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1676. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1677. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1678. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1679. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1680. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1681. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1682. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1683. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1684. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1685. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1686. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1687. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1688. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1689. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1690. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1691. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1692. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1693. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1694. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1695. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1696. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1697. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1698. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1699. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1700. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1701. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1702. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1703. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1704. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1705. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1706. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1707. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1708. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1709. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1710. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1711. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1712. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1713. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1714. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1715. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1716. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1717. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1718. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1719. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1720. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1721. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1722. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1723. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1724. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1725. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1726. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1727. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1728. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1729. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1730. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1731. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1732. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1733. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1734. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1735. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1736. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1737. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1738. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1739. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1740. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1741. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1742. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1743. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1744. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1745. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1746. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1747. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1748. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1749. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1750. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1751. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1752. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1753. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1754. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1755. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1756. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1757. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1758. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1759. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1760. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1761. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1762. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1763. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1764. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1765. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1766. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1767. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1768. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1769. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1770. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1771. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1772. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1773. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1774. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1775. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1776. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1777. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1778. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1779. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1780. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1781. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1782. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1783. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1784. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1785. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1786. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1787. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1788. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1789. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1790. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1791. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1792. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1793. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1794. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1795. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1796. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1797. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1798. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1799. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1800. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1801. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1802. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1803. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1804. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1805. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1806. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1807. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1808. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1809. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1810. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1811. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1812. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1813. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1814. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1815. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1816. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1817. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1818. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1819. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1820. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1821. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1822. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1823. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1824. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1825. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1826. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1827. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1828. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1829. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1830. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1831. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1832. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1833. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1834. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1835. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1836. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1837. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1838. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1839. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1840. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1841. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1842. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1843. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1844. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1845. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1846. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1847. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1848. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1849. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1850. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1851. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1852. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1853. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1854. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1855. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1856. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1857. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1858. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1859. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1860. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1861. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1862. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1863. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1864. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1865. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1866. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1867. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1868. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1869. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1870. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1871. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1872. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1873. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1874. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1875. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1876. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1877. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1878. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1879. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1880. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1881. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1882. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1883. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1884. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1885. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1886. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1887. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1888. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1889. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1890. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1891. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1892. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1893. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1894. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1895. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1896. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1897. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1898. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1899. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1900. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1901. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1902. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1903. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1904. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1905. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1906. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1907. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1908. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1909. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1910. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1911. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1912. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1913. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1914. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1915. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1916. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1917. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1918. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1919. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1920. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1921. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1922. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1923. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1924. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1925. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1926. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1927. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1928. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1929. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1930. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1931. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1932. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1933. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1934. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1935. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1936. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1937. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1938. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1939. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1940. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1941. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1942. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1943. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1944. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1945. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1946. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1947. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1948. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1949. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1950. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1951. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1952. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1953. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1954. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1955. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1956. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1957. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1958. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1959. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1960. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1961. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1962. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1963. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1964. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1965. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1966. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1967. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1968. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1969. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1970. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1971. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1972. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1973. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1974. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1975. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1976. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1977. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1978. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1979. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1980. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1981. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1982. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1983. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1984. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1985. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1986. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1987. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1988. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1989. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1990. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1991. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1992. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1993. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1994. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1995. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1996. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1997. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1998. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1999. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
2000. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
2001. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
2002. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
2003. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
2004. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
2005. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
2006. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
2007. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
2008. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
2009. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
2010. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
2011. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
2012. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
2013. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
2014. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
2015. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
2016. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
2017. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
2018. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
2019. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
2020. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
2021. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
2022. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
2023. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
2024. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
2025. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
2026. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
2027. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
2028. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
2029. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
2030. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
2031. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
2032. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
2033. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
2034. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
2035. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
2036. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
2037. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
2038. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
2039. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
2040. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
2041. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
2042. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
2043. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
2044. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
2045. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
2046. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
2047. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
2048. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
2049. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
2050. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
2051. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
2052. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
2053. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
2054. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
2055. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
2056. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
2057. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
2058. gbinv1.seq - Invertebrate sequence entries, part 1.
2059. gbinv10.seq - Invertebrate sequence entries, part 10.
2060. gbinv100.seq - Invertebrate sequence entries, part 100.
2061. gbinv101.seq - Invertebrate sequence entries, part 101.
2062. gbinv102.seq - Invertebrate sequence entries, part 102.
2063. gbinv103.seq - Invertebrate sequence entries, part 103.
2064. gbinv104.seq - Invertebrate sequence entries, part 104.
2065. gbinv105.seq - Invertebrate sequence entries, part 105.
2066. gbinv106.seq - Invertebrate sequence entries, part 106.
2067. gbinv107.seq - Invertebrate sequence entries, part 107.
2068. gbinv108.seq - Invertebrate sequence entries, part 108.
2069. gbinv109.seq - Invertebrate sequence entries, part 109.
2070. gbinv11.seq - Invertebrate sequence entries, part 11.
2071. gbinv110.seq - Invertebrate sequence entries, part 110.
2072. gbinv111.seq - Invertebrate sequence entries, part 111.
2073. gbinv112.seq - Invertebrate sequence entries, part 112.
2074. gbinv113.seq - Invertebrate sequence entries, part 113.
2075. gbinv114.seq - Invertebrate sequence entries, part 114.
2076. gbinv115.seq - Invertebrate sequence entries, part 115.
2077. gbinv116.seq - Invertebrate sequence entries, part 116.
2078. gbinv117.seq - Invertebrate sequence entries, part 117.
2079. gbinv118.seq - Invertebrate sequence entries, part 118.
2080. gbinv119.seq - Invertebrate sequence entries, part 119.
2081. gbinv12.seq - Invertebrate sequence entries, part 12.
2082. gbinv120.seq - Invertebrate sequence entries, part 120.
2083. gbinv121.seq - Invertebrate sequence entries, part 121.
2084. gbinv122.seq - Invertebrate sequence entries, part 122.
2085. gbinv123.seq - Invertebrate sequence entries, part 123.
2086. gbinv124.seq - Invertebrate sequence entries, part 124.
2087. gbinv125.seq - Invertebrate sequence entries, part 125.
2088. gbinv126.seq - Invertebrate sequence entries, part 126.
2089. gbinv127.seq - Invertebrate sequence entries, part 127.
2090. gbinv128.seq - Invertebrate sequence entries, part 128.
2091. gbinv129.seq - Invertebrate sequence entries, part 129.
2092. gbinv13.seq - Invertebrate sequence entries, part 13.
2093. gbinv130.seq - Invertebrate sequence entries, part 130.
2094. gbinv131.seq - Invertebrate sequence entries, part 131.
2095. gbinv132.seq - Invertebrate sequence entries, part 132.
2096. gbinv133.seq - Invertebrate sequence entries, part 133.
2097. gbinv134.seq - Invertebrate sequence entries, part 134.
2098. gbinv135.seq - Invertebrate sequence entries, part 135.
2099. gbinv136.seq - Invertebrate sequence entries, part 136.
2100. gbinv137.seq - Invertebrate sequence entries, part 137.
2101. gbinv138.seq - Invertebrate sequence entries, part 138.
2102. gbinv139.seq - Invertebrate sequence entries, part 139.
2103. gbinv14.seq - Invertebrate sequence entries, part 14.
2104. gbinv140.seq - Invertebrate sequence entries, part 140.
2105. gbinv141.seq - Invertebrate sequence entries, part 141.
2106. gbinv142.seq - Invertebrate sequence entries, part 142.
2107. gbinv143.seq - Invertebrate sequence entries, part 143.
2108. gbinv144.seq - Invertebrate sequence entries, part 144.
2109. gbinv145.seq - Invertebrate sequence entries, part 145.
2110. gbinv146.seq - Invertebrate sequence entries, part 146.
2111. gbinv147.seq - Invertebrate sequence entries, part 147.
2112. gbinv148.seq - Invertebrate sequence entries, part 148.
2113. gbinv149.seq - Invertebrate sequence entries, part 149.
2114. gbinv15.seq - Invertebrate sequence entries, part 15.
2115. gbinv150.seq - Invertebrate sequence entries, part 150.
2116. gbinv151.seq - Invertebrate sequence entries, part 151.
2117. gbinv152.seq - Invertebrate sequence entries, part 152.
2118. gbinv153.seq - Invertebrate sequence entries, part 153.
2119. gbinv154.seq - Invertebrate sequence entries, part 154.
2120. gbinv155.seq - Invertebrate sequence entries, part 155.
2121. gbinv156.seq - Invertebrate sequence entries, part 156.
2122. gbinv157.seq - Invertebrate sequence entries, part 157.
2123. gbinv158.seq - Invertebrate sequence entries, part 158.
2124. gbinv159.seq - Invertebrate sequence entries, part 159.
2125. gbinv16.seq - Invertebrate sequence entries, part 16.
2126. gbinv160.seq - Invertebrate sequence entries, part 160.
2127. gbinv161.seq - Invertebrate sequence entries, part 161.
2128. gbinv162.seq - Invertebrate sequence entries, part 162.
2129. gbinv163.seq - Invertebrate sequence entries, part 163.
2130. gbinv164.seq - Invertebrate sequence entries, part 164.
2131. gbinv165.seq - Invertebrate sequence entries, part 165.
2132. gbinv166.seq - Invertebrate sequence entries, part 166.
2133. gbinv167.seq - Invertebrate sequence entries, part 167.
2134. gbinv168.seq - Invertebrate sequence entries, part 168.
2135. gbinv169.seq - Invertebrate sequence entries, part 169.
2136. gbinv17.seq - Invertebrate sequence entries, part 17.
2137. gbinv170.seq - Invertebrate sequence entries, part 170.
2138. gbinv171.seq - Invertebrate sequence entries, part 171.
2139. gbinv172.seq - Invertebrate sequence entries, part 172.
2140. gbinv173.seq - Invertebrate sequence entries, part 173.
2141. gbinv174.seq - Invertebrate sequence entries, part 174.
2142. gbinv175.seq - Invertebrate sequence entries, part 175.
2143. gbinv176.seq - Invertebrate sequence entries, part 176.
2144. gbinv177.seq - Invertebrate sequence entries, part 177.
2145. gbinv178.seq - Invertebrate sequence entries, part 178.
2146. gbinv179.seq - Invertebrate sequence entries, part 179.
2147. gbinv18.seq - Invertebrate sequence entries, part 18.
2148. gbinv180.seq - Invertebrate sequence entries, part 180.
2149. gbinv181.seq - Invertebrate sequence entries, part 181.
2150. gbinv182.seq - Invertebrate sequence entries, part 182.
2151. gbinv183.seq - Invertebrate sequence entries, part 183.
2152. gbinv184.seq - Invertebrate sequence entries, part 184.
2153. gbinv185.seq - Invertebrate sequence entries, part 185.
2154. gbinv186.seq - Invertebrate sequence entries, part 186.
2155. gbinv187.seq - Invertebrate sequence entries, part 187.
2156. gbinv188.seq - Invertebrate sequence entries, part 188.
2157. gbinv189.seq - Invertebrate sequence entries, part 189.
2158. gbinv19.seq - Invertebrate sequence entries, part 19.
2159. gbinv190.seq - Invertebrate sequence entries, part 190.
2160. gbinv191.seq - Invertebrate sequence entries, part 191.
2161. gbinv192.seq - Invertebrate sequence entries, part 192.
2162. gbinv193.seq - Invertebrate sequence entries, part 193.
2163. gbinv194.seq - Invertebrate sequence entries, part 194.
2164. gbinv195.seq - Invertebrate sequence entries, part 195.
2165. gbinv196.seq - Invertebrate sequence entries, part 196.
2166. gbinv197.seq - Invertebrate sequence entries, part 197.
2167. gbinv198.seq - Invertebrate sequence entries, part 198.
2168. gbinv199.seq - Invertebrate sequence entries, part 199.
2169. gbinv2.seq - Invertebrate sequence entries, part 2.
2170. gbinv20.seq - Invertebrate sequence entries, part 20.
2171. gbinv200.seq - Invertebrate sequence entries, part 200.
2172. gbinv201.seq - Invertebrate sequence entries, part 201.
2173. gbinv202.seq - Invertebrate sequence entries, part 202.
2174. gbinv203.seq - Invertebrate sequence entries, part 203.
2175. gbinv204.seq - Invertebrate sequence entries, part 204.
2176. gbinv205.seq - Invertebrate sequence entries, part 205.
2177. gbinv206.seq - Invertebrate sequence entries, part 206.
2178. gbinv207.seq - Invertebrate sequence entries, part 207.
2179. gbinv208.seq - Invertebrate sequence entries, part 208.
2180. gbinv209.seq - Invertebrate sequence entries, part 209.
2181. gbinv21.seq - Invertebrate sequence entries, part 21.
2182. gbinv210.seq - Invertebrate sequence entries, part 210.
2183. gbinv211.seq - Invertebrate sequence entries, part 211.
2184. gbinv212.seq - Invertebrate sequence entries, part 212.
2185. gbinv213.seq - Invertebrate sequence entries, part 213.
2186. gbinv214.seq - Invertebrate sequence entries, part 214.
2187. gbinv215.seq - Invertebrate sequence entries, part 215.
2188. gbinv216.seq - Invertebrate sequence entries, part 216.
2189. gbinv217.seq - Invertebrate sequence entries, part 217.
2190. gbinv218.seq - Invertebrate sequence entries, part 218.
2191. gbinv219.seq - Invertebrate sequence entries, part 219.
2192. gbinv22.seq - Invertebrate sequence entries, part 22.
2193. gbinv220.seq - Invertebrate sequence entries, part 220.
2194. gbinv221.seq - Invertebrate sequence entries, part 221.
2195. gbinv222.seq - Invertebrate sequence entries, part 222.
2196. gbinv223.seq - Invertebrate sequence entries, part 223.
2197. gbinv224.seq - Invertebrate sequence entries, part 224.
2198. gbinv225.seq - Invertebrate sequence entries, part 225.
2199. gbinv226.seq - Invertebrate sequence entries, part 226.
2200. gbinv227.seq - Invertebrate sequence entries, part 227.
2201. gbinv228.seq - Invertebrate sequence entries, part 228.
2202. gbinv229.seq - Invertebrate sequence entries, part 229.
2203. gbinv23.seq - Invertebrate sequence entries, part 23.
2204. gbinv230.seq - Invertebrate sequence entries, part 230.
2205. gbinv231.seq - Invertebrate sequence entries, part 231.
2206. gbinv232.seq - Invertebrate sequence entries, part 232.
2207. gbinv233.seq - Invertebrate sequence entries, part 233.
2208. gbinv234.seq - Invertebrate sequence entries, part 234.
2209. gbinv235.seq - Invertebrate sequence entries, part 235.
2210. gbinv236.seq - Invertebrate sequence entries, part 236.
2211. gbinv237.seq - Invertebrate sequence entries, part 237.
2212. gbinv238.seq - Invertebrate sequence entries, part 238.
2213. gbinv239.seq - Invertebrate sequence entries, part 239.
2214. gbinv24.seq - Invertebrate sequence entries, part 24.
2215. gbinv240.seq - Invertebrate sequence entries, part 240.
2216. gbinv241.seq - Invertebrate sequence entries, part 241.
2217. gbinv242.seq - Invertebrate sequence entries, part 242.
2218. gbinv243.seq - Invertebrate sequence entries, part 243.
2219. gbinv244.seq - Invertebrate sequence entries, part 244.
2220. gbinv245.seq - Invertebrate sequence entries, part 245.
2221. gbinv246.seq - Invertebrate sequence entries, part 246.
2222. gbinv247.seq - Invertebrate sequence entries, part 247.
2223. gbinv248.seq - Invertebrate sequence entries, part 248.
2224. gbinv249.seq - Invertebrate sequence entries, part 249.
2225. gbinv25.seq - Invertebrate sequence entries, part 25.
2226. gbinv250.seq - Invertebrate sequence entries, part 250.
2227. gbinv251.seq - Invertebrate sequence entries, part 251.
2228. gbinv252.seq - Invertebrate sequence entries, part 252.
2229. gbinv253.seq - Invertebrate sequence entries, part 253.
2230. gbinv254.seq - Invertebrate sequence entries, part 254.
2231. gbinv255.seq - Invertebrate sequence entries, part 255.
2232. gbinv256.seq - Invertebrate sequence entries, part 256.
2233. gbinv257.seq - Invertebrate sequence entries, part 257.
2234. gbinv258.seq - Invertebrate sequence entries, part 258.
2235. gbinv259.seq - Invertebrate sequence entries, part 259.
2236. gbinv26.seq - Invertebrate sequence entries, part 26.
2237. gbinv260.seq - Invertebrate sequence entries, part 260.
2238. gbinv261.seq - Invertebrate sequence entries, part 261.
2239. gbinv262.seq - Invertebrate sequence entries, part 262.
2240. gbinv263.seq - Invertebrate sequence entries, part 263.
2241. gbinv264.seq - Invertebrate sequence entries, part 264.
2242. gbinv265.seq - Invertebrate sequence entries, part 265.
2243. gbinv266.seq - Invertebrate sequence entries, part 266.
2244. gbinv267.seq - Invertebrate sequence entries, part 267.
2245. gbinv268.seq - Invertebrate sequence entries, part 268.
2246. gbinv269.seq - Invertebrate sequence entries, part 269.
2247. gbinv27.seq - Invertebrate sequence entries, part 27.
2248. gbinv270.seq - Invertebrate sequence entries, part 270.
2249. gbinv271.seq - Invertebrate sequence entries, part 271.
2250. gbinv272.seq - Invertebrate sequence entries, part 272.
2251. gbinv273.seq - Invertebrate sequence entries, part 273.
2252. gbinv274.seq - Invertebrate sequence entries, part 274.
2253. gbinv275.seq - Invertebrate sequence entries, part 275.
2254. gbinv276.seq - Invertebrate sequence entries, part 276.
2255. gbinv277.seq - Invertebrate sequence entries, part 277.
2256. gbinv278.seq - Invertebrate sequence entries, part 278.
2257. gbinv279.seq - Invertebrate sequence entries, part 279.
2258. gbinv28.seq - Invertebrate sequence entries, part 28.
2259. gbinv280.seq - Invertebrate sequence entries, part 280.
2260. gbinv281.seq - Invertebrate sequence entries, part 281.
2261. gbinv282.seq - Invertebrate sequence entries, part 282.
2262. gbinv283.seq - Invertebrate sequence entries, part 283.
2263. gbinv284.seq - Invertebrate sequence entries, part 284.
2264. gbinv285.seq - Invertebrate sequence entries, part 285.
2265. gbinv286.seq - Invertebrate sequence entries, part 286.
2266. gbinv287.seq - Invertebrate sequence entries, part 287.
2267. gbinv288.seq - Invertebrate sequence entries, part 288.
2268. gbinv289.seq - Invertebrate sequence entries, part 289.
2269. gbinv29.seq - Invertebrate sequence entries, part 29.
2270. gbinv290.seq - Invertebrate sequence entries, part 290.
2271. gbinv291.seq - Invertebrate sequence entries, part 291.
2272. gbinv292.seq - Invertebrate sequence entries, part 292.
2273. gbinv293.seq - Invertebrate sequence entries, part 293.
2274. gbinv294.seq - Invertebrate sequence entries, part 294.
2275. gbinv295.seq - Invertebrate sequence entries, part 295.
2276. gbinv296.seq - Invertebrate sequence entries, part 296.
2277. gbinv297.seq - Invertebrate sequence entries, part 297.
2278. gbinv298.seq - Invertebrate sequence entries, part 298.
2279. gbinv299.seq - Invertebrate sequence entries, part 299.
2280. gbinv3.seq - Invertebrate sequence entries, part 3.
2281. gbinv30.seq - Invertebrate sequence entries, part 30.
2282. gbinv300.seq - Invertebrate sequence entries, part 300.
2283. gbinv301.seq - Invertebrate sequence entries, part 301.
2284. gbinv302.seq - Invertebrate sequence entries, part 302.
2285. gbinv303.seq - Invertebrate sequence entries, part 303.
2286. gbinv304.seq - Invertebrate sequence entries, part 304.
2287. gbinv305.seq - Invertebrate sequence entries, part 305.
2288. gbinv306.seq - Invertebrate sequence entries, part 306.
2289. gbinv307.seq - Invertebrate sequence entries, part 307.
2290. gbinv308.seq - Invertebrate sequence entries, part 308.
2291. gbinv309.seq - Invertebrate sequence entries, part 309.
2292. gbinv31.seq - Invertebrate sequence entries, part 31.
2293. gbinv310.seq - Invertebrate sequence entries, part 310.
2294. gbinv311.seq - Invertebrate sequence entries, part 311.
2295. gbinv312.seq - Invertebrate sequence entries, part 312.
2296. gbinv313.seq - Invertebrate sequence entries, part 313.
2297. gbinv314.seq - Invertebrate sequence entries, part 314.
2298. gbinv315.seq - Invertebrate sequence entries, part 315.
2299. gbinv316.seq - Invertebrate sequence entries, part 316.
2300. gbinv317.seq - Invertebrate sequence entries, part 317.
2301. gbinv318.seq - Invertebrate sequence entries, part 318.
2302. gbinv319.seq - Invertebrate sequence entries, part 319.
2303. gbinv32.seq - Invertebrate sequence entries, part 32.
2304. gbinv320.seq - Invertebrate sequence entries, part 320.
2305. gbinv321.seq - Invertebrate sequence entries, part 321.
2306. gbinv322.seq - Invertebrate sequence entries, part 322.
2307. gbinv323.seq - Invertebrate sequence entries, part 323.
2308. gbinv324.seq - Invertebrate sequence entries, part 324.
2309. gbinv325.seq - Invertebrate sequence entries, part 325.
2310. gbinv326.seq - Invertebrate sequence entries, part 326.
2311. gbinv327.seq - Invertebrate sequence entries, part 327.
2312. gbinv328.seq - Invertebrate sequence entries, part 328.
2313. gbinv329.seq - Invertebrate sequence entries, part 329.
2314. gbinv33.seq - Invertebrate sequence entries, part 33.
2315. gbinv330.seq - Invertebrate sequence entries, part 330.
2316. gbinv331.seq - Invertebrate sequence entries, part 331.
2317. gbinv332.seq - Invertebrate sequence entries, part 332.
2318. gbinv333.seq - Invertebrate sequence entries, part 333.
2319. gbinv334.seq - Invertebrate sequence entries, part 334.
2320. gbinv335.seq - Invertebrate sequence entries, part 335.
2321. gbinv336.seq - Invertebrate sequence entries, part 336.
2322. gbinv337.seq - Invertebrate sequence entries, part 337.
2323. gbinv338.seq - Invertebrate sequence entries, part 338.
2324. gbinv339.seq - Invertebrate sequence entries, part 339.
2325. gbinv34.seq - Invertebrate sequence entries, part 34.
2326. gbinv340.seq - Invertebrate sequence entries, part 340.
2327. gbinv341.seq - Invertebrate sequence entries, part 341.
2328. gbinv342.seq - Invertebrate sequence entries, part 342.
2329. gbinv343.seq - Invertebrate sequence entries, part 343.
2330. gbinv344.seq - Invertebrate sequence entries, part 344.
2331. gbinv345.seq - Invertebrate sequence entries, part 345.
2332. gbinv346.seq - Invertebrate sequence entries, part 346.
2333. gbinv347.seq - Invertebrate sequence entries, part 347.
2334. gbinv348.seq - Invertebrate sequence entries, part 348.
2335. gbinv349.seq - Invertebrate sequence entries, part 349.
2336. gbinv35.seq - Invertebrate sequence entries, part 35.
2337. gbinv350.seq - Invertebrate sequence entries, part 350.
2338. gbinv351.seq - Invertebrate sequence entries, part 351.
2339. gbinv352.seq - Invertebrate sequence entries, part 352.
2340. gbinv353.seq - Invertebrate sequence entries, part 353.
2341. gbinv354.seq - Invertebrate sequence entries, part 354.
2342. gbinv355.seq - Invertebrate sequence entries, part 355.
2343. gbinv356.seq - Invertebrate sequence entries, part 356.
2344. gbinv357.seq - Invertebrate sequence entries, part 357.
2345. gbinv358.seq - Invertebrate sequence entries, part 358.
2346. gbinv359.seq - Invertebrate sequence entries, part 359.
2347. gbinv36.seq - Invertebrate sequence entries, part 36.
2348. gbinv360.seq - Invertebrate sequence entries, part 360.
2349. gbinv361.seq - Invertebrate sequence entries, part 361.
2350. gbinv362.seq - Invertebrate sequence entries, part 362.
2351. gbinv363.seq - Invertebrate sequence entries, part 363.
2352. gbinv364.seq - Invertebrate sequence entries, part 364.
2353. gbinv365.seq - Invertebrate sequence entries, part 365.
2354. gbinv366.seq - Invertebrate sequence entries, part 366.
2355. gbinv367.seq - Invertebrate sequence entries, part 367.
2356. gbinv368.seq - Invertebrate sequence entries, part 368.
2357. gbinv369.seq - Invertebrate sequence entries, part 369.
2358. gbinv37.seq - Invertebrate sequence entries, part 37.
2359. gbinv370.seq - Invertebrate sequence entries, part 370.
2360. gbinv371.seq - Invertebrate sequence entries, part 371.
2361. gbinv372.seq - Invertebrate sequence entries, part 372.
2362. gbinv373.seq - Invertebrate sequence entries, part 373.
2363. gbinv374.seq - Invertebrate sequence entries, part 374.
2364. gbinv375.seq - Invertebrate sequence entries, part 375.
2365. gbinv376.seq - Invertebrate sequence entries, part 376.
2366. gbinv377.seq - Invertebrate sequence entries, part 377.
2367. gbinv378.seq - Invertebrate sequence entries, part 378.
2368. gbinv379.seq - Invertebrate sequence entries, part 379.
2369. gbinv38.seq - Invertebrate sequence entries, part 38.
2370. gbinv380.seq - Invertebrate sequence entries, part 380.
2371. gbinv381.seq - Invertebrate sequence entries, part 381.
2372. gbinv382.seq - Invertebrate sequence entries, part 382.
2373. gbinv383.seq - Invertebrate sequence entries, part 383.
2374. gbinv384.seq - Invertebrate sequence entries, part 384.
2375. gbinv385.seq - Invertebrate sequence entries, part 385.
2376. gbinv386.seq - Invertebrate sequence entries, part 386.
2377. gbinv387.seq - Invertebrate sequence entries, part 387.
2378. gbinv388.seq - Invertebrate sequence entries, part 388.
2379. gbinv389.seq - Invertebrate sequence entries, part 389.
2380. gbinv39.seq - Invertebrate sequence entries, part 39.
2381. gbinv390.seq - Invertebrate sequence entries, part 390.
2382. gbinv391.seq - Invertebrate sequence entries, part 391.
2383. gbinv392.seq - Invertebrate sequence entries, part 392.
2384. gbinv393.seq - Invertebrate sequence entries, part 393.
2385. gbinv394.seq - Invertebrate sequence entries, part 394.
2386. gbinv395.seq - Invertebrate sequence entries, part 395.
2387. gbinv396.seq - Invertebrate sequence entries, part 396.
2388. gbinv397.seq - Invertebrate sequence entries, part 397.
2389. gbinv398.seq - Invertebrate sequence entries, part 398.
2390. gbinv399.seq - Invertebrate sequence entries, part 399.
2391. gbinv4.seq - Invertebrate sequence entries, part 4.
2392. gbinv40.seq - Invertebrate sequence entries, part 40.
2393. gbinv400.seq - Invertebrate sequence entries, part 400.
2394. gbinv401.seq - Invertebrate sequence entries, part 401.
2395. gbinv402.seq - Invertebrate sequence entries, part 402.
2396. gbinv403.seq - Invertebrate sequence entries, part 403.
2397. gbinv404.seq - Invertebrate sequence entries, part 404.
2398. gbinv405.seq - Invertebrate sequence entries, part 405.
2399. gbinv406.seq - Invertebrate sequence entries, part 406.
2400. gbinv407.seq - Invertebrate sequence entries, part 407.
2401. gbinv408.seq - Invertebrate sequence entries, part 408.
2402. gbinv409.seq - Invertebrate sequence entries, part 409.
2403. gbinv41.seq - Invertebrate sequence entries, part 41.
2404. gbinv410.seq - Invertebrate sequence entries, part 410.
2405. gbinv411.seq - Invertebrate sequence entries, part 411.
2406. gbinv412.seq - Invertebrate sequence entries, part 412.
2407. gbinv413.seq - Invertebrate sequence entries, part 413.
2408. gbinv414.seq - Invertebrate sequence entries, part 414.
2409. gbinv415.seq - Invertebrate sequence entries, part 415.
2410. gbinv416.seq - Invertebrate sequence entries, part 416.
2411. gbinv417.seq - Invertebrate sequence entries, part 417.
2412. gbinv418.seq - Invertebrate sequence entries, part 418.
2413. gbinv419.seq - Invertebrate sequence entries, part 419.
2414. gbinv42.seq - Invertebrate sequence entries, part 42.
2415. gbinv420.seq - Invertebrate sequence entries, part 420.
2416. gbinv421.seq - Invertebrate sequence entries, part 421.
2417. gbinv422.seq - Invertebrate sequence entries, part 422.
2418. gbinv423.seq - Invertebrate sequence entries, part 423.
2419. gbinv424.seq - Invertebrate sequence entries, part 424.
2420. gbinv425.seq - Invertebrate sequence entries, part 425.
2421. gbinv426.seq - Invertebrate sequence entries, part 426.
2422. gbinv427.seq - Invertebrate sequence entries, part 427.
2423. gbinv428.seq - Invertebrate sequence entries, part 428.
2424. gbinv429.seq - Invertebrate sequence entries, part 429.
2425. gbinv43.seq - Invertebrate sequence entries, part 43.
2426. gbinv430.seq - Invertebrate sequence entries, part 430.
2427. gbinv431.seq - Invertebrate sequence entries, part 431.
2428. gbinv432.seq - Invertebrate sequence entries, part 432.
2429. gbinv433.seq - Invertebrate sequence entries, part 433.
2430. gbinv434.seq - Invertebrate sequence entries, part 434.
2431. gbinv435.seq - Invertebrate sequence entries, part 435.
2432. gbinv436.seq - Invertebrate sequence entries, part 436.
2433. gbinv437.seq - Invertebrate sequence entries, part 437.
2434. gbinv438.seq - Invertebrate sequence entries, part 438.
2435. gbinv439.seq - Invertebrate sequence entries, part 439.
2436. gbinv44.seq - Invertebrate sequence entries, part 44.
2437. gbinv440.seq - Invertebrate sequence entries, part 440.
2438. gbinv441.seq - Invertebrate sequence entries, part 441.
2439. gbinv442.seq - Invertebrate sequence entries, part 442.
2440. gbinv443.seq - Invertebrate sequence entries, part 443.
2441. gbinv444.seq - Invertebrate sequence entries, part 444.
2442. gbinv445.seq - Invertebrate sequence entries, part 445.
2443. gbinv446.seq - Invertebrate sequence entries, part 446.
2444. gbinv447.seq - Invertebrate sequence entries, part 447.
2445. gbinv448.seq - Invertebrate sequence entries, part 448.
2446. gbinv449.seq - Invertebrate sequence entries, part 449.
2447. gbinv45.seq - Invertebrate sequence entries, part 45.
2448. gbinv450.seq - Invertebrate sequence entries, part 450.
2449. gbinv451.seq - Invertebrate sequence entries, part 451.
2450. gbinv452.seq - Invertebrate sequence entries, part 452.
2451. gbinv453.seq - Invertebrate sequence entries, part 453.
2452. gbinv454.seq - Invertebrate sequence entries, part 454.
2453. gbinv455.seq - Invertebrate sequence entries, part 455.
2454. gbinv456.seq - Invertebrate sequence entries, part 456.
2455. gbinv457.seq - Invertebrate sequence entries, part 457.
2456. gbinv458.seq - Invertebrate sequence entries, part 458.
2457. gbinv459.seq - Invertebrate sequence entries, part 459.
2458. gbinv46.seq - Invertebrate sequence entries, part 46.
2459. gbinv460.seq - Invertebrate sequence entries, part 460.
2460. gbinv461.seq - Invertebrate sequence entries, part 461.
2461. gbinv462.seq - Invertebrate sequence entries, part 462.
2462. gbinv463.seq - Invertebrate sequence entries, part 463.
2463. gbinv464.seq - Invertebrate sequence entries, part 464.
2464. gbinv465.seq - Invertebrate sequence entries, part 465.
2465. gbinv466.seq - Invertebrate sequence entries, part 466.
2466. gbinv467.seq - Invertebrate sequence entries, part 467.
2467. gbinv468.seq - Invertebrate sequence entries, part 468.
2468. gbinv469.seq - Invertebrate sequence entries, part 469.
2469. gbinv47.seq - Invertebrate sequence entries, part 47.
2470. gbinv470.seq - Invertebrate sequence entries, part 470.
2471. gbinv471.seq - Invertebrate sequence entries, part 471.
2472. gbinv472.seq - Invertebrate sequence entries, part 472.
2473. gbinv473.seq - Invertebrate sequence entries, part 473.
2474. gbinv474.seq - Invertebrate sequence entries, part 474.
2475. gbinv475.seq - Invertebrate sequence entries, part 475.
2476. gbinv476.seq - Invertebrate sequence entries, part 476.
2477. gbinv477.seq - Invertebrate sequence entries, part 477.
2478. gbinv478.seq - Invertebrate sequence entries, part 478.
2479. gbinv479.seq - Invertebrate sequence entries, part 479.
2480. gbinv48.seq - Invertebrate sequence entries, part 48.
2481. gbinv480.seq - Invertebrate sequence entries, part 480.
2482. gbinv481.seq - Invertebrate sequence entries, part 481.
2483. gbinv482.seq - Invertebrate sequence entries, part 482.
2484. gbinv483.seq - Invertebrate sequence entries, part 483.
2485. gbinv484.seq - Invertebrate sequence entries, part 484.
2486. gbinv485.seq - Invertebrate sequence entries, part 485.
2487. gbinv486.seq - Invertebrate sequence entries, part 486.
2488. gbinv487.seq - Invertebrate sequence entries, part 487.
2489. gbinv488.seq - Invertebrate sequence entries, part 488.
2490. gbinv489.seq - Invertebrate sequence entries, part 489.
2491. gbinv49.seq - Invertebrate sequence entries, part 49.
2492. gbinv490.seq - Invertebrate sequence entries, part 490.
2493. gbinv491.seq - Invertebrate sequence entries, part 491.
2494. gbinv492.seq - Invertebrate sequence entries, part 492.
2495. gbinv493.seq - Invertebrate sequence entries, part 493.
2496. gbinv494.seq - Invertebrate sequence entries, part 494.
2497. gbinv495.seq - Invertebrate sequence entries, part 495.
2498. gbinv496.seq - Invertebrate sequence entries, part 496.
2499. gbinv497.seq - Invertebrate sequence entries, part 497.
2500. gbinv498.seq - Invertebrate sequence entries, part 498.
2501. gbinv499.seq - Invertebrate sequence entries, part 499.
2502. gbinv5.seq - Invertebrate sequence entries, part 5.
2503. gbinv50.seq - Invertebrate sequence entries, part 50.
2504. gbinv500.seq - Invertebrate sequence entries, part 500.
2505. gbinv501.seq - Invertebrate sequence entries, part 501.
2506. gbinv502.seq - Invertebrate sequence entries, part 502.
2507. gbinv503.seq - Invertebrate sequence entries, part 503.
2508. gbinv504.seq - Invertebrate sequence entries, part 504.
2509. gbinv505.seq - Invertebrate sequence entries, part 505.
2510. gbinv506.seq - Invertebrate sequence entries, part 506.
2511. gbinv507.seq - Invertebrate sequence entries, part 507.
2512. gbinv508.seq - Invertebrate sequence entries, part 508.
2513. gbinv509.seq - Invertebrate sequence entries, part 509.
2514. gbinv51.seq - Invertebrate sequence entries, part 51.
2515. gbinv510.seq - Invertebrate sequence entries, part 510.
2516. gbinv511.seq - Invertebrate sequence entries, part 511.
2517. gbinv512.seq - Invertebrate sequence entries, part 512.
2518. gbinv513.seq - Invertebrate sequence entries, part 513.
2519. gbinv514.seq - Invertebrate sequence entries, part 514.
2520. gbinv515.seq - Invertebrate sequence entries, part 515.
2521. gbinv516.seq - Invertebrate sequence entries, part 516.
2522. gbinv517.seq - Invertebrate sequence entries, part 517.
2523. gbinv518.seq - Invertebrate sequence entries, part 518.
2524. gbinv519.seq - Invertebrate sequence entries, part 519.
2525. gbinv52.seq - Invertebrate sequence entries, part 52.
2526. gbinv520.seq - Invertebrate sequence entries, part 520.
2527. gbinv521.seq - Invertebrate sequence entries, part 521.
2528. gbinv522.seq - Invertebrate sequence entries, part 522.
2529. gbinv523.seq - Invertebrate sequence entries, part 523.
2530. gbinv524.seq - Invertebrate sequence entries, part 524.
2531. gbinv525.seq - Invertebrate sequence entries, part 525.
2532. gbinv526.seq - Invertebrate sequence entries, part 526.
2533. gbinv527.seq - Invertebrate sequence entries, part 527.
2534. gbinv528.seq - Invertebrate sequence entries, part 528.
2535. gbinv529.seq - Invertebrate sequence entries, part 529.
2536. gbinv53.seq - Invertebrate sequence entries, part 53.
2537. gbinv530.seq - Invertebrate sequence entries, part 530.
2538. gbinv531.seq - Invertebrate sequence entries, part 531.
2539. gbinv532.seq - Invertebrate sequence entries, part 532.
2540. gbinv533.seq - Invertebrate sequence entries, part 533.
2541. gbinv534.seq - Invertebrate sequence entries, part 534.
2542. gbinv535.seq - Invertebrate sequence entries, part 535.
2543. gbinv536.seq - Invertebrate sequence entries, part 536.
2544. gbinv537.seq - Invertebrate sequence entries, part 537.
2545. gbinv538.seq - Invertebrate sequence entries, part 538.
2546. gbinv539.seq - Invertebrate sequence entries, part 539.
2547. gbinv54.seq - Invertebrate sequence entries, part 54.
2548. gbinv540.seq - Invertebrate sequence entries, part 540.
2549. gbinv541.seq - Invertebrate sequence entries, part 541.
2550. gbinv542.seq - Invertebrate sequence entries, part 542.
2551. gbinv543.seq - Invertebrate sequence entries, part 543.
2552. gbinv544.seq - Invertebrate sequence entries, part 544.
2553. gbinv545.seq - Invertebrate sequence entries, part 545.
2554. gbinv546.seq - Invertebrate sequence entries, part 546.
2555. gbinv547.seq - Invertebrate sequence entries, part 547.
2556. gbinv548.seq - Invertebrate sequence entries, part 548.
2557. gbinv549.seq - Invertebrate sequence entries, part 549.
2558. gbinv55.seq - Invertebrate sequence entries, part 55.
2559. gbinv550.seq - Invertebrate sequence entries, part 550.
2560. gbinv551.seq - Invertebrate sequence entries, part 551.
2561. gbinv552.seq - Invertebrate sequence entries, part 552.
2562. gbinv553.seq - Invertebrate sequence entries, part 553.
2563. gbinv554.seq - Invertebrate sequence entries, part 554.
2564. gbinv555.seq - Invertebrate sequence entries, part 555.
2565. gbinv556.seq - Invertebrate sequence entries, part 556.
2566. gbinv557.seq - Invertebrate sequence entries, part 557.
2567. gbinv558.seq - Invertebrate sequence entries, part 558.
2568. gbinv559.seq - Invertebrate sequence entries, part 559.
2569. gbinv56.seq - Invertebrate sequence entries, part 56.
2570. gbinv560.seq - Invertebrate sequence entries, part 560.
2571. gbinv561.seq - Invertebrate sequence entries, part 561.
2572. gbinv562.seq - Invertebrate sequence entries, part 562.
2573. gbinv563.seq - Invertebrate sequence entries, part 563.
2574. gbinv564.seq - Invertebrate sequence entries, part 564.
2575. gbinv565.seq - Invertebrate sequence entries, part 565.
2576. gbinv566.seq - Invertebrate sequence entries, part 566.
2577. gbinv567.seq - Invertebrate sequence entries, part 567.
2578. gbinv568.seq - Invertebrate sequence entries, part 568.
2579. gbinv569.seq - Invertebrate sequence entries, part 569.
2580. gbinv57.seq - Invertebrate sequence entries, part 57.
2581. gbinv570.seq - Invertebrate sequence entries, part 570.
2582. gbinv571.seq - Invertebrate sequence entries, part 571.
2583. gbinv572.seq - Invertebrate sequence entries, part 572.
2584. gbinv573.seq - Invertebrate sequence entries, part 573.
2585. gbinv574.seq - Invertebrate sequence entries, part 574.
2586. gbinv575.seq - Invertebrate sequence entries, part 575.
2587. gbinv576.seq - Invertebrate sequence entries, part 576.
2588. gbinv577.seq - Invertebrate sequence entries, part 577.
2589. gbinv578.seq - Invertebrate sequence entries, part 578.
2590. gbinv579.seq - Invertebrate sequence entries, part 579.
2591. gbinv58.seq - Invertebrate sequence entries, part 58.
2592. gbinv580.seq - Invertebrate sequence entries, part 580.
2593. gbinv581.seq - Invertebrate sequence entries, part 581.
2594. gbinv582.seq - Invertebrate sequence entries, part 582.
2595. gbinv583.seq - Invertebrate sequence entries, part 583.
2596. gbinv584.seq - Invertebrate sequence entries, part 584.
2597. gbinv585.seq - Invertebrate sequence entries, part 585.
2598. gbinv586.seq - Invertebrate sequence entries, part 586.
2599. gbinv587.seq - Invertebrate sequence entries, part 587.
2600. gbinv588.seq - Invertebrate sequence entries, part 588.
2601. gbinv589.seq - Invertebrate sequence entries, part 589.
2602. gbinv59.seq - Invertebrate sequence entries, part 59.
2603. gbinv590.seq - Invertebrate sequence entries, part 590.
2604. gbinv591.seq - Invertebrate sequence entries, part 591.
2605. gbinv592.seq - Invertebrate sequence entries, part 592.
2606. gbinv593.seq - Invertebrate sequence entries, part 593.
2607. gbinv594.seq - Invertebrate sequence entries, part 594.
2608. gbinv595.seq - Invertebrate sequence entries, part 595.
2609. gbinv596.seq - Invertebrate sequence entries, part 596.
2610. gbinv597.seq - Invertebrate sequence entries, part 597.
2611. gbinv598.seq - Invertebrate sequence entries, part 598.
2612. gbinv599.seq - Invertebrate sequence entries, part 599.
2613. gbinv6.seq - Invertebrate sequence entries, part 6.
2614. gbinv60.seq - Invertebrate sequence entries, part 60.
2615. gbinv600.seq - Invertebrate sequence entries, part 600.
2616. gbinv601.seq - Invertebrate sequence entries, part 601.
2617. gbinv602.seq - Invertebrate sequence entries, part 602.
2618. gbinv603.seq - Invertebrate sequence entries, part 603.
2619. gbinv604.seq - Invertebrate sequence entries, part 604.
2620. gbinv605.seq - Invertebrate sequence entries, part 605.
2621. gbinv606.seq - Invertebrate sequence entries, part 606.
2622. gbinv607.seq - Invertebrate sequence entries, part 607.
2623. gbinv608.seq - Invertebrate sequence entries, part 608.
2624. gbinv609.seq - Invertebrate sequence entries, part 609.
2625. gbinv61.seq - Invertebrate sequence entries, part 61.
2626. gbinv610.seq - Invertebrate sequence entries, part 610.
2627. gbinv611.seq - Invertebrate sequence entries, part 611.
2628. gbinv612.seq - Invertebrate sequence entries, part 612.
2629. gbinv613.seq - Invertebrate sequence entries, part 613.
2630. gbinv614.seq - Invertebrate sequence entries, part 614.
2631. gbinv615.seq - Invertebrate sequence entries, part 615.
2632. gbinv616.seq - Invertebrate sequence entries, part 616.
2633. gbinv617.seq - Invertebrate sequence entries, part 617.
2634. gbinv618.seq - Invertebrate sequence entries, part 618.
2635. gbinv619.seq - Invertebrate sequence entries, part 619.
2636. gbinv62.seq - Invertebrate sequence entries, part 62.
2637. gbinv620.seq - Invertebrate sequence entries, part 620.
2638. gbinv621.seq - Invertebrate sequence entries, part 621.
2639. gbinv622.seq - Invertebrate sequence entries, part 622.
2640. gbinv623.seq - Invertebrate sequence entries, part 623.
2641. gbinv624.seq - Invertebrate sequence entries, part 624.
2642. gbinv625.seq - Invertebrate sequence entries, part 625.
2643. gbinv626.seq - Invertebrate sequence entries, part 626.
2644. gbinv627.seq - Invertebrate sequence entries, part 627.
2645. gbinv628.seq - Invertebrate sequence entries, part 628.
2646. gbinv629.seq - Invertebrate sequence entries, part 629.
2647. gbinv63.seq - Invertebrate sequence entries, part 63.
2648. gbinv630.seq - Invertebrate sequence entries, part 630.
2649. gbinv631.seq - Invertebrate sequence entries, part 631.
2650. gbinv632.seq - Invertebrate sequence entries, part 632.
2651. gbinv633.seq - Invertebrate sequence entries, part 633.
2652. gbinv634.seq - Invertebrate sequence entries, part 634.
2653. gbinv635.seq - Invertebrate sequence entries, part 635.
2654. gbinv636.seq - Invertebrate sequence entries, part 636.
2655. gbinv637.seq - Invertebrate sequence entries, part 637.
2656. gbinv638.seq - Invertebrate sequence entries, part 638.
2657. gbinv639.seq - Invertebrate sequence entries, part 639.
2658. gbinv64.seq - Invertebrate sequence entries, part 64.
2659. gbinv640.seq - Invertebrate sequence entries, part 640.
2660. gbinv641.seq - Invertebrate sequence entries, part 641.
2661. gbinv642.seq - Invertebrate sequence entries, part 642.
2662. gbinv643.seq - Invertebrate sequence entries, part 643.
2663. gbinv644.seq - Invertebrate sequence entries, part 644.
2664. gbinv645.seq - Invertebrate sequence entries, part 645.
2665. gbinv646.seq - Invertebrate sequence entries, part 646.
2666. gbinv647.seq - Invertebrate sequence entries, part 647.
2667. gbinv648.seq - Invertebrate sequence entries, part 648.
2668. gbinv649.seq - Invertebrate sequence entries, part 649.
2669. gbinv65.seq - Invertebrate sequence entries, part 65.
2670. gbinv650.seq - Invertebrate sequence entries, part 650.
2671. gbinv651.seq - Invertebrate sequence entries, part 651.
2672. gbinv652.seq - Invertebrate sequence entries, part 652.
2673. gbinv653.seq - Invertebrate sequence entries, part 653.
2674. gbinv654.seq - Invertebrate sequence entries, part 654.
2675. gbinv655.seq - Invertebrate sequence entries, part 655.
2676. gbinv656.seq - Invertebrate sequence entries, part 656.
2677. gbinv657.seq - Invertebrate sequence entries, part 657.
2678. gbinv658.seq - Invertebrate sequence entries, part 658.
2679. gbinv659.seq - Invertebrate sequence entries, part 659.
2680. gbinv66.seq - Invertebrate sequence entries, part 66.
2681. gbinv660.seq - Invertebrate sequence entries, part 660.
2682. gbinv661.seq - Invertebrate sequence entries, part 661.
2683. gbinv662.seq - Invertebrate sequence entries, part 662.
2684. gbinv663.seq - Invertebrate sequence entries, part 663.
2685. gbinv664.seq - Invertebrate sequence entries, part 664.
2686. gbinv665.seq - Invertebrate sequence entries, part 665.
2687. gbinv666.seq - Invertebrate sequence entries, part 666.
2688. gbinv667.seq - Invertebrate sequence entries, part 667.
2689. gbinv668.seq - Invertebrate sequence entries, part 668.
2690. gbinv669.seq - Invertebrate sequence entries, part 669.
2691. gbinv67.seq - Invertebrate sequence entries, part 67.
2692. gbinv670.seq - Invertebrate sequence entries, part 670.
2693. gbinv671.seq - Invertebrate sequence entries, part 671.
2694. gbinv672.seq - Invertebrate sequence entries, part 672.
2695. gbinv673.seq - Invertebrate sequence entries, part 673.
2696. gbinv674.seq - Invertebrate sequence entries, part 674.
2697. gbinv675.seq - Invertebrate sequence entries, part 675.
2698. gbinv676.seq - Invertebrate sequence entries, part 676.
2699. gbinv677.seq - Invertebrate sequence entries, part 677.
2700. gbinv678.seq - Invertebrate sequence entries, part 678.
2701. gbinv679.seq - Invertebrate sequence entries, part 679.
2702. gbinv68.seq - Invertebrate sequence entries, part 68.
2703. gbinv680.seq - Invertebrate sequence entries, part 680.
2704. gbinv681.seq - Invertebrate sequence entries, part 681.
2705. gbinv682.seq - Invertebrate sequence entries, part 682.
2706. gbinv683.seq - Invertebrate sequence entries, part 683.
2707. gbinv684.seq - Invertebrate sequence entries, part 684.
2708. gbinv685.seq - Invertebrate sequence entries, part 685.
2709. gbinv686.seq - Invertebrate sequence entries, part 686.
2710. gbinv687.seq - Invertebrate sequence entries, part 687.
2711. gbinv688.seq - Invertebrate sequence entries, part 688.
2712. gbinv689.seq - Invertebrate sequence entries, part 689.
2713. gbinv69.seq - Invertebrate sequence entries, part 69.
2714. gbinv690.seq - Invertebrate sequence entries, part 690.
2715. gbinv691.seq - Invertebrate sequence entries, part 691.
2716. gbinv692.seq - Invertebrate sequence entries, part 692.
2717. gbinv693.seq - Invertebrate sequence entries, part 693.
2718. gbinv694.seq - Invertebrate sequence entries, part 694.
2719. gbinv695.seq - Invertebrate sequence entries, part 695.
2720. gbinv696.seq - Invertebrate sequence entries, part 696.
2721. gbinv697.seq - Invertebrate sequence entries, part 697.
2722. gbinv698.seq - Invertebrate sequence entries, part 698.
2723. gbinv699.seq - Invertebrate sequence entries, part 699.
2724. gbinv7.seq - Invertebrate sequence entries, part 7.
2725. gbinv70.seq - Invertebrate sequence entries, part 70.
2726. gbinv700.seq - Invertebrate sequence entries, part 700.
2727. gbinv701.seq - Invertebrate sequence entries, part 701.
2728. gbinv702.seq - Invertebrate sequence entries, part 702.
2729. gbinv703.seq - Invertebrate sequence entries, part 703.
2730. gbinv704.seq - Invertebrate sequence entries, part 704.
2731. gbinv705.seq - Invertebrate sequence entries, part 705.
2732. gbinv706.seq - Invertebrate sequence entries, part 706.
2733. gbinv707.seq - Invertebrate sequence entries, part 707.
2734. gbinv708.seq - Invertebrate sequence entries, part 708.
2735. gbinv709.seq - Invertebrate sequence entries, part 709.
2736. gbinv71.seq - Invertebrate sequence entries, part 71.
2737. gbinv710.seq - Invertebrate sequence entries, part 710.
2738. gbinv711.seq - Invertebrate sequence entries, part 711.
2739. gbinv712.seq - Invertebrate sequence entries, part 712.
2740. gbinv713.seq - Invertebrate sequence entries, part 713.
2741. gbinv714.seq - Invertebrate sequence entries, part 714.
2742. gbinv715.seq - Invertebrate sequence entries, part 715.
2743. gbinv72.seq - Invertebrate sequence entries, part 72.
2744. gbinv73.seq - Invertebrate sequence entries, part 73.
2745. gbinv74.seq - Invertebrate sequence entries, part 74.
2746. gbinv75.seq - Invertebrate sequence entries, part 75.
2747. gbinv76.seq - Invertebrate sequence entries, part 76.
2748. gbinv77.seq - Invertebrate sequence entries, part 77.
2749. gbinv78.seq - Invertebrate sequence entries, part 78.
2750. gbinv79.seq - Invertebrate sequence entries, part 79.
2751. gbinv8.seq - Invertebrate sequence entries, part 8.
2752. gbinv80.seq - Invertebrate sequence entries, part 80.
2753. gbinv81.seq - Invertebrate sequence entries, part 81.
2754. gbinv82.seq - Invertebrate sequence entries, part 82.
2755. gbinv83.seq - Invertebrate sequence entries, part 83.
2756. gbinv84.seq - Invertebrate sequence entries, part 84.
2757. gbinv85.seq - Invertebrate sequence entries, part 85.
2758. gbinv86.seq - Invertebrate sequence entries, part 86.
2759. gbinv87.seq - Invertebrate sequence entries, part 87.
2760. gbinv88.seq - Invertebrate sequence entries, part 88.
2761. gbinv89.seq - Invertebrate sequence entries, part 89.
2762. gbinv9.seq - Invertebrate sequence entries, part 9.
2763. gbinv90.seq - Invertebrate sequence entries, part 90.
2764. gbinv91.seq - Invertebrate sequence entries, part 91.
2765. gbinv92.seq - Invertebrate sequence entries, part 92.
2766. gbinv93.seq - Invertebrate sequence entries, part 93.
2767. gbinv94.seq - Invertebrate sequence entries, part 94.
2768. gbinv95.seq - Invertebrate sequence entries, part 95.
2769. gbinv96.seq - Invertebrate sequence entries, part 96.
2770. gbinv97.seq - Invertebrate sequence entries, part 97.
2771. gbinv98.seq - Invertebrate sequence entries, part 98.
2772. gbinv99.seq - Invertebrate sequence entries, part 99.
2773. gbmam1.seq - Other mammalian sequence entries, part 1.
2774. gbmam10.seq - Other mammalian sequence entries, part 10.
2775. gbmam100.seq - Other mammalian sequence entries, part 100.
2776. gbmam101.seq - Other mammalian sequence entries, part 101.
2777. gbmam102.seq - Other mammalian sequence entries, part 102.
2778. gbmam103.seq - Other mammalian sequence entries, part 103.
2779. gbmam104.seq - Other mammalian sequence entries, part 104.
2780. gbmam105.seq - Other mammalian sequence entries, part 105.
2781. gbmam106.seq - Other mammalian sequence entries, part 106.
2782. gbmam107.seq - Other mammalian sequence entries, part 107.
2783. gbmam108.seq - Other mammalian sequence entries, part 108.
2784. gbmam109.seq - Other mammalian sequence entries, part 109.
2785. gbmam11.seq - Other mammalian sequence entries, part 11.
2786. gbmam110.seq - Other mammalian sequence entries, part 110.
2787. gbmam111.seq - Other mammalian sequence entries, part 111.
2788. gbmam112.seq - Other mammalian sequence entries, part 112.
2789. gbmam113.seq - Other mammalian sequence entries, part 113.
2790. gbmam114.seq - Other mammalian sequence entries, part 114.
2791. gbmam115.seq - Other mammalian sequence entries, part 115.
2792. gbmam116.seq - Other mammalian sequence entries, part 116.
2793. gbmam117.seq - Other mammalian sequence entries, part 117.
2794. gbmam118.seq - Other mammalian sequence entries, part 118.
2795. gbmam119.seq - Other mammalian sequence entries, part 119.
2796. gbmam12.seq - Other mammalian sequence entries, part 12.
2797. gbmam120.seq - Other mammalian sequence entries, part 120.
2798. gbmam121.seq - Other mammalian sequence entries, part 121.
2799. gbmam122.seq - Other mammalian sequence entries, part 122.
2800. gbmam123.seq - Other mammalian sequence entries, part 123.
2801. gbmam124.seq - Other mammalian sequence entries, part 124.
2802. gbmam125.seq - Other mammalian sequence entries, part 125.
2803. gbmam126.seq - Other mammalian sequence entries, part 126.
2804. gbmam127.seq - Other mammalian sequence entries, part 127.
2805. gbmam128.seq - Other mammalian sequence entries, part 128.
2806. gbmam129.seq - Other mammalian sequence entries, part 129.
2807. gbmam13.seq - Other mammalian sequence entries, part 13.
2808. gbmam130.seq - Other mammalian sequence entries, part 130.
2809. gbmam131.seq - Other mammalian sequence entries, part 131.
2810. gbmam132.seq - Other mammalian sequence entries, part 132.
2811. gbmam133.seq - Other mammalian sequence entries, part 133.
2812. gbmam14.seq - Other mammalian sequence entries, part 14.
2813. gbmam15.seq - Other mammalian sequence entries, part 15.
2814. gbmam16.seq - Other mammalian sequence entries, part 16.
2815. gbmam17.seq - Other mammalian sequence entries, part 17.
2816. gbmam18.seq - Other mammalian sequence entries, part 18.
2817. gbmam19.seq - Other mammalian sequence entries, part 19.
2818. gbmam2.seq - Other mammalian sequence entries, part 2.
2819. gbmam20.seq - Other mammalian sequence entries, part 20.
2820. gbmam21.seq - Other mammalian sequence entries, part 21.
2821. gbmam22.seq - Other mammalian sequence entries, part 22.
2822. gbmam23.seq - Other mammalian sequence entries, part 23.
2823. gbmam24.seq - Other mammalian sequence entries, part 24.
2824. gbmam25.seq - Other mammalian sequence entries, part 25.
2825. gbmam26.seq - Other mammalian sequence entries, part 26.
2826. gbmam27.seq - Other mammalian sequence entries, part 27.
2827. gbmam28.seq - Other mammalian sequence entries, part 28.
2828. gbmam29.seq - Other mammalian sequence entries, part 29.
2829. gbmam3.seq - Other mammalian sequence entries, part 3.
2830. gbmam30.seq - Other mammalian sequence entries, part 30.
2831. gbmam31.seq - Other mammalian sequence entries, part 31.
2832. gbmam32.seq - Other mammalian sequence entries, part 32.
2833. gbmam33.seq - Other mammalian sequence entries, part 33.
2834. gbmam34.seq - Other mammalian sequence entries, part 34.
2835. gbmam35.seq - Other mammalian sequence entries, part 35.
2836. gbmam36.seq - Other mammalian sequence entries, part 36.
2837. gbmam37.seq - Other mammalian sequence entries, part 37.
2838. gbmam38.seq - Other mammalian sequence entries, part 38.
2839. gbmam39.seq - Other mammalian sequence entries, part 39.
2840. gbmam4.seq - Other mammalian sequence entries, part 4.
2841. gbmam40.seq - Other mammalian sequence entries, part 40.
2842. gbmam41.seq - Other mammalian sequence entries, part 41.
2843. gbmam42.seq - Other mammalian sequence entries, part 42.
2844. gbmam43.seq - Other mammalian sequence entries, part 43.
2845. gbmam44.seq - Other mammalian sequence entries, part 44.
2846. gbmam45.seq - Other mammalian sequence entries, part 45.
2847. gbmam46.seq - Other mammalian sequence entries, part 46.
2848. gbmam47.seq - Other mammalian sequence entries, part 47.
2849. gbmam48.seq - Other mammalian sequence entries, part 48.
2850. gbmam49.seq - Other mammalian sequence entries, part 49.
2851. gbmam5.seq - Other mammalian sequence entries, part 5.
2852. gbmam50.seq - Other mammalian sequence entries, part 50.
2853. gbmam51.seq - Other mammalian sequence entries, part 51.
2854. gbmam52.seq - Other mammalian sequence entries, part 52.
2855. gbmam53.seq - Other mammalian sequence entries, part 53.
2856. gbmam54.seq - Other mammalian sequence entries, part 54.
2857. gbmam55.seq - Other mammalian sequence entries, part 55.
2858. gbmam56.seq - Other mammalian sequence entries, part 56.
2859. gbmam57.seq - Other mammalian sequence entries, part 57.
2860. gbmam58.seq - Other mammalian sequence entries, part 58.
2861. gbmam59.seq - Other mammalian sequence entries, part 59.
2862. gbmam6.seq - Other mammalian sequence entries, part 6.
2863. gbmam60.seq - Other mammalian sequence entries, part 60.
2864. gbmam61.seq - Other mammalian sequence entries, part 61.
2865. gbmam62.seq - Other mammalian sequence entries, part 62.
2866. gbmam63.seq - Other mammalian sequence entries, part 63.
2867. gbmam64.seq - Other mammalian sequence entries, part 64.
2868. gbmam65.seq - Other mammalian sequence entries, part 65.
2869. gbmam66.seq - Other mammalian sequence entries, part 66.
2870. gbmam67.seq - Other mammalian sequence entries, part 67.
2871. gbmam68.seq - Other mammalian sequence entries, part 68.
2872. gbmam69.seq - Other mammalian sequence entries, part 69.
2873. gbmam7.seq - Other mammalian sequence entries, part 7.
2874. gbmam70.seq - Other mammalian sequence entries, part 70.
2875. gbmam71.seq - Other mammalian sequence entries, part 71.
2876. gbmam72.seq - Other mammalian sequence entries, part 72.
2877. gbmam73.seq - Other mammalian sequence entries, part 73.
2878. gbmam74.seq - Other mammalian sequence entries, part 74.
2879. gbmam75.seq - Other mammalian sequence entries, part 75.
2880. gbmam76.seq - Other mammalian sequence entries, part 76.
2881. gbmam77.seq - Other mammalian sequence entries, part 77.
2882. gbmam78.seq - Other mammalian sequence entries, part 78.
2883. gbmam79.seq - Other mammalian sequence entries, part 79.
2884. gbmam8.seq - Other mammalian sequence entries, part 8.
2885. gbmam80.seq - Other mammalian sequence entries, part 80.
2886. gbmam81.seq - Other mammalian sequence entries, part 81.
2887. gbmam82.seq - Other mammalian sequence entries, part 82.
2888. gbmam83.seq - Other mammalian sequence entries, part 83.
2889. gbmam84.seq - Other mammalian sequence entries, part 84.
2890. gbmam85.seq - Other mammalian sequence entries, part 85.
2891. gbmam86.seq - Other mammalian sequence entries, part 86.
2892. gbmam87.seq - Other mammalian sequence entries, part 87.
2893. gbmam88.seq - Other mammalian sequence entries, part 88.
2894. gbmam89.seq - Other mammalian sequence entries, part 89.
2895. gbmam9.seq - Other mammalian sequence entries, part 9.
2896. gbmam90.seq - Other mammalian sequence entries, part 90.
2897. gbmam91.seq - Other mammalian sequence entries, part 91.
2898. gbmam92.seq - Other mammalian sequence entries, part 92.
2899. gbmam93.seq - Other mammalian sequence entries, part 93.
2900. gbmam94.seq - Other mammalian sequence entries, part 94.
2901. gbmam95.seq - Other mammalian sequence entries, part 95.
2902. gbmam96.seq - Other mammalian sequence entries, part 96.
2903. gbmam97.seq - Other mammalian sequence entries, part 97.
2904. gbmam98.seq - Other mammalian sequence entries, part 98.
2905. gbmam99.seq - Other mammalian sequence entries, part 99.
2906. gbnew.txt - Accession numbers of entries new since the previous release.
2907. gbpat1.seq - Patent sequence entries, part 1.
2908. gbpat10.seq - Patent sequence entries, part 10.
2909. gbpat100.seq - Patent sequence entries, part 100.
2910. gbpat101.seq - Patent sequence entries, part 101.
2911. gbpat102.seq - Patent sequence entries, part 102.
2912. gbpat103.seq - Patent sequence entries, part 103.
2913. gbpat104.seq - Patent sequence entries, part 104.
2914. gbpat105.seq - Patent sequence entries, part 105.
2915. gbpat106.seq - Patent sequence entries, part 106.
2916. gbpat107.seq - Patent sequence entries, part 107.
2917. gbpat108.seq - Patent sequence entries, part 108.
2918. gbpat109.seq - Patent sequence entries, part 109.
2919. gbpat11.seq - Patent sequence entries, part 11.
2920. gbpat110.seq - Patent sequence entries, part 110.
2921. gbpat111.seq - Patent sequence entries, part 111.
2922. gbpat112.seq - Patent sequence entries, part 112.
2923. gbpat113.seq - Patent sequence entries, part 113.
2924. gbpat114.seq - Patent sequence entries, part 114.
2925. gbpat115.seq - Patent sequence entries, part 115.
2926. gbpat116.seq - Patent sequence entries, part 116.
2927. gbpat117.seq - Patent sequence entries, part 117.
2928. gbpat118.seq - Patent sequence entries, part 118.
2929. gbpat119.seq - Patent sequence entries, part 119.
2930. gbpat12.seq - Patent sequence entries, part 12.
2931. gbpat120.seq - Patent sequence entries, part 120.
2932. gbpat121.seq - Patent sequence entries, part 121.
2933. gbpat122.seq - Patent sequence entries, part 122.
2934. gbpat123.seq - Patent sequence entries, part 123.
2935. gbpat124.seq - Patent sequence entries, part 124.
2936. gbpat125.seq - Patent sequence entries, part 125.
2937. gbpat126.seq - Patent sequence entries, part 126.
2938. gbpat127.seq - Patent sequence entries, part 127.
2939. gbpat128.seq - Patent sequence entries, part 128.
2940. gbpat129.seq - Patent sequence entries, part 129.
2941. gbpat13.seq - Patent sequence entries, part 13.
2942. gbpat130.seq - Patent sequence entries, part 130.
2943. gbpat131.seq - Patent sequence entries, part 131.
2944. gbpat132.seq - Patent sequence entries, part 132.
2945. gbpat133.seq - Patent sequence entries, part 133.
2946. gbpat134.seq - Patent sequence entries, part 134.
2947. gbpat135.seq - Patent sequence entries, part 135.
2948. gbpat136.seq - Patent sequence entries, part 136.
2949. gbpat137.seq - Patent sequence entries, part 137.
2950. gbpat138.seq - Patent sequence entries, part 138.
2951. gbpat139.seq - Patent sequence entries, part 139.
2952. gbpat14.seq - Patent sequence entries, part 14.
2953. gbpat140.seq - Patent sequence entries, part 140.
2954. gbpat141.seq - Patent sequence entries, part 141.
2955. gbpat142.seq - Patent sequence entries, part 142.
2956. gbpat143.seq - Patent sequence entries, part 143.
2957. gbpat144.seq - Patent sequence entries, part 144.
2958. gbpat145.seq - Patent sequence entries, part 145.
2959. gbpat146.seq - Patent sequence entries, part 146.
2960. gbpat147.seq - Patent sequence entries, part 147.
2961. gbpat148.seq - Patent sequence entries, part 148.
2962. gbpat149.seq - Patent sequence entries, part 149.
2963. gbpat15.seq - Patent sequence entries, part 15.
2964. gbpat150.seq - Patent sequence entries, part 150.
2965. gbpat151.seq - Patent sequence entries, part 151.
2966. gbpat152.seq - Patent sequence entries, part 152.
2967. gbpat153.seq - Patent sequence entries, part 153.
2968. gbpat154.seq - Patent sequence entries, part 154.
2969. gbpat155.seq - Patent sequence entries, part 155.
2970. gbpat156.seq - Patent sequence entries, part 156.
2971. gbpat157.seq - Patent sequence entries, part 157.
2972. gbpat158.seq - Patent sequence entries, part 158.
2973. gbpat159.seq - Patent sequence entries, part 159.
2974. gbpat16.seq - Patent sequence entries, part 16.
2975. gbpat160.seq - Patent sequence entries, part 160.
2976. gbpat161.seq - Patent sequence entries, part 161.
2977. gbpat162.seq - Patent sequence entries, part 162.
2978. gbpat163.seq - Patent sequence entries, part 163.
2979. gbpat164.seq - Patent sequence entries, part 164.
2980. gbpat165.seq - Patent sequence entries, part 165.
2981. gbpat166.seq - Patent sequence entries, part 166.
2982. gbpat167.seq - Patent sequence entries, part 167.
2983. gbpat168.seq - Patent sequence entries, part 168.
2984. gbpat169.seq - Patent sequence entries, part 169.
2985. gbpat17.seq - Patent sequence entries, part 17.
2986. gbpat170.seq - Patent sequence entries, part 170.
2987. gbpat171.seq - Patent sequence entries, part 171.
2988. gbpat172.seq - Patent sequence entries, part 172.
2989. gbpat173.seq - Patent sequence entries, part 173.
2990. gbpat174.seq - Patent sequence entries, part 174.
2991. gbpat175.seq - Patent sequence entries, part 175.
2992. gbpat176.seq - Patent sequence entries, part 176.
2993. gbpat177.seq - Patent sequence entries, part 177.
2994. gbpat178.seq - Patent sequence entries, part 178.
2995. gbpat179.seq - Patent sequence entries, part 179.
2996. gbpat18.seq - Patent sequence entries, part 18.
2997. gbpat180.seq - Patent sequence entries, part 180.
2998. gbpat181.seq - Patent sequence entries, part 181.
2999. gbpat182.seq - Patent sequence entries, part 182.
3000. gbpat183.seq - Patent sequence entries, part 183.
3001. gbpat184.seq - Patent sequence entries, part 184.
3002. gbpat185.seq - Patent sequence entries, part 185.
3003. gbpat186.seq - Patent sequence entries, part 186.
3004. gbpat187.seq - Patent sequence entries, part 187.
3005. gbpat188.seq - Patent sequence entries, part 188.
3006. gbpat189.seq - Patent sequence entries, part 189.
3007. gbpat19.seq - Patent sequence entries, part 19.
3008. gbpat190.seq - Patent sequence entries, part 190.
3009. gbpat191.seq - Patent sequence entries, part 191.
3010. gbpat192.seq - Patent sequence entries, part 192.
3011. gbpat193.seq - Patent sequence entries, part 193.
3012. gbpat194.seq - Patent sequence entries, part 194.
3013. gbpat195.seq - Patent sequence entries, part 195.
3014. gbpat196.seq - Patent sequence entries, part 196.
3015. gbpat197.seq - Patent sequence entries, part 197.
3016. gbpat198.seq - Patent sequence entries, part 198.
3017. gbpat199.seq - Patent sequence entries, part 199.
3018. gbpat2.seq - Patent sequence entries, part 2.
3019. gbpat20.seq - Patent sequence entries, part 20.
3020. gbpat200.seq - Patent sequence entries, part 200.
3021. gbpat201.seq - Patent sequence entries, part 201.
3022. gbpat202.seq - Patent sequence entries, part 202.
3023. gbpat203.seq - Patent sequence entries, part 203.
3024. gbpat204.seq - Patent sequence entries, part 204.
3025. gbpat205.seq - Patent sequence entries, part 205.
3026. gbpat206.seq - Patent sequence entries, part 206.
3027. gbpat207.seq - Patent sequence entries, part 207.
3028. gbpat208.seq - Patent sequence entries, part 208.
3029. gbpat209.seq - Patent sequence entries, part 209.
3030. gbpat21.seq - Patent sequence entries, part 21.
3031. gbpat210.seq - Patent sequence entries, part 210.
3032. gbpat211.seq - Patent sequence entries, part 211.
3033. gbpat212.seq - Patent sequence entries, part 212.
3034. gbpat213.seq - Patent sequence entries, part 213.
3035. gbpat214.seq - Patent sequence entries, part 214.
3036. gbpat215.seq - Patent sequence entries, part 215.
3037. gbpat216.seq - Patent sequence entries, part 216.
3038. gbpat217.seq - Patent sequence entries, part 217.
3039. gbpat218.seq - Patent sequence entries, part 218.
3040. gbpat219.seq - Patent sequence entries, part 219.
3041. gbpat22.seq - Patent sequence entries, part 22.
3042. gbpat220.seq - Patent sequence entries, part 220.
3043. gbpat221.seq - Patent sequence entries, part 221.
3044. gbpat222.seq - Patent sequence entries, part 222.
3045. gbpat223.seq - Patent sequence entries, part 223.
3046. gbpat224.seq - Patent sequence entries, part 224.
3047. gbpat225.seq - Patent sequence entries, part 225.
3048. gbpat226.seq - Patent sequence entries, part 226.
3049. gbpat227.seq - Patent sequence entries, part 227.
3050. gbpat228.seq - Patent sequence entries, part 228.
3051. gbpat229.seq - Patent sequence entries, part 229.
3052. gbpat23.seq - Patent sequence entries, part 23.
3053. gbpat230.seq - Patent sequence entries, part 230.
3054. gbpat231.seq - Patent sequence entries, part 231.
3055. gbpat232.seq - Patent sequence entries, part 232.
3056. gbpat233.seq - Patent sequence entries, part 233.
3057. gbpat234.seq - Patent sequence entries, part 234.
3058. gbpat235.seq - Patent sequence entries, part 235.
3059. gbpat236.seq - Patent sequence entries, part 236.
3060. gbpat237.seq - Patent sequence entries, part 237.
3061. gbpat238.seq - Patent sequence entries, part 238.
3062. gbpat239.seq - Patent sequence entries, part 239.
3063. gbpat24.seq - Patent sequence entries, part 24.
3064. gbpat240.seq - Patent sequence entries, part 240.
3065. gbpat241.seq - Patent sequence entries, part 241.
3066. gbpat242.seq - Patent sequence entries, part 242.
3067. gbpat243.seq - Patent sequence entries, part 243.
3068. gbpat244.seq - Patent sequence entries, part 244.
3069. gbpat245.seq - Patent sequence entries, part 245.
3070. gbpat246.seq - Patent sequence entries, part 246.
3071. gbpat247.seq - Patent sequence entries, part 247.
3072. gbpat248.seq - Patent sequence entries, part 248.
3073. gbpat249.seq - Patent sequence entries, part 249.
3074. gbpat25.seq - Patent sequence entries, part 25.
3075. gbpat250.seq - Patent sequence entries, part 250.
3076. gbpat251.seq - Patent sequence entries, part 251.
3077. gbpat26.seq - Patent sequence entries, part 26.
3078. gbpat27.seq - Patent sequence entries, part 27.
3079. gbpat28.seq - Patent sequence entries, part 28.
3080. gbpat29.seq - Patent sequence entries, part 29.
3081. gbpat3.seq - Patent sequence entries, part 3.
3082. gbpat30.seq - Patent sequence entries, part 30.
3083. gbpat31.seq - Patent sequence entries, part 31.
3084. gbpat32.seq - Patent sequence entries, part 32.
3085. gbpat33.seq - Patent sequence entries, part 33.
3086. gbpat34.seq - Patent sequence entries, part 34.
3087. gbpat35.seq - Patent sequence entries, part 35.
3088. gbpat36.seq - Patent sequence entries, part 36.
3089. gbpat37.seq - Patent sequence entries, part 37.
3090. gbpat38.seq - Patent sequence entries, part 38.
3091. gbpat39.seq - Patent sequence entries, part 39.
3092. gbpat4.seq - Patent sequence entries, part 4.
3093. gbpat40.seq - Patent sequence entries, part 40.
3094. gbpat41.seq - Patent sequence entries, part 41.
3095. gbpat42.seq - Patent sequence entries, part 42.
3096. gbpat43.seq - Patent sequence entries, part 43.
3097. gbpat44.seq - Patent sequence entries, part 44.
3098. gbpat45.seq - Patent sequence entries, part 45.
3099. gbpat46.seq - Patent sequence entries, part 46.
3100. gbpat47.seq - Patent sequence entries, part 47.
3101. gbpat48.seq - Patent sequence entries, part 48.
3102. gbpat49.seq - Patent sequence entries, part 49.
3103. gbpat5.seq - Patent sequence entries, part 5.
3104. gbpat50.seq - Patent sequence entries, part 50.
3105. gbpat51.seq - Patent sequence entries, part 51.
3106. gbpat52.seq - Patent sequence entries, part 52.
3107. gbpat53.seq - Patent sequence entries, part 53.
3108. gbpat54.seq - Patent sequence entries, part 54.
3109. gbpat55.seq - Patent sequence entries, part 55.
3110. gbpat56.seq - Patent sequence entries, part 56.
3111. gbpat57.seq - Patent sequence entries, part 57.
3112. gbpat58.seq - Patent sequence entries, part 58.
3113. gbpat59.seq - Patent sequence entries, part 59.
3114. gbpat6.seq - Patent sequence entries, part 6.
3115. gbpat60.seq - Patent sequence entries, part 60.
3116. gbpat61.seq - Patent sequence entries, part 61.
3117. gbpat62.seq - Patent sequence entries, part 62.
3118. gbpat63.seq - Patent sequence entries, part 63.
3119. gbpat64.seq - Patent sequence entries, part 64.
3120. gbpat65.seq - Patent sequence entries, part 65.
3121. gbpat66.seq - Patent sequence entries, part 66.
3122. gbpat67.seq - Patent sequence entries, part 67.
3123. gbpat68.seq - Patent sequence entries, part 68.
3124. gbpat69.seq - Patent sequence entries, part 69.
3125. gbpat7.seq - Patent sequence entries, part 7.
3126. gbpat70.seq - Patent sequence entries, part 70.
3127. gbpat71.seq - Patent sequence entries, part 71.
3128. gbpat72.seq - Patent sequence entries, part 72.
3129. gbpat73.seq - Patent sequence entries, part 73.
3130. gbpat74.seq - Patent sequence entries, part 74.
3131. gbpat75.seq - Patent sequence entries, part 75.
3132. gbpat76.seq - Patent sequence entries, part 76.
3133. gbpat77.seq - Patent sequence entries, part 77.
3134. gbpat78.seq - Patent sequence entries, part 78.
3135. gbpat79.seq - Patent sequence entries, part 79.
3136. gbpat8.seq - Patent sequence entries, part 8.
3137. gbpat80.seq - Patent sequence entries, part 80.
3138. gbpat81.seq - Patent sequence entries, part 81.
3139. gbpat82.seq - Patent sequence entries, part 82.
3140. gbpat83.seq - Patent sequence entries, part 83.
3141. gbpat84.seq - Patent sequence entries, part 84.
3142. gbpat85.seq - Patent sequence entries, part 85.
3143. gbpat86.seq - Patent sequence entries, part 86.
3144. gbpat87.seq - Patent sequence entries, part 87.
3145. gbpat88.seq - Patent sequence entries, part 88.
3146. gbpat89.seq - Patent sequence entries, part 89.
3147. gbpat9.seq - Patent sequence entries, part 9.
3148. gbpat90.seq - Patent sequence entries, part 90.
3149. gbpat91.seq - Patent sequence entries, part 91.
3150. gbpat92.seq - Patent sequence entries, part 92.
3151. gbpat93.seq - Patent sequence entries, part 93.
3152. gbpat94.seq - Patent sequence entries, part 94.
3153. gbpat95.seq - Patent sequence entries, part 95.
3154. gbpat96.seq - Patent sequence entries, part 96.
3155. gbpat97.seq - Patent sequence entries, part 97.
3156. gbpat98.seq - Patent sequence entries, part 98.
3157. gbpat99.seq - Patent sequence entries, part 99.
3158. gbphg1.seq - Phage sequence entries, part 1.
3159. gbphg2.seq - Phage sequence entries, part 2.
3160. gbphg3.seq - Phage sequence entries, part 3.
3161. gbphg4.seq - Phage sequence entries, part 4.
3162. gbphg5.seq - Phage sequence entries, part 5.
3163. gbphg6.seq - Phage sequence entries, part 6.
3164. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
3165. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
3166. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
3167. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
3168. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
3169. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
3170. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
3171. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
3172. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
3173. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
3174. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
3175. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
3176. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
3177. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
3178. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
3179. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
3180. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
3181. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
3182. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
3183. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
3184. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
3185. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
3186. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
3187. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
3188. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
3189. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
3190. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
3191. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
3192. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
3193. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
3194. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
3195. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
3196. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
3197. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
3198. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
3199. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
3200. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
3201. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
3202. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
3203. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
3204. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
3205. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
3206. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
3207. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
3208. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
3209. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
3210. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
3211. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
3212. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
3213. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
3214. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
3215. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
3216. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
3217. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
3218. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
3219. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
3220. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
3221. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
3222. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
3223. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
3224. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
3225. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
3226. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
3227. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
3228. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
3229. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
3230. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
3231. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
3232. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
3233. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
3234. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
3235. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
3236. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
3237. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
3238. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
3239. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
3240. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
3241. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
3242. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
3243. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
3244. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
3245. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
3246. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
3247. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
3248. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
3249. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
3250. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
3251. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
3252. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
3253. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
3254. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
3255. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
3256. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
3257. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
3258. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
3259. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
3260. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
3261. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
3262. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
3263. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
3264. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
3265. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
3266. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
3267. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
3268. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
3269. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
3270. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
3271. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
3272. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
3273. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
3274. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
3275. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
3276. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
3277. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
3278. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
3279. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
3280. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
3281. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
3282. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
3283. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
3284. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
3285. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
3286. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
3287. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
3288. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
3289. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
3290. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
3291. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
3292. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
3293. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
3294. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
3295. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
3296. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
3297. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
3298. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
3299. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
3300. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
3301. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
3302. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
3303. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
3304. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
3305. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
3306. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
3307. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
3308. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
3309. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
3310. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
3311. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
3312. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
3313. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
3314. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
3315. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
3316. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
3317. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
3318. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
3319. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
3320. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
3321. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
3322. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
3323. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
3324. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
3325. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
3326. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
3327. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
3328. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
3329. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
3330. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
3331. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
3332. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
3333. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
3334. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
3335. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
3336. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
3337. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
3338. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
3339. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
3340. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
3341. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
3342. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
3343. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
3344. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
3345. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
3346. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
3347. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
3348. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
3349. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
3350. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
3351. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
3352. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
3353. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
3354. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
3355. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
3356. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
3357. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
3358. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
3359. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
3360. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
3361. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
3362. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
3363. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
3364. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
3365. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
3366. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
3367. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
3368. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
3369. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
3370. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
3371. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
3372. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
3373. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
3374. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
3375. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
3376. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
3377. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
3378. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
3379. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
3380. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
3381. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
3382. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
3383. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
3384. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
3385. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
3386. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
3387. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
3388. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
3389. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
3390. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
3391. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
3392. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
3393. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
3394. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
3395. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
3396. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
3397. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
3398. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
3399. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
3400. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
3401. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
3402. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
3403. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
3404. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
3405. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
3406. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
3407. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
3408. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
3409. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
3410. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
3411. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
3412. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
3413. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
3414. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
3415. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
3416. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
3417. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
3418. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
3419. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
3420. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
3421. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
3422. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
3423. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
3424. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
3425. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
3426. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
3427. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
3428. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
3429. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
3430. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
3431. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
3432. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
3433. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
3434. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
3435. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
3436. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
3437. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
3438. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
3439. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
3440. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
3441. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
3442. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
3443. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
3444. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
3445. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
3446. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
3447. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
3448. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
3449. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
3450. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
3451. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
3452. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
3453. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
3454. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
3455. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
3456. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
3457. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
3458. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
3459. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
3460. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
3461. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
3462. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
3463. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
3464. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
3465. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
3466. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
3467. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
3468. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
3469. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
3470. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
3471. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
3472. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
3473. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
3474. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
3475. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
3476. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
3477. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
3478. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
3479. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
3480. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
3481. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
3482. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
3483. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
3484. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
3485. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
3486. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
3487. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
3488. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
3489. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
3490. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
3491. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
3492. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
3493. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
3494. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
3495. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
3496. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
3497. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
3498. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
3499. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
3500. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
3501. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
3502. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
3503. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
3504. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
3505. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
3506. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
3507. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
3508. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
3509. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
3510. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
3511. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
3512. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
3513. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
3514. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
3515. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
3516. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
3517. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
3518. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
3519. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
3520. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
3521. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
3522. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
3523. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
3524. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
3525. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
3526. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
3527. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
3528. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
3529. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
3530. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
3531. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
3532. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
3533. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
3534. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
3535. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
3536. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
3537. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
3538. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
3539. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
3540. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
3541. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
3542. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
3543. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
3544. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
3545. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
3546. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
3547. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
3548. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
3549. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
3550. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
3551. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
3552. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
3553. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
3554. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
3555. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
3556. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
3557. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
3558. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
3559. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
3560. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
3561. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
3562. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
3563. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
3564. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
3565. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
3566. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
3567. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
3568. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
3569. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
3570. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
3571. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
3572. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
3573. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
3574. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
3575. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
3576. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
3577. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
3578. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
3579. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
3580. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
3581. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
3582. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
3583. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
3584. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
3585. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
3586. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
3587. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
3588. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
3589. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
3590. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
3591. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
3592. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
3593. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
3594. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
3595. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
3596. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
3597. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
3598. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
3599. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
3600. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
3601. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
3602. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
3603. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
3604. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
3605. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
3606. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
3607. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
3608. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
3609. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
3610. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
3611. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
3612. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
3613. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
3614. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
3615. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
3616. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
3617. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
3618. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
3619. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
3620. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
3621. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
3622. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
3623. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
3624. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
3625. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
3626. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
3627. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
3628. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
3629. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
3630. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
3631. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
3632. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
3633. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
3634. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
3635. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
3636. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
3637. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
3638. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
3639. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
3640. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
3641. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
3642. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
3643. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
3644. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
3645. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
3646. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
3647. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
3648. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
3649. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
3650. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
3651. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
3652. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
3653. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
3654. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
3655. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
3656. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
3657. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
3658. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
3659. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
3660. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
3661. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
3662. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548.
3663. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549.
3664. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
3665. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550.
3666. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551.
3667. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552.
3668. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553.
3669. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554.
3670. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555.
3671. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556.
3672. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557.
3673. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558.
3674. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559.
3675. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
3676. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560.
3677. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561.
3678. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562.
3679. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563.
3680. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564.
3681. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565.
3682. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566.
3683. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567.
3684. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568.
3685. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569.
3686. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
3687. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570.
3688. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571.
3689. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572.
3690. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573.
3691. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574.
3692. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575.
3693. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576.
3694. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577.
3695. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578.
3696. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579.
3697. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
3698. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580.
3699. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581.
3700. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582.
3701. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583.
3702. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584.
3703. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585.
3704. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586.
3705. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587.
3706. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588.
3707. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589.
3708. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
3709. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590.
3710. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591.
3711. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592.
3712. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593.
3713. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594.
3714. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595.
3715. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596.
3716. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597.
3717. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598.
3718. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599.
3719. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
3720. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
3721. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600.
3722. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601.
3723. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602.
3724. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603.
3725. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604.
3726. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605.
3727. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606.
3728. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607.
3729. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608.
3730. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609.
3731. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
3732. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610.
3733. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611.
3734. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612.
3735. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613.
3736. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614.
3737. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615.
3738. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616.
3739. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617.
3740. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618.
3741. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619.
3742. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
3743. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620.
3744. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621.
3745. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622.
3746. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623.
3747. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624.
3748. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625.
3749. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626.
3750. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627.
3751. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628.
3752. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629.
3753. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
3754. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630.
3755. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631.
3756. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632.
3757. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633.
3758. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634.
3759. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635.
3760. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636.
3761. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637.
3762. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638.
3763. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639.
3764. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
3765. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640.
3766. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641.
3767. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642.
3768. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643.
3769. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644.
3770. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645.
3771. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646.
3772. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647.
3773. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648.
3774. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649.
3775. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
3776. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650.
3777. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651.
3778. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652.
3779. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653.
3780. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654.
3781. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655.
3782. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656.
3783. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657.
3784. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658.
3785. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659.
3786. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
3787. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660.
3788. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661.
3789. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662.
3790. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663.
3791. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664.
3792. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665.
3793. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666.
3794. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667.
3795. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668.
3796. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669.
3797. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
3798. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670.
3799. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671.
3800. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672.
3801. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673.
3802. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674.
3803. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675.
3804. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676.
3805. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677.
3806. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678.
3807. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679.
3808. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
3809. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680.
3810. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681.
3811. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682.
3812. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683.
3813. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684.
3814. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685.
3815. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686.
3816. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687.
3817. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688.
3818. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689.
3819. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
3820. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690.
3821. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691.
3822. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692.
3823. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693.
3824. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694.
3825. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695.
3826. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696.
3827. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697.
3828. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698.
3829. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699.
3830. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
3831. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
3832. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700.
3833. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701.
3834. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702.
3835. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703.
3836. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704.
3837. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705.
3838. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706.
3839. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707.
3840. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708.
3841. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709.
3842. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
3843. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710.
3844. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711.
3845. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712.
3846. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713.
3847. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714.
3848. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715.
3849. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716.
3850. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717.
3851. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718.
3852. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719.
3853. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
3854. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720.
3855. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721.
3856. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722.
3857. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723.
3858. gbpln724.seq - Plant sequence entries (including fungi and algae), part 724.
3859. gbpln725.seq - Plant sequence entries (including fungi and algae), part 725.
3860. gbpln726.seq - Plant sequence entries (including fungi and algae), part 726.
3861. gbpln727.seq - Plant sequence entries (including fungi and algae), part 727.
3862. gbpln728.seq - Plant sequence entries (including fungi and algae), part 728.
3863. gbpln729.seq - Plant sequence entries (including fungi and algae), part 729.
3864. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
3865. gbpln730.seq - Plant sequence entries (including fungi and algae), part 730.
3866. gbpln731.seq - Plant sequence entries (including fungi and algae), part 731.
3867. gbpln732.seq - Plant sequence entries (including fungi and algae), part 732.
3868. gbpln733.seq - Plant sequence entries (including fungi and algae), part 733.
3869. gbpln734.seq - Plant sequence entries (including fungi and algae), part 734.
3870. gbpln735.seq - Plant sequence entries (including fungi and algae), part 735.
3871. gbpln736.seq - Plant sequence entries (including fungi and algae), part 736.
3872. gbpln737.seq - Plant sequence entries (including fungi and algae), part 737.
3873. gbpln738.seq - Plant sequence entries (including fungi and algae), part 738.
3874. gbpln739.seq - Plant sequence entries (including fungi and algae), part 739.
3875. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
3876. gbpln740.seq - Plant sequence entries (including fungi and algae), part 740.
3877. gbpln741.seq - Plant sequence entries (including fungi and algae), part 741.
3878. gbpln742.seq - Plant sequence entries (including fungi and algae), part 742.
3879. gbpln743.seq - Plant sequence entries (including fungi and algae), part 743.
3880. gbpln744.seq - Plant sequence entries (including fungi and algae), part 744.
3881. gbpln745.seq - Plant sequence entries (including fungi and algae), part 745.
3882. gbpln746.seq - Plant sequence entries (including fungi and algae), part 746.
3883. gbpln747.seq - Plant sequence entries (including fungi and algae), part 747.
3884. gbpln748.seq - Plant sequence entries (including fungi and algae), part 748.
3885. gbpln749.seq - Plant sequence entries (including fungi and algae), part 749.
3886. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
3887. gbpln750.seq - Plant sequence entries (including fungi and algae), part 750.
3888. gbpln751.seq - Plant sequence entries (including fungi and algae), part 751.
3889. gbpln752.seq - Plant sequence entries (including fungi and algae), part 752.
3890. gbpln753.seq - Plant sequence entries (including fungi and algae), part 753.
3891. gbpln754.seq - Plant sequence entries (including fungi and algae), part 754.
3892. gbpln755.seq - Plant sequence entries (including fungi and algae), part 755.
3893. gbpln756.seq - Plant sequence entries (including fungi and algae), part 756.
3894. gbpln757.seq - Plant sequence entries (including fungi and algae), part 757.
3895. gbpln758.seq - Plant sequence entries (including fungi and algae), part 758.
3896. gbpln759.seq - Plant sequence entries (including fungi and algae), part 759.
3897. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
3898. gbpln760.seq - Plant sequence entries (including fungi and algae), part 760.
3899. gbpln761.seq - Plant sequence entries (including fungi and algae), part 761.
3900. gbpln762.seq - Plant sequence entries (including fungi and algae), part 762.
3901. gbpln763.seq - Plant sequence entries (including fungi and algae), part 763.
3902. gbpln764.seq - Plant sequence entries (including fungi and algae), part 764.
3903. gbpln765.seq - Plant sequence entries (including fungi and algae), part 765.
3904. gbpln766.seq - Plant sequence entries (including fungi and algae), part 766.
3905. gbpln767.seq - Plant sequence entries (including fungi and algae), part 767.
3906. gbpln768.seq - Plant sequence entries (including fungi and algae), part 768.
3907. gbpln769.seq - Plant sequence entries (including fungi and algae), part 769.
3908. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
3909. gbpln770.seq - Plant sequence entries (including fungi and algae), part 770.
3910. gbpln771.seq - Plant sequence entries (including fungi and algae), part 771.
3911. gbpln772.seq - Plant sequence entries (including fungi and algae), part 772.
3912. gbpln773.seq - Plant sequence entries (including fungi and algae), part 773.
3913. gbpln774.seq - Plant sequence entries (including fungi and algae), part 774.
3914. gbpln775.seq - Plant sequence entries (including fungi and algae), part 775.
3915. gbpln776.seq - Plant sequence entries (including fungi and algae), part 776.
3916. gbpln777.seq - Plant sequence entries (including fungi and algae), part 777.
3917. gbpln778.seq - Plant sequence entries (including fungi and algae), part 778.
3918. gbpln779.seq - Plant sequence entries (including fungi and algae), part 779.
3919. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
3920. gbpln780.seq - Plant sequence entries (including fungi and algae), part 780.
3921. gbpln781.seq - Plant sequence entries (including fungi and algae), part 781.
3922. gbpln782.seq - Plant sequence entries (including fungi and algae), part 782.
3923. gbpln783.seq - Plant sequence entries (including fungi and algae), part 783.
3924. gbpln784.seq - Plant sequence entries (including fungi and algae), part 784.
3925. gbpln785.seq - Plant sequence entries (including fungi and algae), part 785.
3926. gbpln786.seq - Plant sequence entries (including fungi and algae), part 786.
3927. gbpln787.seq - Plant sequence entries (including fungi and algae), part 787.
3928. gbpln788.seq - Plant sequence entries (including fungi and algae), part 788.
3929. gbpln789.seq - Plant sequence entries (including fungi and algae), part 789.
3930. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
3931. gbpln790.seq - Plant sequence entries (including fungi and algae), part 790.
3932. gbpln791.seq - Plant sequence entries (including fungi and algae), part 791.
3933. gbpln792.seq - Plant sequence entries (including fungi and algae), part 792.
3934. gbpln793.seq - Plant sequence entries (including fungi and algae), part 793.
3935. gbpln794.seq - Plant sequence entries (including fungi and algae), part 794.
3936. gbpln795.seq - Plant sequence entries (including fungi and algae), part 795.
3937. gbpln796.seq - Plant sequence entries (including fungi and algae), part 796.
3938. gbpln797.seq - Plant sequence entries (including fungi and algae), part 797.
3939. gbpln798.seq - Plant sequence entries (including fungi and algae), part 798.
3940. gbpln799.seq - Plant sequence entries (including fungi and algae), part 799.
3941. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
3942. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
3943. gbpln800.seq - Plant sequence entries (including fungi and algae), part 800.
3944. gbpln801.seq - Plant sequence entries (including fungi and algae), part 801.
3945. gbpln802.seq - Plant sequence entries (including fungi and algae), part 802.
3946. gbpln803.seq - Plant sequence entries (including fungi and algae), part 803.
3947. gbpln804.seq - Plant sequence entries (including fungi and algae), part 804.
3948. gbpln805.seq - Plant sequence entries (including fungi and algae), part 805.
3949. gbpln806.seq - Plant sequence entries (including fungi and algae), part 806.
3950. gbpln807.seq - Plant sequence entries (including fungi and algae), part 807.
3951. gbpln808.seq - Plant sequence entries (including fungi and algae), part 808.
3952. gbpln809.seq - Plant sequence entries (including fungi and algae), part 809.
3953. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
3954. gbpln810.seq - Plant sequence entries (including fungi and algae), part 810.
3955. gbpln811.seq - Plant sequence entries (including fungi and algae), part 811.
3956. gbpln812.seq - Plant sequence entries (including fungi and algae), part 812.
3957. gbpln813.seq - Plant sequence entries (including fungi and algae), part 813.
3958. gbpln814.seq - Plant sequence entries (including fungi and algae), part 814.
3959. gbpln815.seq - Plant sequence entries (including fungi and algae), part 815.
3960. gbpln816.seq - Plant sequence entries (including fungi and algae), part 816.
3961. gbpln817.seq - Plant sequence entries (including fungi and algae), part 817.
3962. gbpln818.seq - Plant sequence entries (including fungi and algae), part 818.
3963. gbpln819.seq - Plant sequence entries (including fungi and algae), part 819.
3964. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
3965. gbpln820.seq - Plant sequence entries (including fungi and algae), part 820.
3966. gbpln821.seq - Plant sequence entries (including fungi and algae), part 821.
3967. gbpln822.seq - Plant sequence entries (including fungi and algae), part 822.
3968. gbpln823.seq - Plant sequence entries (including fungi and algae), part 823.
3969. gbpln824.seq - Plant sequence entries (including fungi and algae), part 824.
3970. gbpln825.seq - Plant sequence entries (including fungi and algae), part 825.
3971. gbpln826.seq - Plant sequence entries (including fungi and algae), part 826.
3972. gbpln827.seq - Plant sequence entries (including fungi and algae), part 827.
3973. gbpln828.seq - Plant sequence entries (including fungi and algae), part 828.
3974. gbpln829.seq - Plant sequence entries (including fungi and algae), part 829.
3975. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
3976. gbpln830.seq - Plant sequence entries (including fungi and algae), part 830.
3977. gbpln831.seq - Plant sequence entries (including fungi and algae), part 831.
3978. gbpln832.seq - Plant sequence entries (including fungi and algae), part 832.
3979. gbpln833.seq - Plant sequence entries (including fungi and algae), part 833.
3980. gbpln834.seq - Plant sequence entries (including fungi and algae), part 834.
3981. gbpln835.seq - Plant sequence entries (including fungi and algae), part 835.
3982. gbpln836.seq - Plant sequence entries (including fungi and algae), part 836.
3983. gbpln837.seq - Plant sequence entries (including fungi and algae), part 837.
3984. gbpln838.seq - Plant sequence entries (including fungi and algae), part 838.
3985. gbpln839.seq - Plant sequence entries (including fungi and algae), part 839.
3986. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
3987. gbpln840.seq - Plant sequence entries (including fungi and algae), part 840.
3988. gbpln841.seq - Plant sequence entries (including fungi and algae), part 841.
3989. gbpln842.seq - Plant sequence entries (including fungi and algae), part 842.
3990. gbpln843.seq - Plant sequence entries (including fungi and algae), part 843.
3991. gbpln844.seq - Plant sequence entries (including fungi and algae), part 844.
3992. gbpln845.seq - Plant sequence entries (including fungi and algae), part 845.
3993. gbpln846.seq - Plant sequence entries (including fungi and algae), part 846.
3994. gbpln847.seq - Plant sequence entries (including fungi and algae), part 847.
3995. gbpln848.seq - Plant sequence entries (including fungi and algae), part 848.
3996. gbpln849.seq - Plant sequence entries (including fungi and algae), part 849.
3997. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
3998. gbpln850.seq - Plant sequence entries (including fungi and algae), part 850.
3999. gbpln851.seq - Plant sequence entries (including fungi and algae), part 851.
4000. gbpln852.seq - Plant sequence entries (including fungi and algae), part 852.
4001. gbpln853.seq - Plant sequence entries (including fungi and algae), part 853.
4002. gbpln854.seq - Plant sequence entries (including fungi and algae), part 854.
4003. gbpln855.seq - Plant sequence entries (including fungi and algae), part 855.
4004. gbpln856.seq - Plant sequence entries (including fungi and algae), part 856.
4005. gbpln857.seq - Plant sequence entries (including fungi and algae), part 857.
4006. gbpln858.seq - Plant sequence entries (including fungi and algae), part 858.
4007. gbpln859.seq - Plant sequence entries (including fungi and algae), part 859.
4008. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
4009. gbpln860.seq - Plant sequence entries (including fungi and algae), part 860.
4010. gbpln861.seq - Plant sequence entries (including fungi and algae), part 861.
4011. gbpln862.seq - Plant sequence entries (including fungi and algae), part 862.
4012. gbpln863.seq - Plant sequence entries (including fungi and algae), part 863.
4013. gbpln864.seq - Plant sequence entries (including fungi and algae), part 864.
4014. gbpln865.seq - Plant sequence entries (including fungi and algae), part 865.
4015. gbpln866.seq - Plant sequence entries (including fungi and algae), part 866.
4016. gbpln867.seq - Plant sequence entries (including fungi and algae), part 867.
4017. gbpln868.seq - Plant sequence entries (including fungi and algae), part 868.
4018. gbpln869.seq - Plant sequence entries (including fungi and algae), part 869.
4019. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
4020. gbpln870.seq - Plant sequence entries (including fungi and algae), part 870.
4021. gbpln871.seq - Plant sequence entries (including fungi and algae), part 871.
4022. gbpln872.seq - Plant sequence entries (including fungi and algae), part 872.
4023. gbpln873.seq - Plant sequence entries (including fungi and algae), part 873.
4024. gbpln874.seq - Plant sequence entries (including fungi and algae), part 874.
4025. gbpln875.seq - Plant sequence entries (including fungi and algae), part 875.
4026. gbpln876.seq - Plant sequence entries (including fungi and algae), part 876.
4027. gbpln877.seq - Plant sequence entries (including fungi and algae), part 877.
4028. gbpln878.seq - Plant sequence entries (including fungi and algae), part 878.
4029. gbpln879.seq - Plant sequence entries (including fungi and algae), part 879.
4030. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
4031. gbpln880.seq - Plant sequence entries (including fungi and algae), part 880.
4032. gbpln881.seq - Plant sequence entries (including fungi and algae), part 881.
4033. gbpln882.seq - Plant sequence entries (including fungi and algae), part 882.
4034. gbpln883.seq - Plant sequence entries (including fungi and algae), part 883.
4035. gbpln884.seq - Plant sequence entries (including fungi and algae), part 884.
4036. gbpln885.seq - Plant sequence entries (including fungi and algae), part 885.
4037. gbpln886.seq - Plant sequence entries (including fungi and algae), part 886.
4038. gbpln887.seq - Plant sequence entries (including fungi and algae), part 887.
4039. gbpln888.seq - Plant sequence entries (including fungi and algae), part 888.
4040. gbpln889.seq - Plant sequence entries (including fungi and algae), part 889.
4041. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
4042. gbpln890.seq - Plant sequence entries (including fungi and algae), part 890.
4043. gbpln891.seq - Plant sequence entries (including fungi and algae), part 891.
4044. gbpln892.seq - Plant sequence entries (including fungi and algae), part 892.
4045. gbpln893.seq - Plant sequence entries (including fungi and algae), part 893.
4046. gbpln894.seq - Plant sequence entries (including fungi and algae), part 894.
4047. gbpln895.seq - Plant sequence entries (including fungi and algae), part 895.
4048. gbpln896.seq - Plant sequence entries (including fungi and algae), part 896.
4049. gbpln897.seq - Plant sequence entries (including fungi and algae), part 897.
4050. gbpln898.seq - Plant sequence entries (including fungi and algae), part 898.
4051. gbpln899.seq - Plant sequence entries (including fungi and algae), part 899.
4052. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
4053. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
4054. gbpln900.seq - Plant sequence entries (including fungi and algae), part 900.
4055. gbpln901.seq - Plant sequence entries (including fungi and algae), part 901.
4056. gbpln902.seq - Plant sequence entries (including fungi and algae), part 902.
4057. gbpln903.seq - Plant sequence entries (including fungi and algae), part 903.
4058. gbpln904.seq - Plant sequence entries (including fungi and algae), part 904.
4059. gbpln905.seq - Plant sequence entries (including fungi and algae), part 905.
4060. gbpln906.seq - Plant sequence entries (including fungi and algae), part 906.
4061. gbpln907.seq - Plant sequence entries (including fungi and algae), part 907.
4062. gbpln908.seq - Plant sequence entries (including fungi and algae), part 908.
4063. gbpln909.seq - Plant sequence entries (including fungi and algae), part 909.
4064. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
4065. gbpln910.seq - Plant sequence entries (including fungi and algae), part 910.
4066. gbpln911.seq - Plant sequence entries (including fungi and algae), part 911.
4067. gbpln912.seq - Plant sequence entries (including fungi and algae), part 912.
4068. gbpln913.seq - Plant sequence entries (including fungi and algae), part 913.
4069. gbpln914.seq - Plant sequence entries (including fungi and algae), part 914.
4070. gbpln915.seq - Plant sequence entries (including fungi and algae), part 915.
4071. gbpln916.seq - Plant sequence entries (including fungi and algae), part 916.
4072. gbpln917.seq - Plant sequence entries (including fungi and algae), part 917.
4073. gbpln918.seq - Plant sequence entries (including fungi and algae), part 918.
4074. gbpln919.seq - Plant sequence entries (including fungi and algae), part 919.
4075. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
4076. gbpln920.seq - Plant sequence entries (including fungi and algae), part 920.
4077. gbpln921.seq - Plant sequence entries (including fungi and algae), part 921.
4078. gbpln922.seq - Plant sequence entries (including fungi and algae), part 922.
4079. gbpln923.seq - Plant sequence entries (including fungi and algae), part 923.
4080. gbpln924.seq - Plant sequence entries (including fungi and algae), part 924.
4081. gbpln925.seq - Plant sequence entries (including fungi and algae), part 925.
4082. gbpln926.seq - Plant sequence entries (including fungi and algae), part 926.
4083. gbpln927.seq - Plant sequence entries (including fungi and algae), part 927.
4084. gbpln928.seq - Plant sequence entries (including fungi and algae), part 928.
4085. gbpln929.seq - Plant sequence entries (including fungi and algae), part 929.
4086. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
4087. gbpln930.seq - Plant sequence entries (including fungi and algae), part 930.
4088. gbpln931.seq - Plant sequence entries (including fungi and algae), part 931.
4089. gbpln932.seq - Plant sequence entries (including fungi and algae), part 932.
4090. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
4091. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
4092. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
4093. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
4094. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
4095. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
4096. gbpri1.seq - Primate sequence entries, part 1.
4097. gbpri10.seq - Primate sequence entries, part 10.
4098. gbpri11.seq - Primate sequence entries, part 11.
4099. gbpri12.seq - Primate sequence entries, part 12.
4100. gbpri13.seq - Primate sequence entries, part 13.
4101. gbpri14.seq - Primate sequence entries, part 14.
4102. gbpri15.seq - Primate sequence entries, part 15.
4103. gbpri16.seq - Primate sequence entries, part 16.
4104. gbpri17.seq - Primate sequence entries, part 17.
4105. gbpri18.seq - Primate sequence entries, part 18.
4106. gbpri19.seq - Primate sequence entries, part 19.
4107. gbpri2.seq - Primate sequence entries, part 2.
4108. gbpri20.seq - Primate sequence entries, part 20.
4109. gbpri21.seq - Primate sequence entries, part 21.
4110. gbpri22.seq - Primate sequence entries, part 22.
4111. gbpri23.seq - Primate sequence entries, part 23.
4112. gbpri24.seq - Primate sequence entries, part 24.
4113. gbpri25.seq - Primate sequence entries, part 25.
4114. gbpri26.seq - Primate sequence entries, part 26.
4115. gbpri27.seq - Primate sequence entries, part 27.
4116. gbpri28.seq - Primate sequence entries, part 28.
4117. gbpri29.seq - Primate sequence entries, part 29.
4118. gbpri3.seq - Primate sequence entries, part 3.
4119. gbpri30.seq - Primate sequence entries, part 30.
4120. gbpri31.seq - Primate sequence entries, part 31.
4121. gbpri32.seq - Primate sequence entries, part 32.
4122. gbpri33.seq - Primate sequence entries, part 33.
4123. gbpri34.seq - Primate sequence entries, part 34.
4124. gbpri35.seq - Primate sequence entries, part 35.
4125. gbpri36.seq - Primate sequence entries, part 36.
4126. gbpri37.seq - Primate sequence entries, part 37.
4127. gbpri38.seq - Primate sequence entries, part 38.
4128. gbpri39.seq - Primate sequence entries, part 39.
4129. gbpri4.seq - Primate sequence entries, part 4.
4130. gbpri40.seq - Primate sequence entries, part 40.
4131. gbpri41.seq - Primate sequence entries, part 41.
4132. gbpri42.seq - Primate sequence entries, part 42.
4133. gbpri43.seq - Primate sequence entries, part 43.
4134. gbpri44.seq - Primate sequence entries, part 44.
4135. gbpri45.seq - Primate sequence entries, part 45.
4136. gbpri46.seq - Primate sequence entries, part 46.
4137. gbpri47.seq - Primate sequence entries, part 47.
4138. gbpri48.seq - Primate sequence entries, part 48.
4139. gbpri49.seq - Primate sequence entries, part 49.
4140. gbpri5.seq - Primate sequence entries, part 5.
4141. gbpri50.seq - Primate sequence entries, part 50.
4142. gbpri51.seq - Primate sequence entries, part 51.
4143. gbpri52.seq - Primate sequence entries, part 52.
4144. gbpri53.seq - Primate sequence entries, part 53.
4145. gbpri54.seq - Primate sequence entries, part 54.
4146. gbpri55.seq - Primate sequence entries, part 55.
4147. gbpri56.seq - Primate sequence entries, part 56.
4148. gbpri57.seq - Primate sequence entries, part 57.
4149. gbpri6.seq - Primate sequence entries, part 6.
4150. gbpri7.seq - Primate sequence entries, part 7.
4151. gbpri8.seq - Primate sequence entries, part 8.
4152. gbpri9.seq - Primate sequence entries, part 9.
4153. gbrel.txt - Release notes (this document).
4154. gbrod1.seq - Rodent sequence entries, part 1.
4155. gbrod10.seq - Rodent sequence entries, part 10.
4156. gbrod100.seq - Rodent sequence entries, part 100.
4157. gbrod101.seq - Rodent sequence entries, part 101.
4158. gbrod102.seq - Rodent sequence entries, part 102.
4159. gbrod103.seq - Rodent sequence entries, part 103.
4160. gbrod104.seq - Rodent sequence entries, part 104.
4161. gbrod105.seq - Rodent sequence entries, part 105.
4162. gbrod106.seq - Rodent sequence entries, part 106.
4163. gbrod107.seq - Rodent sequence entries, part 107.
4164. gbrod108.seq - Rodent sequence entries, part 108.
4165. gbrod109.seq - Rodent sequence entries, part 109.
4166. gbrod11.seq - Rodent sequence entries, part 11.
4167. gbrod110.seq - Rodent sequence entries, part 110.
4168. gbrod111.seq - Rodent sequence entries, part 111.
4169. gbrod112.seq - Rodent sequence entries, part 112.
4170. gbrod113.seq - Rodent sequence entries, part 113.
4171. gbrod114.seq - Rodent sequence entries, part 114.
4172. gbrod115.seq - Rodent sequence entries, part 115.
4173. gbrod116.seq - Rodent sequence entries, part 116.
4174. gbrod117.seq - Rodent sequence entries, part 117.
4175. gbrod118.seq - Rodent sequence entries, part 118.
4176. gbrod119.seq - Rodent sequence entries, part 119.
4177. gbrod12.seq - Rodent sequence entries, part 12.
4178. gbrod120.seq - Rodent sequence entries, part 120.
4179. gbrod121.seq - Rodent sequence entries, part 121.
4180. gbrod122.seq - Rodent sequence entries, part 122.
4181. gbrod123.seq - Rodent sequence entries, part 123.
4182. gbrod124.seq - Rodent sequence entries, part 124.
4183. gbrod125.seq - Rodent sequence entries, part 125.
4184. gbrod126.seq - Rodent sequence entries, part 126.
4185. gbrod127.seq - Rodent sequence entries, part 127.
4186. gbrod128.seq - Rodent sequence entries, part 128.
4187. gbrod129.seq - Rodent sequence entries, part 129.
4188. gbrod13.seq - Rodent sequence entries, part 13.
4189. gbrod130.seq - Rodent sequence entries, part 130.
4190. gbrod131.seq - Rodent sequence entries, part 131.
4191. gbrod132.seq - Rodent sequence entries, part 132.
4192. gbrod133.seq - Rodent sequence entries, part 133.
4193. gbrod134.seq - Rodent sequence entries, part 134.
4194. gbrod135.seq - Rodent sequence entries, part 135.
4195. gbrod136.seq - Rodent sequence entries, part 136.
4196. gbrod137.seq - Rodent sequence entries, part 137.
4197. gbrod138.seq - Rodent sequence entries, part 138.
4198. gbrod139.seq - Rodent sequence entries, part 139.
4199. gbrod14.seq - Rodent sequence entries, part 14.
4200. gbrod140.seq - Rodent sequence entries, part 140.
4201. gbrod141.seq - Rodent sequence entries, part 141.
4202. gbrod142.seq - Rodent sequence entries, part 142.
4203. gbrod143.seq - Rodent sequence entries, part 143.
4204. gbrod144.seq - Rodent sequence entries, part 144.
4205. gbrod145.seq - Rodent sequence entries, part 145.
4206. gbrod146.seq - Rodent sequence entries, part 146.
4207. gbrod147.seq - Rodent sequence entries, part 147.
4208. gbrod148.seq - Rodent sequence entries, part 148.
4209. gbrod149.seq - Rodent sequence entries, part 149.
4210. gbrod15.seq - Rodent sequence entries, part 15.
4211. gbrod150.seq - Rodent sequence entries, part 150.
4212. gbrod151.seq - Rodent sequence entries, part 151.
4213. gbrod152.seq - Rodent sequence entries, part 152.
4214. gbrod153.seq - Rodent sequence entries, part 153.
4215. gbrod154.seq - Rodent sequence entries, part 154.
4216. gbrod155.seq - Rodent sequence entries, part 155.
4217. gbrod156.seq - Rodent sequence entries, part 156.
4218. gbrod157.seq - Rodent sequence entries, part 157.
4219. gbrod158.seq - Rodent sequence entries, part 158.
4220. gbrod159.seq - Rodent sequence entries, part 159.
4221. gbrod16.seq - Rodent sequence entries, part 16.
4222. gbrod160.seq - Rodent sequence entries, part 160.
4223. gbrod161.seq - Rodent sequence entries, part 161.
4224. gbrod162.seq - Rodent sequence entries, part 162.
4225. gbrod163.seq - Rodent sequence entries, part 163.
4226. gbrod164.seq - Rodent sequence entries, part 164.
4227. gbrod165.seq - Rodent sequence entries, part 165.
4228. gbrod166.seq - Rodent sequence entries, part 166.
4229. gbrod167.seq - Rodent sequence entries, part 167.
4230. gbrod168.seq - Rodent sequence entries, part 168.
4231. gbrod169.seq - Rodent sequence entries, part 169.
4232. gbrod17.seq - Rodent sequence entries, part 17.
4233. gbrod170.seq - Rodent sequence entries, part 170.
4234. gbrod171.seq - Rodent sequence entries, part 171.
4235. gbrod172.seq - Rodent sequence entries, part 172.
4236. gbrod173.seq - Rodent sequence entries, part 173.
4237. gbrod174.seq - Rodent sequence entries, part 174.
4238. gbrod175.seq - Rodent sequence entries, part 175.
4239. gbrod176.seq - Rodent sequence entries, part 176.
4240. gbrod177.seq - Rodent sequence entries, part 177.
4241. gbrod178.seq - Rodent sequence entries, part 178.
4242. gbrod179.seq - Rodent sequence entries, part 179.
4243. gbrod18.seq - Rodent sequence entries, part 18.
4244. gbrod180.seq - Rodent sequence entries, part 180.
4245. gbrod181.seq - Rodent sequence entries, part 181.
4246. gbrod182.seq - Rodent sequence entries, part 182.
4247. gbrod183.seq - Rodent sequence entries, part 183.
4248. gbrod184.seq - Rodent sequence entries, part 184.
4249. gbrod185.seq - Rodent sequence entries, part 185.
4250. gbrod186.seq - Rodent sequence entries, part 186.
4251. gbrod187.seq - Rodent sequence entries, part 187.
4252. gbrod188.seq - Rodent sequence entries, part 188.
4253. gbrod189.seq - Rodent sequence entries, part 189.
4254. gbrod19.seq - Rodent sequence entries, part 19.
4255. gbrod190.seq - Rodent sequence entries, part 190.
4256. gbrod2.seq - Rodent sequence entries, part 2.
4257. gbrod20.seq - Rodent sequence entries, part 20.
4258. gbrod21.seq - Rodent sequence entries, part 21.
4259. gbrod22.seq - Rodent sequence entries, part 22.
4260. gbrod23.seq - Rodent sequence entries, part 23.
4261. gbrod24.seq - Rodent sequence entries, part 24.
4262. gbrod25.seq - Rodent sequence entries, part 25.
4263. gbrod26.seq - Rodent sequence entries, part 26.
4264. gbrod27.seq - Rodent sequence entries, part 27.
4265. gbrod28.seq - Rodent sequence entries, part 28.
4266. gbrod29.seq - Rodent sequence entries, part 29.
4267. gbrod3.seq - Rodent sequence entries, part 3.
4268. gbrod30.seq - Rodent sequence entries, part 30.
4269. gbrod31.seq - Rodent sequence entries, part 31.
4270. gbrod32.seq - Rodent sequence entries, part 32.
4271. gbrod33.seq - Rodent sequence entries, part 33.
4272. gbrod34.seq - Rodent sequence entries, part 34.
4273. gbrod35.seq - Rodent sequence entries, part 35.
4274. gbrod36.seq - Rodent sequence entries, part 36.
4275. gbrod37.seq - Rodent sequence entries, part 37.
4276. gbrod38.seq - Rodent sequence entries, part 38.
4277. gbrod39.seq - Rodent sequence entries, part 39.
4278. gbrod4.seq - Rodent sequence entries, part 4.
4279. gbrod40.seq - Rodent sequence entries, part 40.
4280. gbrod41.seq - Rodent sequence entries, part 41.
4281. gbrod42.seq - Rodent sequence entries, part 42.
4282. gbrod43.seq - Rodent sequence entries, part 43.
4283. gbrod44.seq - Rodent sequence entries, part 44.
4284. gbrod45.seq - Rodent sequence entries, part 45.
4285. gbrod46.seq - Rodent sequence entries, part 46.
4286. gbrod47.seq - Rodent sequence entries, part 47.
4287. gbrod48.seq - Rodent sequence entries, part 48.
4288. gbrod49.seq - Rodent sequence entries, part 49.
4289. gbrod5.seq - Rodent sequence entries, part 5.
4290. gbrod50.seq - Rodent sequence entries, part 50.
4291. gbrod51.seq - Rodent sequence entries, part 51.
4292. gbrod52.seq - Rodent sequence entries, part 52.
4293. gbrod53.seq - Rodent sequence entries, part 53.
4294. gbrod54.seq - Rodent sequence entries, part 54.
4295. gbrod55.seq - Rodent sequence entries, part 55.
4296. gbrod56.seq - Rodent sequence entries, part 56.
4297. gbrod57.seq - Rodent sequence entries, part 57.
4298. gbrod58.seq - Rodent sequence entries, part 58.
4299. gbrod59.seq - Rodent sequence entries, part 59.
4300. gbrod6.seq - Rodent sequence entries, part 6.
4301. gbrod60.seq - Rodent sequence entries, part 60.
4302. gbrod61.seq - Rodent sequence entries, part 61.
4303. gbrod62.seq - Rodent sequence entries, part 62.
4304. gbrod63.seq - Rodent sequence entries, part 63.
4305. gbrod64.seq - Rodent sequence entries, part 64.
4306. gbrod65.seq - Rodent sequence entries, part 65.
4307. gbrod66.seq - Rodent sequence entries, part 66.
4308. gbrod67.seq - Rodent sequence entries, part 67.
4309. gbrod68.seq - Rodent sequence entries, part 68.
4310. gbrod69.seq - Rodent sequence entries, part 69.
4311. gbrod7.seq - Rodent sequence entries, part 7.
4312. gbrod70.seq - Rodent sequence entries, part 70.
4313. gbrod71.seq - Rodent sequence entries, part 71.
4314. gbrod72.seq - Rodent sequence entries, part 72.
4315. gbrod73.seq - Rodent sequence entries, part 73.
4316. gbrod74.seq - Rodent sequence entries, part 74.
4317. gbrod75.seq - Rodent sequence entries, part 75.
4318. gbrod76.seq - Rodent sequence entries, part 76.
4319. gbrod77.seq - Rodent sequence entries, part 77.
4320. gbrod78.seq - Rodent sequence entries, part 78.
4321. gbrod79.seq - Rodent sequence entries, part 79.
4322. gbrod8.seq - Rodent sequence entries, part 8.
4323. gbrod80.seq - Rodent sequence entries, part 80.
4324. gbrod81.seq - Rodent sequence entries, part 81.
4325. gbrod82.seq - Rodent sequence entries, part 82.
4326. gbrod83.seq - Rodent sequence entries, part 83.
4327. gbrod84.seq - Rodent sequence entries, part 84.
4328. gbrod85.seq - Rodent sequence entries, part 85.
4329. gbrod86.seq - Rodent sequence entries, part 86.
4330. gbrod87.seq - Rodent sequence entries, part 87.
4331. gbrod88.seq - Rodent sequence entries, part 88.
4332. gbrod89.seq - Rodent sequence entries, part 89.
4333. gbrod9.seq - Rodent sequence entries, part 9.
4334. gbrod90.seq - Rodent sequence entries, part 90.
4335. gbrod91.seq - Rodent sequence entries, part 91.
4336. gbrod92.seq - Rodent sequence entries, part 92.
4337. gbrod93.seq - Rodent sequence entries, part 93.
4338. gbrod94.seq - Rodent sequence entries, part 94.
4339. gbrod95.seq - Rodent sequence entries, part 95.
4340. gbrod96.seq - Rodent sequence entries, part 96.
4341. gbrod97.seq - Rodent sequence entries, part 97.
4342. gbrod98.seq - Rodent sequence entries, part 98.
4343. gbrod99.seq - Rodent sequence entries, part 99.
4344. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
4345. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
4346. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
4347. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
4348. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
4349. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
4350. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
4351. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
4352. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
4353. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
4354. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
4355. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
4356. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
4357. gbsyn11.seq - Synthetic and chimeric sequence entries, part 11.
4358. gbsyn12.seq - Synthetic and chimeric sequence entries, part 12.
4359. gbsyn13.seq - Synthetic and chimeric sequence entries, part 13.
4360. gbsyn14.seq - Synthetic and chimeric sequence entries, part 14.
4361. gbsyn15.seq - Synthetic and chimeric sequence entries, part 15.
4362. gbsyn16.seq - Synthetic and chimeric sequence entries, part 16.
4363. gbsyn17.seq - Synthetic and chimeric sequence entries, part 17.
4364. gbsyn18.seq - Synthetic and chimeric sequence entries, part 18.
4365. gbsyn19.seq - Synthetic and chimeric sequence entries, part 19.
4366. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
4367. gbsyn20.seq - Synthetic and chimeric sequence entries, part 20.
4368. gbsyn21.seq - Synthetic and chimeric sequence entries, part 21.
4369. gbsyn22.seq - Synthetic and chimeric sequence entries, part 22.
4370. gbsyn23.seq - Synthetic and chimeric sequence entries, part 23.
4371. gbsyn24.seq - Synthetic and chimeric sequence entries, part 24.
4372. gbsyn25.seq - Synthetic and chimeric sequence entries, part 25.
4373. gbsyn26.seq - Synthetic and chimeric sequence entries, part 26.
4374. gbsyn27.seq - Synthetic and chimeric sequence entries, part 27.
4375. gbsyn28.seq - Synthetic and chimeric sequence entries, part 28.
4376. gbsyn29.seq - Synthetic and chimeric sequence entries, part 29.
4377. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
4378. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
4379. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
4380. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
4381. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
4382. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
4383. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
4384. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
4385. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
4386. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
4387. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
4388. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
4389. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
4390. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
4391. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
4392. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
4393. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
4394. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
4395. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
4396. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
4397. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
4398. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
4399. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
4400. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
4401. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
4402. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
4403. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
4404. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
4405. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
4406. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
4407. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
4408. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
4409. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
4410. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
4411. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
4412. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
4413. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
4414. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
4415. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
4416. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
4417. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
4418. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
4419. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
4420. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
4421. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
4422. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
4423. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
4424. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
4425. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
4426. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
4427. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
4428. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
4429. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
4430. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
4431. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
4432. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
4433. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
4434. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
4435. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
4436. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
4437. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
4438. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
4439. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
4440. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
4441. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
4442. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
4443. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
4444. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
4445. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
4446. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
4447. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
4448. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
4449. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
4450. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
4451. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
4452. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
4453. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
4454. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
4455. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
4456. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
4457. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
4458. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
4459. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
4460. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
4461. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
4462. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
4463. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
4464. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
4465. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
4466. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
4467. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
4468. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
4469. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
4470. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
4471. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
4472. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
4473. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
4474. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
4475. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
4476. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
4477. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
4478. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
4479. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
4480. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
4481. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
4482. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
4483. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
4484. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
4485. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
4486. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
4487. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
4488. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
4489. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
4490. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
4491. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
4492. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
4493. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
4494. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
4495. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
4496. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
4497. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
4498. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
4499. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
4500. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
4501. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
4502. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
4503. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
4504. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
4505. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
4506. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
4507. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
4508. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
4509. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
4510. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
4511. gbuna1.seq - Unannotated sequence entries, part 1.
4512. gbvrl1.seq - Viral sequence entries, part 1.
4513. gbvrl10.seq - Viral sequence entries, part 10.
4514. gbvrl100.seq - Viral sequence entries, part 100.
4515. gbvrl101.seq - Viral sequence entries, part 101.
4516. gbvrl102.seq - Viral sequence entries, part 102.
4517. gbvrl103.seq - Viral sequence entries, part 103.
4518. gbvrl104.seq - Viral sequence entries, part 104.
4519. gbvrl105.seq - Viral sequence entries, part 105.
4520. gbvrl106.seq - Viral sequence entries, part 106.
4521. gbvrl107.seq - Viral sequence entries, part 107.
4522. gbvrl108.seq - Viral sequence entries, part 108.
4523. gbvrl109.seq - Viral sequence entries, part 109.
4524. gbvrl11.seq - Viral sequence entries, part 11.
4525. gbvrl110.seq - Viral sequence entries, part 110.
4526. gbvrl111.seq - Viral sequence entries, part 111.
4527. gbvrl112.seq - Viral sequence entries, part 112.
4528. gbvrl113.seq - Viral sequence entries, part 113.
4529. gbvrl114.seq - Viral sequence entries, part 114.
4530. gbvrl115.seq - Viral sequence entries, part 115.
4531. gbvrl116.seq - Viral sequence entries, part 116.
4532. gbvrl117.seq - Viral sequence entries, part 117.
4533. gbvrl118.seq - Viral sequence entries, part 118.
4534. gbvrl119.seq - Viral sequence entries, part 119.
4535. gbvrl12.seq - Viral sequence entries, part 12.
4536. gbvrl120.seq - Viral sequence entries, part 120.
4537. gbvrl121.seq - Viral sequence entries, part 121.
4538. gbvrl122.seq - Viral sequence entries, part 122.
4539. gbvrl123.seq - Viral sequence entries, part 123.
4540. gbvrl124.seq - Viral sequence entries, part 124.
4541. gbvrl125.seq - Viral sequence entries, part 125.
4542. gbvrl126.seq - Viral sequence entries, part 126.
4543. gbvrl127.seq - Viral sequence entries, part 127.
4544. gbvrl128.seq - Viral sequence entries, part 128.
4545. gbvrl129.seq - Viral sequence entries, part 129.
4546. gbvrl13.seq - Viral sequence entries, part 13.
4547. gbvrl130.seq - Viral sequence entries, part 130.
4548. gbvrl131.seq - Viral sequence entries, part 131.
4549. gbvrl132.seq - Viral sequence entries, part 132.
4550. gbvrl133.seq - Viral sequence entries, part 133.
4551. gbvrl134.seq - Viral sequence entries, part 134.
4552. gbvrl135.seq - Viral sequence entries, part 135.
4553. gbvrl136.seq - Viral sequence entries, part 136.
4554. gbvrl137.seq - Viral sequence entries, part 137.
4555. gbvrl138.seq - Viral sequence entries, part 138.
4556. gbvrl139.seq - Viral sequence entries, part 139.
4557. gbvrl14.seq - Viral sequence entries, part 14.
4558. gbvrl140.seq - Viral sequence entries, part 140.
4559. gbvrl141.seq - Viral sequence entries, part 141.
4560. gbvrl142.seq - Viral sequence entries, part 142.
4561. gbvrl143.seq - Viral sequence entries, part 143.
4562. gbvrl144.seq - Viral sequence entries, part 144.
4563. gbvrl145.seq - Viral sequence entries, part 145.
4564. gbvrl146.seq - Viral sequence entries, part 146.
4565. gbvrl147.seq - Viral sequence entries, part 147.
4566. gbvrl148.seq - Viral sequence entries, part 148.
4567. gbvrl149.seq - Viral sequence entries, part 149.
4568. gbvrl15.seq - Viral sequence entries, part 15.
4569. gbvrl150.seq - Viral sequence entries, part 150.
4570. gbvrl151.seq - Viral sequence entries, part 151.
4571. gbvrl152.seq - Viral sequence entries, part 152.
4572. gbvrl153.seq - Viral sequence entries, part 153.
4573. gbvrl154.seq - Viral sequence entries, part 154.
4574. gbvrl155.seq - Viral sequence entries, part 155.
4575. gbvrl156.seq - Viral sequence entries, part 156.
4576. gbvrl157.seq - Viral sequence entries, part 157.
4577. gbvrl158.seq - Viral sequence entries, part 158.
4578. gbvrl159.seq - Viral sequence entries, part 159.
4579. gbvrl16.seq - Viral sequence entries, part 16.
4580. gbvrl160.seq - Viral sequence entries, part 160.
4581. gbvrl161.seq - Viral sequence entries, part 161.
4582. gbvrl162.seq - Viral sequence entries, part 162.
4583. gbvrl163.seq - Viral sequence entries, part 163.
4584. gbvrl164.seq - Viral sequence entries, part 164.
4585. gbvrl165.seq - Viral sequence entries, part 165.
4586. gbvrl166.seq - Viral sequence entries, part 166.
4587. gbvrl167.seq - Viral sequence entries, part 167.
4588. gbvrl168.seq - Viral sequence entries, part 168.
4589. gbvrl169.seq - Viral sequence entries, part 169.
4590. gbvrl17.seq - Viral sequence entries, part 17.
4591. gbvrl170.seq - Viral sequence entries, part 170.
4592. gbvrl171.seq - Viral sequence entries, part 171.
4593. gbvrl172.seq - Viral sequence entries, part 172.
4594. gbvrl173.seq - Viral sequence entries, part 173.
4595. gbvrl174.seq - Viral sequence entries, part 174.
4596. gbvrl175.seq - Viral sequence entries, part 175.
4597. gbvrl176.seq - Viral sequence entries, part 176.
4598. gbvrl177.seq - Viral sequence entries, part 177.
4599. gbvrl178.seq - Viral sequence entries, part 178.
4600. gbvrl179.seq - Viral sequence entries, part 179.
4601. gbvrl18.seq - Viral sequence entries, part 18.
4602. gbvrl180.seq - Viral sequence entries, part 180.
4603. gbvrl181.seq - Viral sequence entries, part 181.
4604. gbvrl182.seq - Viral sequence entries, part 182.
4605. gbvrl183.seq - Viral sequence entries, part 183.
4606. gbvrl184.seq - Viral sequence entries, part 184.
4607. gbvrl185.seq - Viral sequence entries, part 185.
4608. gbvrl186.seq - Viral sequence entries, part 186.
4609. gbvrl187.seq - Viral sequence entries, part 187.
4610. gbvrl188.seq - Viral sequence entries, part 188.
4611. gbvrl189.seq - Viral sequence entries, part 189.
4612. gbvrl19.seq - Viral sequence entries, part 19.
4613. gbvrl190.seq - Viral sequence entries, part 190.
4614. gbvrl191.seq - Viral sequence entries, part 191.
4615. gbvrl192.seq - Viral sequence entries, part 192.
4616. gbvrl193.seq - Viral sequence entries, part 193.
4617. gbvrl194.seq - Viral sequence entries, part 194.
4618. gbvrl195.seq - Viral sequence entries, part 195.
4619. gbvrl196.seq - Viral sequence entries, part 196.
4620. gbvrl197.seq - Viral sequence entries, part 197.
4621. gbvrl198.seq - Viral sequence entries, part 198.
4622. gbvrl199.seq - Viral sequence entries, part 199.
4623. gbvrl2.seq - Viral sequence entries, part 2.
4624. gbvrl20.seq - Viral sequence entries, part 20.
4625. gbvrl200.seq - Viral sequence entries, part 200.
4626. gbvrl201.seq - Viral sequence entries, part 201.
4627. gbvrl202.seq - Viral sequence entries, part 202.
4628. gbvrl203.seq - Viral sequence entries, part 203.
4629. gbvrl204.seq - Viral sequence entries, part 204.
4630. gbvrl205.seq - Viral sequence entries, part 205.
4631. gbvrl206.seq - Viral sequence entries, part 206.
4632. gbvrl207.seq - Viral sequence entries, part 207.
4633. gbvrl208.seq - Viral sequence entries, part 208.
4634. gbvrl209.seq - Viral sequence entries, part 209.
4635. gbvrl21.seq - Viral sequence entries, part 21.
4636. gbvrl210.seq - Viral sequence entries, part 210.
4637. gbvrl211.seq - Viral sequence entries, part 211.
4638. gbvrl212.seq - Viral sequence entries, part 212.
4639. gbvrl213.seq - Viral sequence entries, part 213.
4640. gbvrl214.seq - Viral sequence entries, part 214.
4641. gbvrl215.seq - Viral sequence entries, part 215.
4642. gbvrl216.seq - Viral sequence entries, part 216.
4643. gbvrl217.seq - Viral sequence entries, part 217.
4644. gbvrl218.seq - Viral sequence entries, part 218.
4645. gbvrl219.seq - Viral sequence entries, part 219.
4646. gbvrl22.seq - Viral sequence entries, part 22.
4647. gbvrl220.seq - Viral sequence entries, part 220.
4648. gbvrl221.seq - Viral sequence entries, part 221.
4649. gbvrl222.seq - Viral sequence entries, part 222.
4650. gbvrl223.seq - Viral sequence entries, part 223.
4651. gbvrl224.seq - Viral sequence entries, part 224.
4652. gbvrl225.seq - Viral sequence entries, part 225.
4653. gbvrl226.seq - Viral sequence entries, part 226.
4654. gbvrl227.seq - Viral sequence entries, part 227.
4655. gbvrl228.seq - Viral sequence entries, part 228.
4656. gbvrl229.seq - Viral sequence entries, part 229.
4657. gbvrl23.seq - Viral sequence entries, part 23.
4658. gbvrl230.seq - Viral sequence entries, part 230.
4659. gbvrl231.seq - Viral sequence entries, part 231.
4660. gbvrl232.seq - Viral sequence entries, part 232.
4661. gbvrl233.seq - Viral sequence entries, part 233.
4662. gbvrl234.seq - Viral sequence entries, part 234.
4663. gbvrl235.seq - Viral sequence entries, part 235.
4664. gbvrl236.seq - Viral sequence entries, part 236.
4665. gbvrl237.seq - Viral sequence entries, part 237.
4666. gbvrl238.seq - Viral sequence entries, part 238.
4667. gbvrl239.seq - Viral sequence entries, part 239.
4668. gbvrl24.seq - Viral sequence entries, part 24.
4669. gbvrl240.seq - Viral sequence entries, part 240.
4670. gbvrl241.seq - Viral sequence entries, part 241.
4671. gbvrl242.seq - Viral sequence entries, part 242.
4672. gbvrl243.seq - Viral sequence entries, part 243.
4673. gbvrl244.seq - Viral sequence entries, part 244.
4674. gbvrl245.seq - Viral sequence entries, part 245.
4675. gbvrl246.seq - Viral sequence entries, part 246.
4676. gbvrl247.seq - Viral sequence entries, part 247.
4677. gbvrl248.seq - Viral sequence entries, part 248.
4678. gbvrl249.seq - Viral sequence entries, part 249.
4679. gbvrl25.seq - Viral sequence entries, part 25.
4680. gbvrl250.seq - Viral sequence entries, part 250.
4681. gbvrl251.seq - Viral sequence entries, part 251.
4682. gbvrl252.seq - Viral sequence entries, part 252.
4683. gbvrl253.seq - Viral sequence entries, part 253.
4684. gbvrl254.seq - Viral sequence entries, part 254.
4685. gbvrl255.seq - Viral sequence entries, part 255.
4686. gbvrl256.seq - Viral sequence entries, part 256.
4687. gbvrl257.seq - Viral sequence entries, part 257.
4688. gbvrl258.seq - Viral sequence entries, part 258.
4689. gbvrl259.seq - Viral sequence entries, part 259.
4690. gbvrl26.seq - Viral sequence entries, part 26.
4691. gbvrl260.seq - Viral sequence entries, part 260.
4692. gbvrl261.seq - Viral sequence entries, part 261.
4693. gbvrl262.seq - Viral sequence entries, part 262.
4694. gbvrl263.seq - Viral sequence entries, part 263.
4695. gbvrl264.seq - Viral sequence entries, part 264.
4696. gbvrl265.seq - Viral sequence entries, part 265.
4697. gbvrl266.seq - Viral sequence entries, part 266.
4698. gbvrl267.seq - Viral sequence entries, part 267.
4699. gbvrl268.seq - Viral sequence entries, part 268.
4700. gbvrl269.seq - Viral sequence entries, part 269.
4701. gbvrl27.seq - Viral sequence entries, part 27.
4702. gbvrl270.seq - Viral sequence entries, part 270.
4703. gbvrl271.seq - Viral sequence entries, part 271.
4704. gbvrl272.seq - Viral sequence entries, part 272.
4705. gbvrl273.seq - Viral sequence entries, part 273.
4706. gbvrl274.seq - Viral sequence entries, part 274.
4707. gbvrl275.seq - Viral sequence entries, part 275.
4708. gbvrl276.seq - Viral sequence entries, part 276.
4709. gbvrl277.seq - Viral sequence entries, part 277.
4710. gbvrl278.seq - Viral sequence entries, part 278.
4711. gbvrl279.seq - Viral sequence entries, part 279.
4712. gbvrl28.seq - Viral sequence entries, part 28.
4713. gbvrl280.seq - Viral sequence entries, part 280.
4714. gbvrl281.seq - Viral sequence entries, part 281.
4715. gbvrl282.seq - Viral sequence entries, part 282.
4716. gbvrl283.seq - Viral sequence entries, part 283.
4717. gbvrl284.seq - Viral sequence entries, part 284.
4718. gbvrl285.seq - Viral sequence entries, part 285.
4719. gbvrl286.seq - Viral sequence entries, part 286.
4720. gbvrl287.seq - Viral sequence entries, part 287.
4721. gbvrl288.seq - Viral sequence entries, part 288.
4722. gbvrl289.seq - Viral sequence entries, part 289.
4723. gbvrl29.seq - Viral sequence entries, part 29.
4724. gbvrl290.seq - Viral sequence entries, part 290.
4725. gbvrl291.seq - Viral sequence entries, part 291.
4726. gbvrl292.seq - Viral sequence entries, part 292.
4727. gbvrl293.seq - Viral sequence entries, part 293.
4728. gbvrl294.seq - Viral sequence entries, part 294.
4729. gbvrl295.seq - Viral sequence entries, part 295.
4730. gbvrl296.seq - Viral sequence entries, part 296.
4731. gbvrl297.seq - Viral sequence entries, part 297.
4732. gbvrl298.seq - Viral sequence entries, part 298.
4733. gbvrl299.seq - Viral sequence entries, part 299.
4734. gbvrl3.seq - Viral sequence entries, part 3.
4735. gbvrl30.seq - Viral sequence entries, part 30.
4736. gbvrl300.seq - Viral sequence entries, part 300.
4737. gbvrl301.seq - Viral sequence entries, part 301.
4738. gbvrl302.seq - Viral sequence entries, part 302.
4739. gbvrl303.seq - Viral sequence entries, part 303.
4740. gbvrl304.seq - Viral sequence entries, part 304.
4741. gbvrl305.seq - Viral sequence entries, part 305.
4742. gbvrl306.seq - Viral sequence entries, part 306.
4743. gbvrl307.seq - Viral sequence entries, part 307.
4744. gbvrl308.seq - Viral sequence entries, part 308.
4745. gbvrl309.seq - Viral sequence entries, part 309.
4746. gbvrl31.seq - Viral sequence entries, part 31.
4747. gbvrl310.seq - Viral sequence entries, part 310.
4748. gbvrl311.seq - Viral sequence entries, part 311.
4749. gbvrl312.seq - Viral sequence entries, part 312.
4750. gbvrl313.seq - Viral sequence entries, part 313.
4751. gbvrl314.seq - Viral sequence entries, part 314.
4752. gbvrl315.seq - Viral sequence entries, part 315.
4753. gbvrl316.seq - Viral sequence entries, part 316.
4754. gbvrl317.seq - Viral sequence entries, part 317.
4755. gbvrl318.seq - Viral sequence entries, part 318.
4756. gbvrl319.seq - Viral sequence entries, part 319.
4757. gbvrl32.seq - Viral sequence entries, part 32.
4758. gbvrl320.seq - Viral sequence entries, part 320.
4759. gbvrl321.seq - Viral sequence entries, part 321.
4760. gbvrl322.seq - Viral sequence entries, part 322.
4761. gbvrl323.seq - Viral sequence entries, part 323.
4762. gbvrl324.seq - Viral sequence entries, part 324.
4763. gbvrl325.seq - Viral sequence entries, part 325.
4764. gbvrl326.seq - Viral sequence entries, part 326.
4765. gbvrl327.seq - Viral sequence entries, part 327.
4766. gbvrl328.seq - Viral sequence entries, part 328.
4767. gbvrl329.seq - Viral sequence entries, part 329.
4768. gbvrl33.seq - Viral sequence entries, part 33.
4769. gbvrl330.seq - Viral sequence entries, part 330.
4770. gbvrl331.seq - Viral sequence entries, part 331.
4771. gbvrl332.seq - Viral sequence entries, part 332.
4772. gbvrl333.seq - Viral sequence entries, part 333.
4773. gbvrl334.seq - Viral sequence entries, part 334.
4774. gbvrl335.seq - Viral sequence entries, part 335.
4775. gbvrl336.seq - Viral sequence entries, part 336.
4776. gbvrl337.seq - Viral sequence entries, part 337.
4777. gbvrl338.seq - Viral sequence entries, part 338.
4778. gbvrl339.seq - Viral sequence entries, part 339.
4779. gbvrl34.seq - Viral sequence entries, part 34.
4780. gbvrl340.seq - Viral sequence entries, part 340.
4781. gbvrl341.seq - Viral sequence entries, part 341.
4782. gbvrl342.seq - Viral sequence entries, part 342.
4783. gbvrl343.seq - Viral sequence entries, part 343.
4784. gbvrl344.seq - Viral sequence entries, part 344.
4785. gbvrl345.seq - Viral sequence entries, part 345.
4786. gbvrl346.seq - Viral sequence entries, part 346.
4787. gbvrl347.seq - Viral sequence entries, part 347.
4788. gbvrl348.seq - Viral sequence entries, part 348.
4789. gbvrl349.seq - Viral sequence entries, part 349.
4790. gbvrl35.seq - Viral sequence entries, part 35.
4791. gbvrl350.seq - Viral sequence entries, part 350.
4792. gbvrl351.seq - Viral sequence entries, part 351.
4793. gbvrl352.seq - Viral sequence entries, part 352.
4794. gbvrl353.seq - Viral sequence entries, part 353.
4795. gbvrl354.seq - Viral sequence entries, part 354.
4796. gbvrl355.seq - Viral sequence entries, part 355.
4797. gbvrl356.seq - Viral sequence entries, part 356.
4798. gbvrl357.seq - Viral sequence entries, part 357.
4799. gbvrl358.seq - Viral sequence entries, part 358.
4800. gbvrl359.seq - Viral sequence entries, part 359.
4801. gbvrl36.seq - Viral sequence entries, part 36.
4802. gbvrl360.seq - Viral sequence entries, part 360.
4803. gbvrl361.seq - Viral sequence entries, part 361.
4804. gbvrl362.seq - Viral sequence entries, part 362.
4805. gbvrl363.seq - Viral sequence entries, part 363.
4806. gbvrl364.seq - Viral sequence entries, part 364.
4807. gbvrl365.seq - Viral sequence entries, part 365.
4808. gbvrl366.seq - Viral sequence entries, part 366.
4809. gbvrl367.seq - Viral sequence entries, part 367.
4810. gbvrl368.seq - Viral sequence entries, part 368.
4811. gbvrl369.seq - Viral sequence entries, part 369.
4812. gbvrl37.seq - Viral sequence entries, part 37.
4813. gbvrl370.seq - Viral sequence entries, part 370.
4814. gbvrl371.seq - Viral sequence entries, part 371.
4815. gbvrl372.seq - Viral sequence entries, part 372.
4816. gbvrl373.seq - Viral sequence entries, part 373.
4817. gbvrl374.seq - Viral sequence entries, part 374.
4818. gbvrl375.seq - Viral sequence entries, part 375.
4819. gbvrl376.seq - Viral sequence entries, part 376.
4820. gbvrl377.seq - Viral sequence entries, part 377.
4821. gbvrl378.seq - Viral sequence entries, part 378.
4822. gbvrl379.seq - Viral sequence entries, part 379.
4823. gbvrl38.seq - Viral sequence entries, part 38.
4824. gbvrl380.seq - Viral sequence entries, part 380.
4825. gbvrl381.seq - Viral sequence entries, part 381.
4826. gbvrl382.seq - Viral sequence entries, part 382.
4827. gbvrl383.seq - Viral sequence entries, part 383.
4828. gbvrl384.seq - Viral sequence entries, part 384.
4829. gbvrl385.seq - Viral sequence entries, part 385.
4830. gbvrl386.seq - Viral sequence entries, part 386.
4831. gbvrl387.seq - Viral sequence entries, part 387.
4832. gbvrl388.seq - Viral sequence entries, part 388.
4833. gbvrl389.seq - Viral sequence entries, part 389.
4834. gbvrl39.seq - Viral sequence entries, part 39.
4835. gbvrl390.seq - Viral sequence entries, part 390.
4836. gbvrl391.seq - Viral sequence entries, part 391.
4837. gbvrl392.seq - Viral sequence entries, part 392.
4838. gbvrl393.seq - Viral sequence entries, part 393.
4839. gbvrl394.seq - Viral sequence entries, part 394.
4840. gbvrl395.seq - Viral sequence entries, part 395.
4841. gbvrl396.seq - Viral sequence entries, part 396.
4842. gbvrl397.seq - Viral sequence entries, part 397.
4843. gbvrl398.seq - Viral sequence entries, part 398.
4844. gbvrl399.seq - Viral sequence entries, part 399.
4845. gbvrl4.seq - Viral sequence entries, part 4.
4846. gbvrl40.seq - Viral sequence entries, part 40.
4847. gbvrl400.seq - Viral sequence entries, part 400.
4848. gbvrl401.seq - Viral sequence entries, part 401.
4849. gbvrl402.seq - Viral sequence entries, part 402.
4850. gbvrl403.seq - Viral sequence entries, part 403.
4851. gbvrl404.seq - Viral sequence entries, part 404.
4852. gbvrl405.seq - Viral sequence entries, part 405.
4853. gbvrl406.seq - Viral sequence entries, part 406.
4854. gbvrl407.seq - Viral sequence entries, part 407.
4855. gbvrl408.seq - Viral sequence entries, part 408.
4856. gbvrl409.seq - Viral sequence entries, part 409.
4857. gbvrl41.seq - Viral sequence entries, part 41.
4858. gbvrl410.seq - Viral sequence entries, part 410.
4859. gbvrl411.seq - Viral sequence entries, part 411.
4860. gbvrl412.seq - Viral sequence entries, part 412.
4861. gbvrl413.seq - Viral sequence entries, part 413.
4862. gbvrl414.seq - Viral sequence entries, part 414.
4863. gbvrl415.seq - Viral sequence entries, part 415.
4864. gbvrl416.seq - Viral sequence entries, part 416.
4865. gbvrl417.seq - Viral sequence entries, part 417.
4866. gbvrl418.seq - Viral sequence entries, part 418.
4867. gbvrl419.seq - Viral sequence entries, part 419.
4868. gbvrl42.seq - Viral sequence entries, part 42.
4869. gbvrl420.seq - Viral sequence entries, part 420.
4870. gbvrl421.seq - Viral sequence entries, part 421.
4871. gbvrl422.seq - Viral sequence entries, part 422.
4872. gbvrl423.seq - Viral sequence entries, part 423.
4873. gbvrl424.seq - Viral sequence entries, part 424.
4874. gbvrl425.seq - Viral sequence entries, part 425.
4875. gbvrl426.seq - Viral sequence entries, part 426.
4876. gbvrl427.seq - Viral sequence entries, part 427.
4877. gbvrl428.seq - Viral sequence entries, part 428.
4878. gbvrl429.seq - Viral sequence entries, part 429.
4879. gbvrl43.seq - Viral sequence entries, part 43.
4880. gbvrl430.seq - Viral sequence entries, part 430.
4881. gbvrl431.seq - Viral sequence entries, part 431.
4882. gbvrl432.seq - Viral sequence entries, part 432.
4883. gbvrl433.seq - Viral sequence entries, part 433.
4884. gbvrl434.seq - Viral sequence entries, part 434.
4885. gbvrl435.seq - Viral sequence entries, part 435.
4886. gbvrl436.seq - Viral sequence entries, part 436.
4887. gbvrl437.seq - Viral sequence entries, part 437.
4888. gbvrl438.seq - Viral sequence entries, part 438.
4889. gbvrl439.seq - Viral sequence entries, part 439.
4890. gbvrl44.seq - Viral sequence entries, part 44.
4891. gbvrl440.seq - Viral sequence entries, part 440.
4892. gbvrl441.seq - Viral sequence entries, part 441.
4893. gbvrl442.seq - Viral sequence entries, part 442.
4894. gbvrl443.seq - Viral sequence entries, part 443.
4895. gbvrl444.seq - Viral sequence entries, part 444.
4896. gbvrl445.seq - Viral sequence entries, part 445.
4897. gbvrl446.seq - Viral sequence entries, part 446.
4898. gbvrl447.seq - Viral sequence entries, part 447.
4899. gbvrl448.seq - Viral sequence entries, part 448.
4900. gbvrl449.seq - Viral sequence entries, part 449.
4901. gbvrl45.seq - Viral sequence entries, part 45.
4902. gbvrl450.seq - Viral sequence entries, part 450.
4903. gbvrl451.seq - Viral sequence entries, part 451.
4904. gbvrl452.seq - Viral sequence entries, part 452.
4905. gbvrl453.seq - Viral sequence entries, part 453.
4906. gbvrl454.seq - Viral sequence entries, part 454.
4907. gbvrl455.seq - Viral sequence entries, part 455.
4908. gbvrl456.seq - Viral sequence entries, part 456.
4909. gbvrl457.seq - Viral sequence entries, part 457.
4910. gbvrl458.seq - Viral sequence entries, part 458.
4911. gbvrl459.seq - Viral sequence entries, part 459.
4912. gbvrl46.seq - Viral sequence entries, part 46.
4913. gbvrl460.seq - Viral sequence entries, part 460.
4914. gbvrl461.seq - Viral sequence entries, part 461.
4915. gbvrl462.seq - Viral sequence entries, part 462.
4916. gbvrl463.seq - Viral sequence entries, part 463.
4917. gbvrl464.seq - Viral sequence entries, part 464.
4918. gbvrl465.seq - Viral sequence entries, part 465.
4919. gbvrl466.seq - Viral sequence entries, part 466.
4920. gbvrl467.seq - Viral sequence entries, part 467.
4921. gbvrl468.seq - Viral sequence entries, part 468.
4922. gbvrl469.seq - Viral sequence entries, part 469.
4923. gbvrl47.seq - Viral sequence entries, part 47.
4924. gbvrl470.seq - Viral sequence entries, part 470.
4925. gbvrl471.seq - Viral sequence entries, part 471.
4926. gbvrl472.seq - Viral sequence entries, part 472.
4927. gbvrl473.seq - Viral sequence entries, part 473.
4928. gbvrl474.seq - Viral sequence entries, part 474.
4929. gbvrl475.seq - Viral sequence entries, part 475.
4930. gbvrl476.seq - Viral sequence entries, part 476.
4931. gbvrl477.seq - Viral sequence entries, part 477.
4932. gbvrl478.seq - Viral sequence entries, part 478.
4933. gbvrl479.seq - Viral sequence entries, part 479.
4934. gbvrl48.seq - Viral sequence entries, part 48.
4935. gbvrl480.seq - Viral sequence entries, part 480.
4936. gbvrl481.seq - Viral sequence entries, part 481.
4937. gbvrl482.seq - Viral sequence entries, part 482.
4938. gbvrl483.seq - Viral sequence entries, part 483.
4939. gbvrl484.seq - Viral sequence entries, part 484.
4940. gbvrl485.seq - Viral sequence entries, part 485.
4941. gbvrl486.seq - Viral sequence entries, part 486.
4942. gbvrl487.seq - Viral sequence entries, part 487.
4943. gbvrl488.seq - Viral sequence entries, part 488.
4944. gbvrl489.seq - Viral sequence entries, part 489.
4945. gbvrl49.seq - Viral sequence entries, part 49.
4946. gbvrl490.seq - Viral sequence entries, part 490.
4947. gbvrl491.seq - Viral sequence entries, part 491.
4948. gbvrl492.seq - Viral sequence entries, part 492.
4949. gbvrl493.seq - Viral sequence entries, part 493.
4950. gbvrl494.seq - Viral sequence entries, part 494.
4951. gbvrl495.seq - Viral sequence entries, part 495.
4952. gbvrl496.seq - Viral sequence entries, part 496.
4953. gbvrl497.seq - Viral sequence entries, part 497.
4954. gbvrl498.seq - Viral sequence entries, part 498.
4955. gbvrl499.seq - Viral sequence entries, part 499.
4956. gbvrl5.seq - Viral sequence entries, part 5.
4957. gbvrl50.seq - Viral sequence entries, part 50.
4958. gbvrl500.seq - Viral sequence entries, part 500.
4959. gbvrl501.seq - Viral sequence entries, part 501.
4960. gbvrl502.seq - Viral sequence entries, part 502.
4961. gbvrl503.seq - Viral sequence entries, part 503.
4962. gbvrl504.seq - Viral sequence entries, part 504.
4963. gbvrl505.seq - Viral sequence entries, part 505.
4964. gbvrl506.seq - Viral sequence entries, part 506.
4965. gbvrl507.seq - Viral sequence entries, part 507.
4966. gbvrl508.seq - Viral sequence entries, part 508.
4967. gbvrl509.seq - Viral sequence entries, part 509.
4968. gbvrl51.seq - Viral sequence entries, part 51.
4969. gbvrl510.seq - Viral sequence entries, part 510.
4970. gbvrl511.seq - Viral sequence entries, part 511.
4971. gbvrl512.seq - Viral sequence entries, part 512.
4972. gbvrl513.seq - Viral sequence entries, part 513.
4973. gbvrl514.seq - Viral sequence entries, part 514.
4974. gbvrl515.seq - Viral sequence entries, part 515.
4975. gbvrl516.seq - Viral sequence entries, part 516.
4976. gbvrl517.seq - Viral sequence entries, part 517.
4977. gbvrl518.seq - Viral sequence entries, part 518.
4978. gbvrl519.seq - Viral sequence entries, part 519.
4979. gbvrl52.seq - Viral sequence entries, part 52.
4980. gbvrl520.seq - Viral sequence entries, part 520.
4981. gbvrl521.seq - Viral sequence entries, part 521.
4982. gbvrl522.seq - Viral sequence entries, part 522.
4983. gbvrl523.seq - Viral sequence entries, part 523.
4984. gbvrl524.seq - Viral sequence entries, part 524.
4985. gbvrl525.seq - Viral sequence entries, part 525.
4986. gbvrl526.seq - Viral sequence entries, part 526.
4987. gbvrl527.seq - Viral sequence entries, part 527.
4988. gbvrl528.seq - Viral sequence entries, part 528.
4989. gbvrl529.seq - Viral sequence entries, part 529.
4990. gbvrl53.seq - Viral sequence entries, part 53.
4991. gbvrl530.seq - Viral sequence entries, part 530.
4992. gbvrl531.seq - Viral sequence entries, part 531.
4993. gbvrl532.seq - Viral sequence entries, part 532.
4994. gbvrl533.seq - Viral sequence entries, part 533.
4995. gbvrl534.seq - Viral sequence entries, part 534.
4996. gbvrl535.seq - Viral sequence entries, part 535.
4997. gbvrl536.seq - Viral sequence entries, part 536.
4998. gbvrl537.seq - Viral sequence entries, part 537.
4999. gbvrl538.seq - Viral sequence entries, part 538.
5000. gbvrl539.seq - Viral sequence entries, part 539.
5001. gbvrl54.seq - Viral sequence entries, part 54.
5002. gbvrl540.seq - Viral sequence entries, part 540.
5003. gbvrl541.seq - Viral sequence entries, part 541.
5004. gbvrl542.seq - Viral sequence entries, part 542.
5005. gbvrl543.seq - Viral sequence entries, part 543.
5006. gbvrl544.seq - Viral sequence entries, part 544.
5007. gbvrl545.seq - Viral sequence entries, part 545.
5008. gbvrl546.seq - Viral sequence entries, part 546.
5009. gbvrl547.seq - Viral sequence entries, part 547.
5010. gbvrl548.seq - Viral sequence entries, part 548.
5011. gbvrl549.seq - Viral sequence entries, part 549.
5012. gbvrl55.seq - Viral sequence entries, part 55.
5013. gbvrl550.seq - Viral sequence entries, part 550.
5014. gbvrl551.seq - Viral sequence entries, part 551.
5015. gbvrl552.seq - Viral sequence entries, part 552.
5016. gbvrl553.seq - Viral sequence entries, part 553.
5017. gbvrl554.seq - Viral sequence entries, part 554.
5018. gbvrl555.seq - Viral sequence entries, part 555.
5019. gbvrl556.seq - Viral sequence entries, part 556.
5020. gbvrl557.seq - Viral sequence entries, part 557.
5021. gbvrl558.seq - Viral sequence entries, part 558.
5022. gbvrl559.seq - Viral sequence entries, part 559.
5023. gbvrl56.seq - Viral sequence entries, part 56.
5024. gbvrl560.seq - Viral sequence entries, part 560.
5025. gbvrl561.seq - Viral sequence entries, part 561.
5026. gbvrl562.seq - Viral sequence entries, part 562.
5027. gbvrl563.seq - Viral sequence entries, part 563.
5028. gbvrl564.seq - Viral sequence entries, part 564.
5029. gbvrl565.seq - Viral sequence entries, part 565.
5030. gbvrl566.seq - Viral sequence entries, part 566.
5031. gbvrl567.seq - Viral sequence entries, part 567.
5032. gbvrl568.seq - Viral sequence entries, part 568.
5033. gbvrl569.seq - Viral sequence entries, part 569.
5034. gbvrl57.seq - Viral sequence entries, part 57.
5035. gbvrl570.seq - Viral sequence entries, part 570.
5036. gbvrl571.seq - Viral sequence entries, part 571.
5037. gbvrl572.seq - Viral sequence entries, part 572.
5038. gbvrl573.seq - Viral sequence entries, part 573.
5039. gbvrl574.seq - Viral sequence entries, part 574.
5040. gbvrl575.seq - Viral sequence entries, part 575.
5041. gbvrl576.seq - Viral sequence entries, part 576.
5042. gbvrl577.seq - Viral sequence entries, part 577.
5043. gbvrl578.seq - Viral sequence entries, part 578.
5044. gbvrl579.seq - Viral sequence entries, part 579.
5045. gbvrl58.seq - Viral sequence entries, part 58.
5046. gbvrl580.seq - Viral sequence entries, part 580.
5047. gbvrl581.seq - Viral sequence entries, part 581.
5048. gbvrl582.seq - Viral sequence entries, part 582.
5049. gbvrl583.seq - Viral sequence entries, part 583.
5050. gbvrl584.seq - Viral sequence entries, part 584.
5051. gbvrl585.seq - Viral sequence entries, part 585.
5052. gbvrl586.seq - Viral sequence entries, part 586.
5053. gbvrl587.seq - Viral sequence entries, part 587.
5054. gbvrl588.seq - Viral sequence entries, part 588.
5055. gbvrl589.seq - Viral sequence entries, part 589.
5056. gbvrl59.seq - Viral sequence entries, part 59.
5057. gbvrl590.seq - Viral sequence entries, part 590.
5058. gbvrl591.seq - Viral sequence entries, part 591.
5059. gbvrl592.seq - Viral sequence entries, part 592.
5060. gbvrl593.seq - Viral sequence entries, part 593.
5061. gbvrl594.seq - Viral sequence entries, part 594.
5062. gbvrl595.seq - Viral sequence entries, part 595.
5063. gbvrl596.seq - Viral sequence entries, part 596.
5064. gbvrl597.seq - Viral sequence entries, part 597.
5065. gbvrl598.seq - Viral sequence entries, part 598.
5066. gbvrl599.seq - Viral sequence entries, part 599.
5067. gbvrl6.seq - Viral sequence entries, part 6.
5068. gbvrl60.seq - Viral sequence entries, part 60.
5069. gbvrl600.seq - Viral sequence entries, part 600.
5070. gbvrl601.seq - Viral sequence entries, part 601.
5071. gbvrl602.seq - Viral sequence entries, part 602.
5072. gbvrl603.seq - Viral sequence entries, part 603.
5073. gbvrl604.seq - Viral sequence entries, part 604.
5074. gbvrl605.seq - Viral sequence entries, part 605.
5075. gbvrl606.seq - Viral sequence entries, part 606.
5076. gbvrl607.seq - Viral sequence entries, part 607.
5077. gbvrl608.seq - Viral sequence entries, part 608.
5078. gbvrl609.seq - Viral sequence entries, part 609.
5079. gbvrl61.seq - Viral sequence entries, part 61.
5080. gbvrl610.seq - Viral sequence entries, part 610.
5081. gbvrl611.seq - Viral sequence entries, part 611.
5082. gbvrl612.seq - Viral sequence entries, part 612.
5083. gbvrl613.seq - Viral sequence entries, part 613.
5084. gbvrl614.seq - Viral sequence entries, part 614.
5085. gbvrl615.seq - Viral sequence entries, part 615.
5086. gbvrl616.seq - Viral sequence entries, part 616.
5087. gbvrl617.seq - Viral sequence entries, part 617.
5088. gbvrl618.seq - Viral sequence entries, part 618.
5089. gbvrl619.seq - Viral sequence entries, part 619.
5090. gbvrl62.seq - Viral sequence entries, part 62.
5091. gbvrl620.seq - Viral sequence entries, part 620.
5092. gbvrl621.seq - Viral sequence entries, part 621.
5093. gbvrl622.seq - Viral sequence entries, part 622.
5094. gbvrl623.seq - Viral sequence entries, part 623.
5095. gbvrl624.seq - Viral sequence entries, part 624.
5096. gbvrl625.seq - Viral sequence entries, part 625.
5097. gbvrl626.seq - Viral sequence entries, part 626.
5098. gbvrl627.seq - Viral sequence entries, part 627.
5099. gbvrl628.seq - Viral sequence entries, part 628.
5100. gbvrl629.seq - Viral sequence entries, part 629.
5101. gbvrl63.seq - Viral sequence entries, part 63.
5102. gbvrl630.seq - Viral sequence entries, part 630.
5103. gbvrl631.seq - Viral sequence entries, part 631.
5104. gbvrl632.seq - Viral sequence entries, part 632.
5105. gbvrl633.seq - Viral sequence entries, part 633.
5106. gbvrl634.seq - Viral sequence entries, part 634.
5107. gbvrl635.seq - Viral sequence entries, part 635.
5108. gbvrl636.seq - Viral sequence entries, part 636.
5109. gbvrl637.seq - Viral sequence entries, part 637.
5110. gbvrl638.seq - Viral sequence entries, part 638.
5111. gbvrl639.seq - Viral sequence entries, part 639.
5112. gbvrl64.seq - Viral sequence entries, part 64.
5113. gbvrl640.seq - Viral sequence entries, part 640.
5114. gbvrl641.seq - Viral sequence entries, part 641.
5115. gbvrl642.seq - Viral sequence entries, part 642.
5116. gbvrl643.seq - Viral sequence entries, part 643.
5117. gbvrl644.seq - Viral sequence entries, part 644.
5118. gbvrl645.seq - Viral sequence entries, part 645.
5119. gbvrl646.seq - Viral sequence entries, part 646.
5120. gbvrl647.seq - Viral sequence entries, part 647.
5121. gbvrl648.seq - Viral sequence entries, part 648.
5122. gbvrl649.seq - Viral sequence entries, part 649.
5123. gbvrl65.seq - Viral sequence entries, part 65.
5124. gbvrl650.seq - Viral sequence entries, part 650.
5125. gbvrl651.seq - Viral sequence entries, part 651.
5126. gbvrl652.seq - Viral sequence entries, part 652.
5127. gbvrl653.seq - Viral sequence entries, part 653.
5128. gbvrl654.seq - Viral sequence entries, part 654.
5129. gbvrl655.seq - Viral sequence entries, part 655.
5130. gbvrl656.seq - Viral sequence entries, part 656.
5131. gbvrl657.seq - Viral sequence entries, part 657.
5132. gbvrl658.seq - Viral sequence entries, part 658.
5133. gbvrl659.seq - Viral sequence entries, part 659.
5134. gbvrl66.seq - Viral sequence entries, part 66.
5135. gbvrl660.seq - Viral sequence entries, part 660.
5136. gbvrl661.seq - Viral sequence entries, part 661.
5137. gbvrl662.seq - Viral sequence entries, part 662.
5138. gbvrl663.seq - Viral sequence entries, part 663.
5139. gbvrl664.seq - Viral sequence entries, part 664.
5140. gbvrl665.seq - Viral sequence entries, part 665.
5141. gbvrl666.seq - Viral sequence entries, part 666.
5142. gbvrl667.seq - Viral sequence entries, part 667.
5143. gbvrl668.seq - Viral sequence entries, part 668.
5144. gbvrl669.seq - Viral sequence entries, part 669.
5145. gbvrl67.seq - Viral sequence entries, part 67.
5146. gbvrl670.seq - Viral sequence entries, part 670.
5147. gbvrl671.seq - Viral sequence entries, part 671.
5148. gbvrl672.seq - Viral sequence entries, part 672.
5149. gbvrl673.seq - Viral sequence entries, part 673.
5150. gbvrl674.seq - Viral sequence entries, part 674.
5151. gbvrl675.seq - Viral sequence entries, part 675.
5152. gbvrl676.seq - Viral sequence entries, part 676.
5153. gbvrl677.seq - Viral sequence entries, part 677.
5154. gbvrl678.seq - Viral sequence entries, part 678.
5155. gbvrl679.seq - Viral sequence entries, part 679.
5156. gbvrl68.seq - Viral sequence entries, part 68.
5157. gbvrl680.seq - Viral sequence entries, part 680.
5158. gbvrl681.seq - Viral sequence entries, part 681.
5159. gbvrl682.seq - Viral sequence entries, part 682.
5160. gbvrl683.seq - Viral sequence entries, part 683.
5161. gbvrl684.seq - Viral sequence entries, part 684.
5162. gbvrl685.seq - Viral sequence entries, part 685.
5163. gbvrl686.seq - Viral sequence entries, part 686.
5164. gbvrl687.seq - Viral sequence entries, part 687.
5165. gbvrl688.seq - Viral sequence entries, part 688.
5166. gbvrl689.seq - Viral sequence entries, part 689.
5167. gbvrl69.seq - Viral sequence entries, part 69.
5168. gbvrl690.seq - Viral sequence entries, part 690.
5169. gbvrl691.seq - Viral sequence entries, part 691.
5170. gbvrl692.seq - Viral sequence entries, part 692.
5171. gbvrl693.seq - Viral sequence entries, part 693.
5172. gbvrl694.seq - Viral sequence entries, part 694.
5173. gbvrl695.seq - Viral sequence entries, part 695.
5174. gbvrl696.seq - Viral sequence entries, part 696.
5175. gbvrl697.seq - Viral sequence entries, part 697.
5176. gbvrl698.seq - Viral sequence entries, part 698.
5177. gbvrl699.seq - Viral sequence entries, part 699.
5178. gbvrl7.seq - Viral sequence entries, part 7.
5179. gbvrl70.seq - Viral sequence entries, part 70.
5180. gbvrl700.seq - Viral sequence entries, part 700.
5181. gbvrl701.seq - Viral sequence entries, part 701.
5182. gbvrl702.seq - Viral sequence entries, part 702.
5183. gbvrl703.seq - Viral sequence entries, part 703.
5184. gbvrl704.seq - Viral sequence entries, part 704.
5185. gbvrl705.seq - Viral sequence entries, part 705.
5186. gbvrl706.seq - Viral sequence entries, part 706.
5187. gbvrl707.seq - Viral sequence entries, part 707.
5188. gbvrl708.seq - Viral sequence entries, part 708.
5189. gbvrl709.seq - Viral sequence entries, part 709.
5190. gbvrl71.seq - Viral sequence entries, part 71.
5191. gbvrl710.seq - Viral sequence entries, part 710.
5192. gbvrl711.seq - Viral sequence entries, part 711.
5193. gbvrl72.seq - Viral sequence entries, part 72.
5194. gbvrl73.seq - Viral sequence entries, part 73.
5195. gbvrl74.seq - Viral sequence entries, part 74.
5196. gbvrl75.seq - Viral sequence entries, part 75.
5197. gbvrl76.seq - Viral sequence entries, part 76.
5198. gbvrl77.seq - Viral sequence entries, part 77.
5199. gbvrl78.seq - Viral sequence entries, part 78.
5200. gbvrl79.seq - Viral sequence entries, part 79.
5201. gbvrl8.seq - Viral sequence entries, part 8.
5202. gbvrl80.seq - Viral sequence entries, part 80.
5203. gbvrl81.seq - Viral sequence entries, part 81.
5204. gbvrl82.seq - Viral sequence entries, part 82.
5205. gbvrl83.seq - Viral sequence entries, part 83.
5206. gbvrl84.seq - Viral sequence entries, part 84.
5207. gbvrl85.seq - Viral sequence entries, part 85.
5208. gbvrl86.seq - Viral sequence entries, part 86.
5209. gbvrl87.seq - Viral sequence entries, part 87.
5210. gbvrl88.seq - Viral sequence entries, part 88.
5211. gbvrl89.seq - Viral sequence entries, part 89.
5212. gbvrl9.seq - Viral sequence entries, part 9.
5213. gbvrl90.seq - Viral sequence entries, part 90.
5214. gbvrl91.seq - Viral sequence entries, part 91.
5215. gbvrl92.seq - Viral sequence entries, part 92.
5216. gbvrl93.seq - Viral sequence entries, part 93.
5217. gbvrl94.seq - Viral sequence entries, part 94.
5218. gbvrl95.seq - Viral sequence entries, part 95.
5219. gbvrl96.seq - Viral sequence entries, part 96.
5220. gbvrl97.seq - Viral sequence entries, part 97.
5221. gbvrl98.seq - Viral sequence entries, part 98.
5222. gbvrl99.seq - Viral sequence entries, part 99.
5223. gbvrt1.seq - Other vertebrate sequence entries, part 1.
5224. gbvrt10.seq - Other vertebrate sequence entries, part 10.
5225. gbvrt100.seq - Other vertebrate sequence entries, part 100.
5226. gbvrt101.seq - Other vertebrate sequence entries, part 101.
5227. gbvrt102.seq - Other vertebrate sequence entries, part 102.
5228. gbvrt103.seq - Other vertebrate sequence entries, part 103.
5229. gbvrt104.seq - Other vertebrate sequence entries, part 104.
5230. gbvrt105.seq - Other vertebrate sequence entries, part 105.
5231. gbvrt106.seq - Other vertebrate sequence entries, part 106.
5232. gbvrt107.seq - Other vertebrate sequence entries, part 107.
5233. gbvrt108.seq - Other vertebrate sequence entries, part 108.
5234. gbvrt109.seq - Other vertebrate sequence entries, part 109.
5235. gbvrt11.seq - Other vertebrate sequence entries, part 11.
5236. gbvrt110.seq - Other vertebrate sequence entries, part 110.
5237. gbvrt111.seq - Other vertebrate sequence entries, part 111.
5238. gbvrt112.seq - Other vertebrate sequence entries, part 112.
5239. gbvrt113.seq - Other vertebrate sequence entries, part 113.
5240. gbvrt114.seq - Other vertebrate sequence entries, part 114.
5241. gbvrt115.seq - Other vertebrate sequence entries, part 115.
5242. gbvrt116.seq - Other vertebrate sequence entries, part 116.
5243. gbvrt117.seq - Other vertebrate sequence entries, part 117.
5244. gbvrt118.seq - Other vertebrate sequence entries, part 118.
5245. gbvrt119.seq - Other vertebrate sequence entries, part 119.
5246. gbvrt12.seq - Other vertebrate sequence entries, part 12.
5247. gbvrt120.seq - Other vertebrate sequence entries, part 120.
5248. gbvrt121.seq - Other vertebrate sequence entries, part 121.
5249. gbvrt122.seq - Other vertebrate sequence entries, part 122.
5250. gbvrt123.seq - Other vertebrate sequence entries, part 123.
5251. gbvrt124.seq - Other vertebrate sequence entries, part 124.
5252. gbvrt125.seq - Other vertebrate sequence entries, part 125.
5253. gbvrt126.seq - Other vertebrate sequence entries, part 126.
5254. gbvrt127.seq - Other vertebrate sequence entries, part 127.
5255. gbvrt128.seq - Other vertebrate sequence entries, part 128.
5256. gbvrt129.seq - Other vertebrate sequence entries, part 129.
5257. gbvrt13.seq - Other vertebrate sequence entries, part 13.
5258. gbvrt130.seq - Other vertebrate sequence entries, part 130.
5259. gbvrt131.seq - Other vertebrate sequence entries, part 131.
5260. gbvrt132.seq - Other vertebrate sequence entries, part 132.
5261. gbvrt133.seq - Other vertebrate sequence entries, part 133.
5262. gbvrt134.seq - Other vertebrate sequence entries, part 134.
5263. gbvrt135.seq - Other vertebrate sequence entries, part 135.
5264. gbvrt136.seq - Other vertebrate sequence entries, part 136.
5265. gbvrt137.seq - Other vertebrate sequence entries, part 137.
5266. gbvrt138.seq - Other vertebrate sequence entries, part 138.
5267. gbvrt139.seq - Other vertebrate sequence entries, part 139.
5268. gbvrt14.seq - Other vertebrate sequence entries, part 14.
5269. gbvrt140.seq - Other vertebrate sequence entries, part 140.
5270. gbvrt141.seq - Other vertebrate sequence entries, part 141.
5271. gbvrt142.seq - Other vertebrate sequence entries, part 142.
5272. gbvrt143.seq - Other vertebrate sequence entries, part 143.
5273. gbvrt144.seq - Other vertebrate sequence entries, part 144.
5274. gbvrt145.seq - Other vertebrate sequence entries, part 145.
5275. gbvrt146.seq - Other vertebrate sequence entries, part 146.
5276. gbvrt147.seq - Other vertebrate sequence entries, part 147.
5277. gbvrt148.seq - Other vertebrate sequence entries, part 148.
5278. gbvrt149.seq - Other vertebrate sequence entries, part 149.
5279. gbvrt15.seq - Other vertebrate sequence entries, part 15.
5280. gbvrt150.seq - Other vertebrate sequence entries, part 150.
5281. gbvrt151.seq - Other vertebrate sequence entries, part 151.
5282. gbvrt152.seq - Other vertebrate sequence entries, part 152.
5283. gbvrt153.seq - Other vertebrate sequence entries, part 153.
5284. gbvrt154.seq - Other vertebrate sequence entries, part 154.
5285. gbvrt155.seq - Other vertebrate sequence entries, part 155.
5286. gbvrt156.seq - Other vertebrate sequence entries, part 156.
5287. gbvrt157.seq - Other vertebrate sequence entries, part 157.
5288. gbvrt158.seq - Other vertebrate sequence entries, part 158.
5289. gbvrt159.seq - Other vertebrate sequence entries, part 159.
5290. gbvrt16.seq - Other vertebrate sequence entries, part 16.
5291. gbvrt160.seq - Other vertebrate sequence entries, part 160.
5292. gbvrt161.seq - Other vertebrate sequence entries, part 161.
5293. gbvrt162.seq - Other vertebrate sequence entries, part 162.
5294. gbvrt163.seq - Other vertebrate sequence entries, part 163.
5295. gbvrt164.seq - Other vertebrate sequence entries, part 164.
5296. gbvrt165.seq - Other vertebrate sequence entries, part 165.
5297. gbvrt166.seq - Other vertebrate sequence entries, part 166.
5298. gbvrt167.seq - Other vertebrate sequence entries, part 167.
5299. gbvrt168.seq - Other vertebrate sequence entries, part 168.
5300. gbvrt169.seq - Other vertebrate sequence entries, part 169.
5301. gbvrt17.seq - Other vertebrate sequence entries, part 17.
5302. gbvrt170.seq - Other vertebrate sequence entries, part 170.
5303. gbvrt171.seq - Other vertebrate sequence entries, part 171.
5304. gbvrt172.seq - Other vertebrate sequence entries, part 172.
5305. gbvrt173.seq - Other vertebrate sequence entries, part 173.
5306. gbvrt174.seq - Other vertebrate sequence entries, part 174.
5307. gbvrt175.seq - Other vertebrate sequence entries, part 175.
5308. gbvrt176.seq - Other vertebrate sequence entries, part 176.
5309. gbvrt177.seq - Other vertebrate sequence entries, part 177.
5310. gbvrt178.seq - Other vertebrate sequence entries, part 178.
5311. gbvrt179.seq - Other vertebrate sequence entries, part 179.
5312. gbvrt18.seq - Other vertebrate sequence entries, part 18.
5313. gbvrt180.seq - Other vertebrate sequence entries, part 180.
5314. gbvrt181.seq - Other vertebrate sequence entries, part 181.
5315. gbvrt182.seq - Other vertebrate sequence entries, part 182.
5316. gbvrt183.seq - Other vertebrate sequence entries, part 183.
5317. gbvrt184.seq - Other vertebrate sequence entries, part 184.
5318. gbvrt185.seq - Other vertebrate sequence entries, part 185.
5319. gbvrt186.seq - Other vertebrate sequence entries, part 186.
5320. gbvrt187.seq - Other vertebrate sequence entries, part 187.
5321. gbvrt188.seq - Other vertebrate sequence entries, part 188.
5322. gbvrt189.seq - Other vertebrate sequence entries, part 189.
5323. gbvrt19.seq - Other vertebrate sequence entries, part 19.
5324. gbvrt190.seq - Other vertebrate sequence entries, part 190.
5325. gbvrt191.seq - Other vertebrate sequence entries, part 191.
5326. gbvrt192.seq - Other vertebrate sequence entries, part 192.
5327. gbvrt193.seq - Other vertebrate sequence entries, part 193.
5328. gbvrt194.seq - Other vertebrate sequence entries, part 194.
5329. gbvrt195.seq - Other vertebrate sequence entries, part 195.
5330. gbvrt196.seq - Other vertebrate sequence entries, part 196.
5331. gbvrt197.seq - Other vertebrate sequence entries, part 197.
5332. gbvrt198.seq - Other vertebrate sequence entries, part 198.
5333. gbvrt199.seq - Other vertebrate sequence entries, part 199.
5334. gbvrt2.seq - Other vertebrate sequence entries, part 2.
5335. gbvrt20.seq - Other vertebrate sequence entries, part 20.
5336. gbvrt200.seq - Other vertebrate sequence entries, part 200.
5337. gbvrt201.seq - Other vertebrate sequence entries, part 201.
5338. gbvrt202.seq - Other vertebrate sequence entries, part 202.
5339. gbvrt203.seq - Other vertebrate sequence entries, part 203.
5340. gbvrt204.seq - Other vertebrate sequence entries, part 204.
5341. gbvrt205.seq - Other vertebrate sequence entries, part 205.
5342. gbvrt206.seq - Other vertebrate sequence entries, part 206.
5343. gbvrt207.seq - Other vertebrate sequence entries, part 207.
5344. gbvrt208.seq - Other vertebrate sequence entries, part 208.
5345. gbvrt209.seq - Other vertebrate sequence entries, part 209.
5346. gbvrt21.seq - Other vertebrate sequence entries, part 21.
5347. gbvrt210.seq - Other vertebrate sequence entries, part 210.
5348. gbvrt211.seq - Other vertebrate sequence entries, part 211.
5349. gbvrt212.seq - Other vertebrate sequence entries, part 212.
5350. gbvrt213.seq - Other vertebrate sequence entries, part 213.
5351. gbvrt214.seq - Other vertebrate sequence entries, part 214.
5352. gbvrt215.seq - Other vertebrate sequence entries, part 215.
5353. gbvrt216.seq - Other vertebrate sequence entries, part 216.
5354. gbvrt217.seq - Other vertebrate sequence entries, part 217.
5355. gbvrt218.seq - Other vertebrate sequence entries, part 218.
5356. gbvrt219.seq - Other vertebrate sequence entries, part 219.
5357. gbvrt22.seq - Other vertebrate sequence entries, part 22.
5358. gbvrt220.seq - Other vertebrate sequence entries, part 220.
5359. gbvrt221.seq - Other vertebrate sequence entries, part 221.
5360. gbvrt222.seq - Other vertebrate sequence entries, part 222.
5361. gbvrt223.seq - Other vertebrate sequence entries, part 223.
5362. gbvrt224.seq - Other vertebrate sequence entries, part 224.
5363. gbvrt225.seq - Other vertebrate sequence entries, part 225.
5364. gbvrt226.seq - Other vertebrate sequence entries, part 226.
5365. gbvrt227.seq - Other vertebrate sequence entries, part 227.
5366. gbvrt228.seq - Other vertebrate sequence entries, part 228.
5367. gbvrt229.seq - Other vertebrate sequence entries, part 229.
5368. gbvrt23.seq - Other vertebrate sequence entries, part 23.
5369. gbvrt230.seq - Other vertebrate sequence entries, part 230.
5370. gbvrt231.seq - Other vertebrate sequence entries, part 231.
5371. gbvrt232.seq - Other vertebrate sequence entries, part 232.
5372. gbvrt233.seq - Other vertebrate sequence entries, part 233.
5373. gbvrt234.seq - Other vertebrate sequence entries, part 234.
5374. gbvrt235.seq - Other vertebrate sequence entries, part 235.
5375. gbvrt236.seq - Other vertebrate sequence entries, part 236.
5376. gbvrt237.seq - Other vertebrate sequence entries, part 237.
5377. gbvrt238.seq - Other vertebrate sequence entries, part 238.
5378. gbvrt239.seq - Other vertebrate sequence entries, part 239.
5379. gbvrt24.seq - Other vertebrate sequence entries, part 24.
5380. gbvrt240.seq - Other vertebrate sequence entries, part 240.
5381. gbvrt241.seq - Other vertebrate sequence entries, part 241.
5382. gbvrt242.seq - Other vertebrate sequence entries, part 242.
5383. gbvrt243.seq - Other vertebrate sequence entries, part 243.
5384. gbvrt244.seq - Other vertebrate sequence entries, part 244.
5385. gbvrt245.seq - Other vertebrate sequence entries, part 245.
5386. gbvrt246.seq - Other vertebrate sequence entries, part 246.
5387. gbvrt247.seq - Other vertebrate sequence entries, part 247.
5388. gbvrt248.seq - Other vertebrate sequence entries, part 248.
5389. gbvrt249.seq - Other vertebrate sequence entries, part 249.
5390. gbvrt25.seq - Other vertebrate sequence entries, part 25.
5391. gbvrt250.seq - Other vertebrate sequence entries, part 250.
5392. gbvrt251.seq - Other vertebrate sequence entries, part 251.
5393. gbvrt252.seq - Other vertebrate sequence entries, part 252.
5394. gbvrt253.seq - Other vertebrate sequence entries, part 253.
5395. gbvrt254.seq - Other vertebrate sequence entries, part 254.
5396. gbvrt255.seq - Other vertebrate sequence entries, part 255.
5397. gbvrt256.seq - Other vertebrate sequence entries, part 256.
5398. gbvrt257.seq - Other vertebrate sequence entries, part 257.
5399. gbvrt258.seq - Other vertebrate sequence entries, part 258.
5400. gbvrt259.seq - Other vertebrate sequence entries, part 259.
5401. gbvrt26.seq - Other vertebrate sequence entries, part 26.
5402. gbvrt260.seq - Other vertebrate sequence entries, part 260.
5403. gbvrt261.seq - Other vertebrate sequence entries, part 261.
5404. gbvrt262.seq - Other vertebrate sequence entries, part 262.
5405. gbvrt263.seq - Other vertebrate sequence entries, part 263.
5406. gbvrt264.seq - Other vertebrate sequence entries, part 264.
5407. gbvrt265.seq - Other vertebrate sequence entries, part 265.
5408. gbvrt266.seq - Other vertebrate sequence entries, part 266.
5409. gbvrt267.seq - Other vertebrate sequence entries, part 267.
5410. gbvrt268.seq - Other vertebrate sequence entries, part 268.
5411. gbvrt269.seq - Other vertebrate sequence entries, part 269.
5412. gbvrt27.seq - Other vertebrate sequence entries, part 27.
5413. gbvrt270.seq - Other vertebrate sequence entries, part 270.
5414. gbvrt271.seq - Other vertebrate sequence entries, part 271.
5415. gbvrt272.seq - Other vertebrate sequence entries, part 272.
5416. gbvrt273.seq - Other vertebrate sequence entries, part 273.
5417. gbvrt274.seq - Other vertebrate sequence entries, part 274.
5418. gbvrt275.seq - Other vertebrate sequence entries, part 275.
5419. gbvrt276.seq - Other vertebrate sequence entries, part 276.
5420. gbvrt277.seq - Other vertebrate sequence entries, part 277.
5421. gbvrt278.seq - Other vertebrate sequence entries, part 278.
5422. gbvrt279.seq - Other vertebrate sequence entries, part 279.
5423. gbvrt28.seq - Other vertebrate sequence entries, part 28.
5424. gbvrt280.seq - Other vertebrate sequence entries, part 280.
5425. gbvrt281.seq - Other vertebrate sequence entries, part 281.
5426. gbvrt282.seq - Other vertebrate sequence entries, part 282.
5427. gbvrt283.seq - Other vertebrate sequence entries, part 283.
5428. gbvrt284.seq - Other vertebrate sequence entries, part 284.
5429. gbvrt285.seq - Other vertebrate sequence entries, part 285.
5430. gbvrt286.seq - Other vertebrate sequence entries, part 286.
5431. gbvrt287.seq - Other vertebrate sequence entries, part 287.
5432. gbvrt288.seq - Other vertebrate sequence entries, part 288.
5433. gbvrt289.seq - Other vertebrate sequence entries, part 289.
5434. gbvrt29.seq - Other vertebrate sequence entries, part 29.
5435. gbvrt290.seq - Other vertebrate sequence entries, part 290.
5436. gbvrt291.seq - Other vertebrate sequence entries, part 291.
5437. gbvrt292.seq - Other vertebrate sequence entries, part 292.
5438. gbvrt293.seq - Other vertebrate sequence entries, part 293.
5439. gbvrt294.seq - Other vertebrate sequence entries, part 294.
5440. gbvrt295.seq - Other vertebrate sequence entries, part 295.
5441. gbvrt296.seq - Other vertebrate sequence entries, part 296.
5442. gbvrt297.seq - Other vertebrate sequence entries, part 297.
5443. gbvrt298.seq - Other vertebrate sequence entries, part 298.
5444. gbvrt299.seq - Other vertebrate sequence entries, part 299.
5445. gbvrt3.seq - Other vertebrate sequence entries, part 3.
5446. gbvrt30.seq - Other vertebrate sequence entries, part 30.
5447. gbvrt300.seq - Other vertebrate sequence entries, part 300.
5448. gbvrt301.seq - Other vertebrate sequence entries, part 301.
5449. gbvrt302.seq - Other vertebrate sequence entries, part 302.
5450. gbvrt303.seq - Other vertebrate sequence entries, part 303.
5451. gbvrt31.seq - Other vertebrate sequence entries, part 31.
5452. gbvrt32.seq - Other vertebrate sequence entries, part 32.
5453. gbvrt33.seq - Other vertebrate sequence entries, part 33.
5454. gbvrt34.seq - Other vertebrate sequence entries, part 34.
5455. gbvrt35.seq - Other vertebrate sequence entries, part 35.
5456. gbvrt36.seq - Other vertebrate sequence entries, part 36.
5457. gbvrt37.seq - Other vertebrate sequence entries, part 37.
5458. gbvrt38.seq - Other vertebrate sequence entries, part 38.
5459. gbvrt39.seq - Other vertebrate sequence entries, part 39.
5460. gbvrt4.seq - Other vertebrate sequence entries, part 4.
5461. gbvrt40.seq - Other vertebrate sequence entries, part 40.
5462. gbvrt41.seq - Other vertebrate sequence entries, part 41.
5463. gbvrt42.seq - Other vertebrate sequence entries, part 42.
5464. gbvrt43.seq - Other vertebrate sequence entries, part 43.
5465. gbvrt44.seq - Other vertebrate sequence entries, part 44.
5466. gbvrt45.seq - Other vertebrate sequence entries, part 45.
5467. gbvrt46.seq - Other vertebrate sequence entries, part 46.
5468. gbvrt47.seq - Other vertebrate sequence entries, part 47.
5469. gbvrt48.seq - Other vertebrate sequence entries, part 48.
5470. gbvrt49.seq - Other vertebrate sequence entries, part 49.
5471. gbvrt5.seq - Other vertebrate sequence entries, part 5.
5472. gbvrt50.seq - Other vertebrate sequence entries, part 50.
5473. gbvrt51.seq - Other vertebrate sequence entries, part 51.
5474. gbvrt52.seq - Other vertebrate sequence entries, part 52.
5475. gbvrt53.seq - Other vertebrate sequence entries, part 53.
5476. gbvrt54.seq - Other vertebrate sequence entries, part 54.
5477. gbvrt55.seq - Other vertebrate sequence entries, part 55.
5478. gbvrt56.seq - Other vertebrate sequence entries, part 56.
5479. gbvrt57.seq - Other vertebrate sequence entries, part 57.
5480. gbvrt58.seq - Other vertebrate sequence entries, part 58.
5481. gbvrt59.seq - Other vertebrate sequence entries, part 59.
5482. gbvrt6.seq - Other vertebrate sequence entries, part 6.
5483. gbvrt60.seq - Other vertebrate sequence entries, part 60.
5484. gbvrt61.seq - Other vertebrate sequence entries, part 61.
5485. gbvrt62.seq - Other vertebrate sequence entries, part 62.
5486. gbvrt63.seq - Other vertebrate sequence entries, part 63.
5487. gbvrt64.seq - Other vertebrate sequence entries, part 64.
5488. gbvrt65.seq - Other vertebrate sequence entries, part 65.
5489. gbvrt66.seq - Other vertebrate sequence entries, part 66.
5490. gbvrt67.seq - Other vertebrate sequence entries, part 67.
5491. gbvrt68.seq - Other vertebrate sequence entries, part 68.
5492. gbvrt69.seq - Other vertebrate sequence entries, part 69.
5493. gbvrt7.seq - Other vertebrate sequence entries, part 7.
5494. gbvrt70.seq - Other vertebrate sequence entries, part 70.
5495. gbvrt71.seq - Other vertebrate sequence entries, part 71.
5496. gbvrt72.seq - Other vertebrate sequence entries, part 72.
5497. gbvrt73.seq - Other vertebrate sequence entries, part 73.
5498. gbvrt74.seq - Other vertebrate sequence entries, part 74.
5499. gbvrt75.seq - Other vertebrate sequence entries, part 75.
5500. gbvrt76.seq - Other vertebrate sequence entries, part 76.
5501. gbvrt77.seq - Other vertebrate sequence entries, part 77.
5502. gbvrt78.seq - Other vertebrate sequence entries, part 78.
5503. gbvrt79.seq - Other vertebrate sequence entries, part 79.
5504. gbvrt8.seq - Other vertebrate sequence entries, part 8.
5505. gbvrt80.seq - Other vertebrate sequence entries, part 80.
5506. gbvrt81.seq - Other vertebrate sequence entries, part 81.
5507. gbvrt82.seq - Other vertebrate sequence entries, part 82.
5508. gbvrt83.seq - Other vertebrate sequence entries, part 83.
5509. gbvrt84.seq - Other vertebrate sequence entries, part 84.
5510. gbvrt85.seq - Other vertebrate sequence entries, part 85.
5511. gbvrt86.seq - Other vertebrate sequence entries, part 86.
5512. gbvrt87.seq - Other vertebrate sequence entries, part 87.
5513. gbvrt88.seq - Other vertebrate sequence entries, part 88.
5514. gbvrt89.seq - Other vertebrate sequence entries, part 89.
5515. gbvrt9.seq - Other vertebrate sequence entries, part 9.
5516. gbvrt90.seq - Other vertebrate sequence entries, part 90.
5517. gbvrt91.seq - Other vertebrate sequence entries, part 91.
5518. gbvrt92.seq - Other vertebrate sequence entries, part 92.
5519. gbvrt93.seq - Other vertebrate sequence entries, part 93.
5520. gbvrt94.seq - Other vertebrate sequence entries, part 94.
5521. gbvrt95.seq - Other vertebrate sequence entries, part 95.
5522. gbvrt96.seq - Other vertebrate sequence entries, part 96.
5523. gbvrt97.seq - Other vertebrate sequence entries, part 97.
5524. gbvrt98.seq - Other vertebrate sequence entries, part 98.
5525. gbvrt99.seq - Other vertebrate sequence entries, part 99.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 250.0 flatfiles require roughly 2585 GB, including the sequence files and the *.txt files.

  The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 499960123     gbbct1.seq
 499653762     gbbct10.seq
 495523592     gbbct100.seq
 300972602     gbbct101.seq
 499886592     gbbct102.seq
 495464939     gbbct103.seq
 496856798     gbbct104.seq
  74937926     gbbct105.seq
 489628476     gbbct106.seq
 499324473     gbbct107.seq
 499932034     gbbct108.seq
 389028332     gbbct109.seq
 499606265     gbbct11.seq
 499874269     gbbct110.seq
 498124520     gbbct111.seq
 499293117     gbbct112.seq
 491408562     gbbct113.seq
  13752576     gbbct114.seq
 493589519     gbbct115.seq
 494745801     gbbct116.seq
 495417216     gbbct117.seq
 491069911     gbbct118.seq
 195549944     gbbct119.seq
 499599563     gbbct12.seq
 494137385     gbbct120.seq
 492532931     gbbct121.seq
 493222843     gbbct122.seq
 497234644     gbbct123.seq
  99480597     gbbct124.seq
 499011110     gbbct125.seq
 494100520     gbbct126.seq
 498830491     gbbct127.seq
 333295075     gbbct128.seq
 490711205     gbbct129.seq
  20743665     gbbct13.seq
 498618689     gbbct130.seq
 499996757     gbbct131.seq
 426872035     gbbct132.seq
 491475645     gbbct133.seq
 489083762     gbbct134.seq
 487156903     gbbct135.seq
 498574632     gbbct136.seq
 490818552     gbbct137.seq
 488627144     gbbct138.seq
 425698518     gbbct139.seq
 499888611     gbbct14.seq
 498287445     gbbct140.seq
 489448234     gbbct141.seq
 499734983     gbbct142.seq
 461302620     gbbct143.seq
 495776348     gbbct144.seq
 493829933     gbbct145.seq
 491661614     gbbct146.seq
 498685419     gbbct147.seq
 499806835     gbbct148.seq
 147979463     gbbct149.seq
 496455164     gbbct15.seq
 497196744     gbbct150.seq
 494839032     gbbct151.seq
 493252206     gbbct152.seq
 494938732     gbbct153.seq
 404787633     gbbct154.seq
 489367744     gbbct155.seq
 490447348     gbbct156.seq
 488202130     gbbct157.seq
 499999904     gbbct158.seq
 497026974     gbbct159.seq
 495906703     gbbct16.seq
 370331919     gbbct160.seq
 497656051     gbbct161.seq
 494967779     gbbct162.seq
 496941187     gbbct163.seq
 489042971     gbbct164.seq
 493287597     gbbct165.seq
 496053153     gbbct166.seq
 159717960     gbbct167.seq
 494734495     gbbct168.seq
 491514334     gbbct169.seq
 480283968     gbbct17.seq
 499168375     gbbct170.seq
 486268160     gbbct171.seq
 497456613     gbbct172.seq
 493190726     gbbct173.seq
 492199014     gbbct174.seq
 491123486     gbbct175.seq
 493968696     gbbct176.seq
 489221514     gbbct177.seq
 497866922     gbbct178.seq
 496180302     gbbct179.seq
  42378335     gbbct18.seq
 195291545     gbbct180.seq
 493675693     gbbct181.seq
 491173977     gbbct182.seq
 499375552     gbbct183.seq
 273476305     gbbct184.seq
 495006064     gbbct185.seq
 495933239     gbbct186.seq
 489790304     gbbct187.seq
 303707273     gbbct188.seq
 499226172     gbbct189.seq
 497718462     gbbct19.seq
 489059042     gbbct190.seq
 495425463     gbbct191.seq
 496022194     gbbct192.seq
  78326760     gbbct193.seq
 498036958     gbbct194.seq
 497779662     gbbct195.seq
 496083279     gbbct196.seq
 496491595     gbbct197.seq
 499747602     gbbct198.seq
 192261499     gbbct199.seq
 497213900     gbbct2.seq
 498773297     gbbct20.seq
 498767719     gbbct200.seq
 497238580     gbbct201.seq
 493963145     gbbct202.seq
 497330862     gbbct203.seq
 275862693     gbbct204.seq
 495095682     gbbct205.seq
 495972090     gbbct206.seq
 496079794     gbbct207.seq
 493223865     gbbct208.seq
 246412484     gbbct209.seq
 498046707     gbbct21.seq
 499817125     gbbct210.seq
 497426653     gbbct211.seq
 497029443     gbbct212.seq
 497533961     gbbct213.seq
 440230499     gbbct214.seq
 499900603     gbbct215.seq
 496011665     gbbct216.seq
 481293430     gbbct217.seq
 496168720     gbbct218.seq
 495262662     gbbct219.seq
 495266104     gbbct22.seq
 497650377     gbbct220.seq
 339346584     gbbct221.seq
 497109801     gbbct222.seq
 493797302     gbbct223.seq
 496714989     gbbct224.seq
 378276833     gbbct225.seq
 484833405     gbbct226.seq
 495933701     gbbct227.seq
 496839536     gbbct228.seq
 499799757     gbbct229.seq
 100599247     gbbct23.seq
 240958865     gbbct230.seq
 493989285     gbbct231.seq
 489510950     gbbct232.seq
 489873084     gbbct233.seq
 185848462     gbbct234.seq
 493893056     gbbct235.seq
 496233264     gbbct236.seq
 493073828     gbbct237.seq
 498684952     gbbct238.seq
 155788816     gbbct239.seq
 492477673     gbbct24.seq
 494063240     gbbct240.seq
 488281700     gbbct241.seq
 489824993     gbbct242.seq
 488530119     gbbct243.seq
 157431691     gbbct244.seq
 483161011     gbbct245.seq
 493212568     gbbct246.seq
 489922665     gbbct247.seq
 495742418     gbbct248.seq
  65305233     gbbct249.seq
 490124448     gbbct25.seq
 492194113     gbbct250.seq
 487559671     gbbct251.seq
 492444662     gbbct252.seq
 467375865     gbbct253.seq
 498159131     gbbct254.seq
 490705855     gbbct255.seq
 496101834     gbbct256.seq
 494852887     gbbct257.seq
 496631621     gbbct258.seq
 145951585     gbbct259.seq
 498214424     gbbct26.seq
 491982954     gbbct260.seq
 488305898     gbbct261.seq
 484960307     gbbct262.seq
 448261454     gbbct263.seq
 496470400     gbbct264.seq
 495798367     gbbct265.seq
 499577801     gbbct266.seq
 462016012     gbbct267.seq
 496061144     gbbct268.seq
 492890741     gbbct269.seq
 495528338     gbbct27.seq
 496405452     gbbct270.seq
 490897395     gbbct271.seq
 487289310     gbbct272.seq
 482078170     gbbct273.seq
 497206795     gbbct274.seq
 180503093     gbbct275.seq
 491163327     gbbct276.seq
 488410873     gbbct277.seq
 498295734     gbbct278.seq
 414251284     gbbct279.seq
 497901239     gbbct28.seq
 497188943     gbbct280.seq
 496648193     gbbct281.seq
 496913777     gbbct282.seq
 458244740     gbbct283.seq
 495338382     gbbct284.seq
 499422429     gbbct285.seq
 499643473     gbbct286.seq
 486051845     gbbct287.seq
 496654751     gbbct288.seq
 495399382     gbbct289.seq
  20405695     gbbct29.seq
 499367559     gbbct290.seq
 498633213     gbbct291.seq
  11142580     gbbct292.seq
 487661820     gbbct293.seq
 490839824     gbbct294.seq
 495725928     gbbct295.seq
 491472988     gbbct296.seq
 499032633     gbbct297.seq
 491225906     gbbct298.seq
 367961410     gbbct299.seq
 301527197     gbbct3.seq
 490496371     gbbct30.seq
 497758570     gbbct300.seq
 491215986     gbbct301.seq
 487093195     gbbct302.seq
 491128384     gbbct303.seq
 402161320     gbbct304.seq
 498731935     gbbct305.seq
 495864523     gbbct306.seq
 496793305     gbbct307.seq
 496383629     gbbct308.seq
 397486819     gbbct309.seq
 493806493     gbbct31.seq
 494855908     gbbct310.seq
 494741773     gbbct311.seq
 499982911     gbbct312.seq
 489769502     gbbct313.seq
 413163748     gbbct314.seq
 498785705     gbbct315.seq
 497116220     gbbct316.seq
 497441705     gbbct317.seq
 497889072     gbbct318.seq
 389356091     gbbct319.seq
 480279995     gbbct32.seq
 491217598     gbbct320.seq
 497116713     gbbct321.seq
 498126204     gbbct322.seq
 498498457     gbbct323.seq
 493195958     gbbct324.seq
  88117885     gbbct325.seq
 497529723     gbbct326.seq
 493930388     gbbct327.seq
 499359813     gbbct328.seq
 486894873     gbbct329.seq
 497453164     gbbct33.seq
 247745271     gbbct330.seq
 495595016     gbbct331.seq
 498471048     gbbct332.seq
 495995379     gbbct333.seq
 494542487     gbbct334.seq
 407613822     gbbct335.seq
 490875198     gbbct336.seq
 488242668     gbbct337.seq
 490121906     gbbct338.seq
 493908662     gbbct339.seq
 148639396     gbbct34.seq
 495699169     gbbct340.seq
 498744196     gbbct341.seq
 498778656     gbbct342.seq
 278865076     gbbct343.seq
 499433385     gbbct344.seq
 496209439     gbbct345.seq
 492654822     gbbct346.seq
 496891973     gbbct347.seq
 498824063     gbbct348.seq
 498314317     gbbct349.seq
 489873765     gbbct35.seq
 238514756     gbbct350.seq
 493830838     gbbct351.seq
 498244047     gbbct352.seq
 498343865     gbbct353.seq
 496449931     gbbct354.seq
 419496455     gbbct355.seq
 499659137     gbbct356.seq
 499503238     gbbct357.seq
 476431292     gbbct358.seq
 497026821     gbbct359.seq
 495831329     gbbct36.seq
 494534767     gbbct360.seq
 499546320     gbbct361.seq
 498187277     gbbct362.seq
  35006477     gbbct363.seq
 488618346     gbbct364.seq
 499584040     gbbct365.seq
 495429420     gbbct366.seq
 497944961     gbbct367.seq
 227268584     gbbct368.seq
 498252735     gbbct369.seq
 491609240     gbbct37.seq
 490196155     gbbct370.seq
 491454197     gbbct371.seq
 499237446     gbbct372.seq
 169554528     gbbct373.seq
 497759853     gbbct374.seq
 496982359     gbbct375.seq
 498637405     gbbct376.seq
 496314465     gbbct377.seq
 494990469     gbbct378.seq
 498638163     gbbct379.seq
 493183570     gbbct38.seq
 491700081     gbbct380.seq
 497027721     gbbct381.seq
 492096290     gbbct382.seq
 494849250     gbbct383.seq
 495221728     gbbct384.seq
 498750157     gbbct385.seq
 499764972     gbbct386.seq
 401015358     gbbct387.seq
 490636086     gbbct388.seq
 490677893     gbbct389.seq
 102625792     gbbct39.seq
 488841167     gbbct390.seq
 499128290     gbbct391.seq
 499013483     gbbct392.seq
 232854502     gbbct393.seq
 495693722     gbbct394.seq
 498256436     gbbct395.seq
 496892690     gbbct396.seq
 494634100     gbbct397.seq
 498671993     gbbct398.seq
 421485210     gbbct399.seq
 394703759     gbbct4.seq
 495486407     gbbct40.seq
 496814061     gbbct400.seq
 491384339     gbbct401.seq
 496516498     gbbct402.seq
 494235461     gbbct403.seq
 495175714     gbbct404.seq
 491231492     gbbct405.seq
 470881324     gbbct406.seq
 493251108     gbbct407.seq
 497639970     gbbct408.seq
 491629237     gbbct409.seq
 498094797     gbbct41.seq
 499405757     gbbct410.seq
 196568573     gbbct411.seq
 484011538     gbbct412.seq
 499765661     gbbct413.seq
 496608197     gbbct414.seq
 498277861     gbbct415.seq
 453637929     gbbct416.seq
 499135588     gbbct417.seq
 497267883     gbbct418.seq
 495502054     gbbct419.seq
 499225670     gbbct42.seq
 495882318     gbbct420.seq
 278806854     gbbct421.seq
 499760245     gbbct422.seq
 499536713     gbbct423.seq
 490460559     gbbct424.seq
 499918342     gbbct425.seq
 186166662     gbbct426.seq
 499863872     gbbct427.seq
 494745082     gbbct428.seq
 499039957     gbbct429.seq
 498605338     gbbct43.seq
 499029875     gbbct430.seq
  59066813     gbbct431.seq
 494159569     gbbct432.seq
 494444916     gbbct433.seq
 493696745     gbbct434.seq
 499965064     gbbct435.seq
  27014534     gbbct436.seq
 493426836     gbbct437.seq
 490784357     gbbct438.seq
 495844042     gbbct439.seq
  62904852     gbbct44.seq
 498701200     gbbct440.seq
 496852281     gbbct441.seq
 281237944     gbbct442.seq
 498313997     gbbct443.seq
 491989656     gbbct444.seq
 492620858     gbbct445.seq
 489060303     gbbct446.seq
 495318626     gbbct447.seq
 499984617     gbbct448.seq
 276043539     gbbct449.seq
  21430602     gbbct45.seq
 499390053     gbbct450.seq
 499625068     gbbct451.seq
 498435906     gbbct452.seq
 488344291     gbbct453.seq
  45056260     gbbct454.seq
 485664615     gbbct455.seq
 492762413     gbbct456.seq
 493976853     gbbct457.seq
 498618461     gbbct458.seq
 495051282     gbbct459.seq
  38683737     gbbct46.seq
 483776237     gbbct460.seq
 492629572     gbbct461.seq
 497576724     gbbct462.seq
 491148551     gbbct463.seq
 495372584     gbbct464.seq
 172098662     gbbct465.seq
 488400037     gbbct466.seq
 497609771     gbbct467.seq
 493602253     gbbct468.seq
 499477169     gbbct469.seq
 499627586     gbbct47.seq
 490837917     gbbct470.seq
 457708908     gbbct471.seq
 494383928     gbbct472.seq
 493402330     gbbct473.seq
 495774412     gbbct474.seq
 498340244     gbbct475.seq
 190485650     gbbct476.seq
 499708889     gbbct477.seq
 491164106     gbbct478.seq
 493296685     gbbct479.seq
 494570659     gbbct48.seq
 484617824     gbbct480.seq
 499391109     gbbct481.seq
 499652627     gbbct482.seq
 497680015     gbbct483.seq
 447953487     gbbct484.seq
 490781298     gbbct485.seq
 499411338     gbbct486.seq
 488508146     gbbct487.seq
 495393960     gbbct488.seq
 497610212     gbbct489.seq
 495665539     gbbct49.seq
 497559225     gbbct490.seq
 151423912     gbbct491.seq
 497835321     gbbct492.seq
 496273118     gbbct493.seq
 496820682     gbbct494.seq
 499164005     gbbct495.seq
 495385396     gbbct496.seq
 492903020     gbbct497.seq
 469284424     gbbct498.seq
 496835329     gbbct499.seq
 440954049     gbbct5.seq
 456123465     gbbct50.seq
 494150180     gbbct500.seq
 499232469     gbbct501.seq
 494444036     gbbct502.seq
  53420662     gbbct503.seq
 495729691     gbbct504.seq
 492060071     gbbct505.seq
 488395740     gbbct506.seq
 499963233     gbbct507.seq
 107420673     gbbct508.seq
 495080878     gbbct509.seq
 497462792     gbbct51.seq
 496630443     gbbct510.seq
 497010646     gbbct511.seq
 495555894     gbbct512.seq
 494316466     gbbct513.seq
 496448757     gbbct514.seq
 491371681     gbbct515.seq
  94616304     gbbct516.seq
 490091633     gbbct517.seq
 489093207     gbbct518.seq
 498249902     gbbct519.seq
 491184233     gbbct52.seq
 491852660     gbbct520.seq
 490633715     gbbct521.seq
 282904096     gbbct522.seq
 499357622     gbbct523.seq
 494394440     gbbct524.seq
 497807033     gbbct525.seq
 497663420     gbbct526.seq
 496132554     gbbct527.seq
  99498945     gbbct528.seq
 496528449     gbbct529.seq
 489161752     gbbct53.seq
 499978574     gbbct530.seq
 488711404     gbbct531.seq
 491150002     gbbct532.seq
 388077674     gbbct533.seq
 489360452     gbbct534.seq
 495902842     gbbct535.seq
 493146544     gbbct536.seq
 489303264     gbbct537.seq
 330971744     gbbct538.seq
 491893098     gbbct539.seq
 497807974     gbbct54.seq
 491537787     gbbct540.seq
 489571412     gbbct541.seq
 494469799     gbbct542.seq
 499309682     gbbct543.seq
 402852331     gbbct544.seq
 499621472     gbbct545.seq
 492245040     gbbct546.seq
 490237068     gbbct547.seq
 484475168     gbbct548.seq
 493646961     gbbct549.seq
 498887712     gbbct55.seq
  61148404     gbbct550.seq
 492186695     gbbct551.seq
 493995736     gbbct552.seq
 499588779     gbbct553.seq
 497083702     gbbct554.seq
 488151539     gbbct555.seq
  48022506     gbbct556.seq
 493987178     gbbct557.seq
 497655977     gbbct558.seq
 493794543     gbbct559.seq
 301819107     gbbct56.seq
 494371412     gbbct560.seq
 498675396     gbbct561.seq
 239598609     gbbct562.seq
 497140308     gbbct563.seq
 489864836     gbbct564.seq
 496866130     gbbct565.seq
 488464498     gbbct566.seq
 498214481     gbbct567.seq
 175996861     gbbct568.seq
 491634870     gbbct569.seq
 496359147     gbbct57.seq
 498516802     gbbct570.seq
 487812847     gbbct571.seq
 493626857     gbbct572.seq
 494656235     gbbct573.seq
  98529209     gbbct574.seq
 497742753     gbbct575.seq
 488679967     gbbct576.seq
 492109864     gbbct577.seq
 499163959     gbbct578.seq
 493125104     gbbct579.seq
 491310649     gbbct58.seq
 100470688     gbbct580.seq
 493727484     gbbct581.seq
 497904548     gbbct582.seq
 497678451     gbbct583.seq
 496985206     gbbct584.seq
 496770539     gbbct585.seq
 480350751     gbbct586.seq
 487995484     gbbct587.seq
 491989488     gbbct588.seq
 498944192     gbbct589.seq
 499896991     gbbct59.seq
 492246261     gbbct590.seq
 493358474     gbbct591.seq
 495408525     gbbct592.seq
 181789315     gbbct593.seq
 490253458     gbbct594.seq
 492040181     gbbct595.seq
 498474142     gbbct596.seq
 498064653     gbbct597.seq
 496993254     gbbct598.seq
 498979060     gbbct599.seq
 102235980     gbbct6.seq
 492176884     gbbct60.seq
 196152604     gbbct600.seq
 495614016     gbbct601.seq
 496299141     gbbct602.seq
 498890156     gbbct603.seq
 496725938     gbbct604.seq
 384830585     gbbct605.seq
 494523221     gbbct606.seq
 494889219     gbbct607.seq
 488862316     gbbct608.seq
 499005930     gbbct609.seq
 494853959     gbbct61.seq
 499113396     gbbct610.seq
 495695463     gbbct611.seq
 383424117     gbbct612.seq
 499774526     gbbct613.seq
 493409641     gbbct614.seq
 499795186     gbbct615.seq
 498823396     gbbct616.seq
 284336059     gbbct617.seq
 494999428     gbbct618.seq
 489006318     gbbct619.seq
 356563221     gbbct62.seq
 496702304     gbbct620.seq
 495342502     gbbct621.seq
 498785459     gbbct622.seq
 482273579     gbbct623.seq
 499189088     gbbct624.seq
 463371552     gbbct625.seq
 493254956     gbbct626.seq
 494275275     gbbct627.seq
 498507767     gbbct628.seq
 490133210     gbbct629.seq
 499974802     gbbct63.seq
  12265360     gbbct630.seq
 497895766     gbbct631.seq
 496924020     gbbct632.seq
 494433349     gbbct633.seq
 487998784     gbbct634.seq
  51472802     gbbct635.seq
 498573429     gbbct636.seq
 499143012     gbbct637.seq
 498428965     gbbct638.seq
 497666250     gbbct639.seq
 492293496     gbbct64.seq
  44611187     gbbct640.seq
 499869647     gbbct641.seq
 498772148     gbbct642.seq
 489602646     gbbct643.seq
 499574287     gbbct644.seq
 330220220     gbbct645.seq
 491761765     gbbct646.seq
 493761555     gbbct647.seq
 499981441     gbbct648.seq
 489713905     gbbct649.seq
 489450472     gbbct65.seq
 485397800     gbbct650.seq
 489374489     gbbct651.seq
 492746281     gbbct652.seq
 494855921     gbbct653.seq
 499345435     gbbct654.seq
 250862877     gbbct655.seq
 499262531     gbbct656.seq
 497471906     gbbct657.seq
 488195564     gbbct658.seq
 499498745     gbbct659.seq
 497371670     gbbct66.seq
 445068227     gbbct660.seq
 498010705     gbbct661.seq
 498376464     gbbct662.seq
 492161539     gbbct663.seq
 489453384     gbbct664.seq
 496998721     gbbct665.seq
 496763885     gbbct666.seq
 496618331     gbbct667.seq
 272767243     gbbct668.seq
 499151211     gbbct669.seq
 499930625     gbbct67.seq
 491102958     gbbct670.seq
 496162669     gbbct671.seq
 494580965     gbbct672.seq
 496218082     gbbct673.seq
   7847546     gbbct674.seq
 489461081     gbbct675.seq
 493156973     gbbct676.seq
 490547295     gbbct677.seq
 489070385     gbbct678.seq
 410188647     gbbct679.seq
 495181079     gbbct68.seq
 498507873     gbbct680.seq
 489186328     gbbct681.seq
 497647100     gbbct682.seq
 498388448     gbbct683.seq
 232195177     gbbct684.seq
 497208002     gbbct685.seq
 499273629     gbbct686.seq
 497263133     gbbct687.seq
 493751307     gbbct688.seq
  36967975     gbbct689.seq
 112142538     gbbct69.seq
 492376847     gbbct690.seq
 496777667     gbbct691.seq
 497457156     gbbct692.seq
 495267875     gbbct693.seq
  18558582     gbbct694.seq
 498867734     gbbct695.seq
 498750941     gbbct696.seq
 499886593     gbbct697.seq
 495492995     gbbct698.seq
 233637702     gbbct699.seq
 282579843     gbbct7.seq
 494608197     gbbct70.seq
 305795637     gbbct700.seq
   6891290     gbbct701.seq
  14169822     gbbct702.seq
  22803109     gbbct703.seq
  44506009     gbbct704.seq
  86655416     gbbct705.seq
 168600818     gbbct706.seq
 499999994     gbbct707.seq
 492955060     gbbct708.seq
 499529765     gbbct709.seq
 499071761     gbbct71.seq
 499960899     gbbct710.seq
 498208516     gbbct711.seq
 499998693     gbbct712.seq
 131085244     gbbct713.seq
 493499827     gbbct714.seq
 499364045     gbbct715.seq
 484377678     gbbct716.seq
 499999128     gbbct717.seq
 219022347     gbbct718.seq
 499999115     gbbct719.seq
 496563929     gbbct72.seq
 291278758     gbbct720.seq
 499999989     gbbct721.seq
  85777708     gbbct722.seq
 500000180     gbbct723.seq
 125677108     gbbct724.seq
 499996550     gbbct725.seq
  44320859     gbbct726.seq
 146580364     gbbct727.seq
 499982158     gbbct728.seq
 491465669     gbbct729.seq
 497568334     gbbct73.seq
  47125493     gbbct730.seq
 497123457     gbbct731.seq
 489941240     gbbct732.seq
 493050121     gbbct733.seq
 497933357     gbbct734.seq
 497254622     gbbct735.seq
 488464410     gbbct736.seq
 305471094     gbbct737.seq
 495496654     gbbct738.seq
 498006132     gbbct739.seq
 499752685     gbbct74.seq
 498177811     gbbct740.seq
 168613526     gbbct741.seq
 472462187     gbbct742.seq
 497339601     gbbct743.seq
 497110838     gbbct744.seq
 499752508     gbbct745.seq
 137358079     gbbct746.seq
 487532831     gbbct747.seq
 498131104     gbbct748.seq
 496359051     gbbct749.seq
 490382330     gbbct75.seq
 379404234     gbbct750.seq
 498499361     gbbct751.seq
 497461802     gbbct752.seq
 491674470     gbbct753.seq
 325905521     gbbct754.seq
 496306965     gbbct755.seq
 497542057     gbbct756.seq
 499056174     gbbct757.seq
 243474309     gbbct758.seq
 492632956     gbbct759.seq
 257413073     gbbct76.seq
 496920960     gbbct760.seq
 498726137     gbbct761.seq
 498560157     gbbct762.seq
 105689420     gbbct763.seq
 496401442     gbbct764.seq
 489823080     gbbct765.seq
 498850995     gbbct766.seq
 457166828     gbbct767.seq
  51247575     gbbct768.seq
 107909227     gbbct769.seq
 499969440     gbbct77.seq
 499998497     gbbct770.seq
 499997287     gbbct771.seq
 413551633     gbbct772.seq
 499999708     gbbct773.seq
 499998751     gbbct774.seq
 498896419     gbbct775.seq
 380174344     gbbct776.seq
 488470685     gbbct777.seq
 492075745     gbbct778.seq
 491137137     gbbct779.seq
 495194025     gbbct78.seq
 498788853     gbbct780.seq
 488387528     gbbct781.seq
 488464657     gbbct782.seq
  26137781     gbbct783.seq
 498338738     gbbct784.seq
 498433840     gbbct785.seq
 495474042     gbbct786.seq
 497231939     gbbct787.seq
 498461401     gbbct788.seq
 443882029     gbbct789.seq
 486287702     gbbct79.seq
 493057048     gbbct8.seq
 493211239     gbbct80.seq
 464467981     gbbct81.seq
 490192709     gbbct82.seq
 485838948     gbbct83.seq
 497985142     gbbct84.seq
 498937215     gbbct85.seq
 306897287     gbbct86.seq
 491474356     gbbct87.seq
 494310085     gbbct88.seq
 495814035     gbbct89.seq
 493342095     gbbct9.seq
 498718254     gbbct90.seq
 499103639     gbbct91.seq
 261686782     gbbct92.seq
 498131306     gbbct93.seq
 499519654     gbbct94.seq
 498962944     gbbct95.seq
 488108543     gbbct96.seq
 397950786     gbbct97.seq
 498261726     gbbct98.seq
 492775826     gbbct99.seq
    976230     gbchg.txt
 499815830     gbcon1.seq
 498782226     gbcon10.seq
 499999827     gbcon100.seq
 364586198     gbcon101.seq
 499993697     gbcon102.seq
 499999905     gbcon103.seq
 386119956     gbcon104.seq
 499993763     gbcon105.seq
 472811182     gbcon106.seq
 174082387     gbcon107.seq
 499969506     gbcon108.seq
  23946022     gbcon109.seq
 499862029     gbcon11.seq
 499984380     gbcon110.seq
 205111589     gbcon111.seq
 199581543     gbcon112.seq
 499269900     gbcon113.seq
 499996644     gbcon114.seq
 338965108     gbcon115.seq
 499532058     gbcon116.seq
 495874813     gbcon117.seq
 499836779     gbcon118.seq
 226684285     gbcon119.seq
 498670573     gbcon12.seq
 499985376     gbcon120.seq
 499999544     gbcon121.seq
 499404143     gbcon122.seq
 168813353     gbcon123.seq
 499999373     gbcon124.seq
 499999398     gbcon125.seq
 131835036     gbcon126.seq
 499990648     gbcon127.seq
 499998736     gbcon128.seq
 499997418     gbcon129.seq
 499513772     gbcon13.seq
 266670628     gbcon130.seq
 499998865     gbcon131.seq
 499996530     gbcon132.seq
 169680627     gbcon133.seq
 498573535     gbcon134.seq
 497575212     gbcon135.seq
 499998319     gbcon136.seq
 499945732     gbcon137.seq
 298259760     gbcon138.seq
 499956041     gbcon139.seq
 496523716     gbcon14.seq
 499999027     gbcon140.seq
 302798114     gbcon141.seq
 500000227     gbcon142.seq
 499998799     gbcon143.seq
 132535059     gbcon144.seq
 499987403     gbcon145.seq
 499997957     gbcon146.seq
 499786713     gbcon147.seq
 277075009     gbcon148.seq
 499999876     gbcon149.seq
 498684986     gbcon15.seq
 499999395     gbcon150.seq
 222253215     gbcon151.seq
  45836617     gbcon152.seq
 499997550     gbcon153.seq
 499999703     gbcon154.seq
 447041410     gbcon155.seq
 499998084     gbcon156.seq
 499999787     gbcon157.seq
 499995531     gbcon158.seq
 198120694     gbcon159.seq
 257460683     gbcon16.seq
 499995599     gbcon160.seq
 499998760     gbcon161.seq
 238758219     gbcon162.seq
 499998528     gbcon163.seq
 467678609     gbcon164.seq
 499998079     gbcon165.seq
 499998058     gbcon166.seq
 260380073     gbcon167.seq
 499999022     gbcon168.seq
 499999683     gbcon169.seq
 492307692     gbcon17.seq
 498175651     gbcon170.seq
 499999617     gbcon171.seq
 499996334     gbcon172.seq
 179609408     gbcon173.seq
 499998561     gbcon174.seq
 499997527     gbcon175.seq
  23249966     gbcon176.seq
 499889958     gbcon177.seq
 499998608     gbcon178.seq
 410313876     gbcon179.seq
 301987525     gbcon18.seq
 499999518     gbcon180.seq
 499987779     gbcon181.seq
 378623858     gbcon182.seq
 499997936     gbcon183.seq
 499971816     gbcon184.seq
 264849660     gbcon185.seq
 499997218     gbcon186.seq
 499999328     gbcon187.seq
  78099525     gbcon188.seq
 500000141     gbcon189.seq
 388993918     gbcon19.seq
 499799225     gbcon190.seq
 499994670     gbcon191.seq
 143068769     gbcon192.seq
 499831115     gbcon193.seq
 499975648     gbcon194.seq
 499972444     gbcon195.seq
 336313296     gbcon196.seq
 499996424     gbcon197.seq
 499999419     gbcon198.seq
 399092417     gbcon199.seq
 499998862     gbcon2.seq
 484829758     gbcon20.seq
 499998956     gbcon200.seq
 499998687     gbcon201.seq
 499997649     gbcon202.seq
 272414595     gbcon203.seq
 499999711     gbcon204.seq
 499998667     gbcon205.seq
 499706793     gbcon206.seq
 499997666     gbcon207.seq
 154988223     gbcon208.seq
 499999293     gbcon209.seq
 409359422     gbcon21.seq
 499995812     gbcon210.seq
 135787869     gbcon211.seq
 499994951     gbcon212.seq
 499997020     gbcon213.seq
 499998672     gbcon214.seq
 299087302     gbcon215.seq
 499981966     gbcon216.seq
 499996413     gbcon217.seq
 474625246     gbcon218.seq
 499998676     gbcon219.seq
 383534805     gbcon22.seq
 499983543     gbcon220.seq
 397782244     gbcon221.seq
 499943427     gbcon222.seq
 499998582     gbcon223.seq
 499999289     gbcon224.seq
 139597999     gbcon225.seq
 499998392     gbcon226.seq
 499998372     gbcon227.seq
  37871910     gbcon228.seq
 499997011     gbcon229.seq
 423037964     gbcon23.seq
 499999819     gbcon230.seq
 499996104     gbcon231.seq
 499999364     gbcon232.seq
 499888972     gbcon233.seq
 277027354     gbcon234.seq
 499999940     gbcon235.seq
 484917663     gbcon236.seq
 499996483     gbcon237.seq
 499978966     gbcon238.seq
 499999072     gbcon239.seq
 398152410     gbcon24.seq
   9283389     gbcon240.seq
 499999292     gbcon241.seq
 499995492     gbcon242.seq
 499998812     gbcon243.seq
  13946366     gbcon244.seq
 499819693     gbcon245.seq
 499989478     gbcon246.seq
 499997209     gbcon247.seq
 277682634     gbcon248.seq
 499898455     gbcon249.seq
 333262378     gbcon25.seq
 499856643     gbcon250.seq
 499991783     gbcon251.seq
 313205301     gbcon252.seq
 499975738     gbcon253.seq
 499998137     gbcon254.seq
 499915281     gbcon255.seq
 500000207     gbcon256.seq
 499782562     gbcon257.seq
 499926763     gbcon258.seq
 269865574     gbcon259.seq
 349736674     gbcon26.seq
 463161134     gbcon27.seq
 399226196     gbcon28.seq
 479716145     gbcon29.seq
 499996773     gbcon3.seq
 495336918     gbcon30.seq
 490924085     gbcon31.seq
 485457887     gbcon32.seq
 409898801     gbcon33.seq
 384460749     gbcon34.seq
 425895722     gbcon35.seq
 399082685     gbcon36.seq
 338846333     gbcon37.seq
 474661478     gbcon38.seq
 475605979     gbcon39.seq
 106579732     gbcon4.seq
 428247910     gbcon40.seq
 471973611     gbcon41.seq
 421633024     gbcon42.seq
 427506340     gbcon43.seq
 417845065     gbcon44.seq
 424878731     gbcon45.seq
 484173947     gbcon46.seq
 499856282     gbcon47.seq
 494237972     gbcon48.seq
 499837762     gbcon49.seq
 499940282     gbcon5.seq
 176948681     gbcon50.seq
 499999541     gbcon51.seq
 499997735     gbcon52.seq
 499999109     gbcon53.seq
  83469174     gbcon54.seq
 499999901     gbcon55.seq
 499630334     gbcon56.seq
 499148099     gbcon57.seq
 314690312     gbcon58.seq
 499452860     gbcon59.seq
 494454587     gbcon6.seq
 126525272     gbcon60.seq
 126587128     gbcon61.seq
 499912359     gbcon62.seq
 499998468     gbcon63.seq
  27859502     gbcon64.seq
 499999414     gbcon65.seq
 499998297     gbcon66.seq
 444037905     gbcon67.seq
 499999057     gbcon68.seq
 499998568     gbcon69.seq
 494751901     gbcon7.seq
 499999100     gbcon70.seq
  41918782     gbcon71.seq
 500000081     gbcon72.seq
 499998540     gbcon73.seq
 277009775     gbcon74.seq
 499996336     gbcon75.seq
 499998469     gbcon76.seq
 270612827     gbcon77.seq
 499996532     gbcon78.seq
 499996905     gbcon79.seq
 499999276     gbcon8.seq
 385374935     gbcon80.seq
 499997390     gbcon81.seq
 499999185     gbcon82.seq
 176580283     gbcon83.seq
 499999848     gbcon84.seq
 499997718     gbcon85.seq
 238773972     gbcon86.seq
 499997628     gbcon87.seq
 499995125     gbcon88.seq
 335698760     gbcon89.seq
  61944737     gbcon9.seq
 499996299     gbcon90.seq
 499999132     gbcon91.seq
 298461041     gbcon92.seq
 499995314     gbcon93.seq
 499999014     gbcon94.seq
 259899669     gbcon95.seq
 499996880     gbcon96.seq
 499997062     gbcon97.seq
 187377116     gbcon98.seq
 499996720     gbcon99.seq
     80394     gbdel.txt
 499999226     gbenv1.seq
 499999933     gbenv10.seq
 469665365     gbenv11.seq
 499996910     gbenv12.seq
 499998285     gbenv13.seq
  53849346     gbenv14.seq
 499998573     gbenv15.seq
 499998309     gbenv16.seq
 499999982     gbenv17.seq
 499999758     gbenv18.seq
   3580579     gbenv19.seq
 500000107     gbenv2.seq
 499999648     gbenv20.seq
 500000260     gbenv21.seq
 190578196     gbenv22.seq
 499975501     gbenv23.seq
 499999037     gbenv24.seq
 499999229     gbenv25.seq
  83990187     gbenv26.seq
 499998395     gbenv27.seq
 499999474     gbenv28.seq
 177757620     gbenv29.seq
 352243670     gbenv3.seq
 499999990     gbenv30.seq
 499997176     gbenv31.seq
 499999207     gbenv32.seq
  46460005     gbenv33.seq
 499999352     gbenv34.seq
 499998306     gbenv35.seq
 192785390     gbenv36.seq
 499997960     gbenv37.seq
 499999555     gbenv38.seq
 334974184     gbenv39.seq
 498296040     gbenv4.seq
 499999312     gbenv40.seq
 499998458     gbenv41.seq
 471459939     gbenv42.seq
 499999097     gbenv43.seq
 499998441     gbenv44.seq
 338681611     gbenv45.seq
 499998421     gbenv46.seq
 499998661     gbenv47.seq
 394516243     gbenv48.seq
 499999355     gbenv49.seq
 498348808     gbenv5.seq
 499998481     gbenv50.seq
 345548899     gbenv51.seq
 499999002     gbenv52.seq
 499998880     gbenv53.seq
 237965736     gbenv54.seq
 499999874     gbenv55.seq
 499999294     gbenv56.seq
 391165226     gbenv57.seq
 499999724     gbenv58.seq
 499995985     gbenv59.seq
 497804030     gbenv6.seq
 499998826     gbenv60.seq
 112627266     gbenv61.seq
 500000261     gbenv62.seq
 499999838     gbenv63.seq
 499997614     gbenv64.seq
 212382900     gbenv65.seq
 499998666     gbenv66.seq
 499956219     gbenv67.seq
 499997974     gbenv68.seq
 499997981     gbenv69.seq
 481339727     gbenv7.seq
 484979929     gbenv70.seq
 497122861     gbenv8.seq
 497820007     gbenv9.seq
 499999886     gbest1.seq
 499998754     gbest10.seq
 499997424     gbest100.seq
 500000102     gbest101.seq
 499997928     gbest102.seq
 499998096     gbest103.seq
  27058254     gbest104.seq
 499996554     gbest105.seq
 499997290     gbest106.seq
 499999575     gbest107.seq
 499999528     gbest108.seq
   9862063     gbest109.seq
 499997630     gbest11.seq
 500000213     gbest110.seq
 499997713     gbest111.seq
 499999576     gbest112.seq
 499998985     gbest113.seq
  21759790     gbest114.seq
 500000014     gbest115.seq
 499999248     gbest116.seq
 499999583     gbest117.seq
  17679403     gbest118.seq
 499998016     gbest119.seq
 475534456     gbest12.seq
 499998546     gbest120.seq
 499997661     gbest121.seq
  69242600     gbest122.seq
 499997996     gbest123.seq
 499996364     gbest124.seq
 223780385     gbest125.seq
 499997461     gbest126.seq
 499998633     gbest127.seq
 195307357     gbest128.seq
 499997173     gbest129.seq
 499998511     gbest13.seq
 499998792     gbest130.seq
 499995025     gbest131.seq
 499996839     gbest132.seq
  85321549     gbest133.seq
 499999011     gbest134.seq
 500000103     gbest135.seq
 499997620     gbest136.seq
 499998847     gbest137.seq
 103557175     gbest138.seq
 499999885     gbest139.seq
 249982659     gbest14.seq
 499996904     gbest140.seq
 500000218     gbest141.seq
 499998495     gbest142.seq
  28439876     gbest143.seq
 499998590     gbest144.seq
 500000094     gbest145.seq
 499997472     gbest146.seq
 500000048     gbest147.seq
  30910652     gbest148.seq
 499998615     gbest149.seq
 499999796     gbest15.seq
 500000160     gbest150.seq
 499997750     gbest151.seq
 324374809     gbest152.seq
 499997344     gbest153.seq
 499999008     gbest154.seq
 499996792     gbest155.seq
 499998093     gbest156.seq
  26483164     gbest157.seq
 499999138     gbest158.seq
 499998999     gbest159.seq
 499999839     gbest16.seq
 499996120     gbest160.seq
 499998492     gbest161.seq
  11183156     gbest162.seq
 499999738     gbest163.seq
 499999333     gbest164.seq
 499999672     gbest165.seq
 499996585     gbest166.seq
  86372124     gbest167.seq
 500000180     gbest168.seq
 499996624     gbest169.seq
 421346801     gbest17.seq
 499997982     gbest170.seq
 499996832     gbest171.seq
 120388331     gbest172.seq
 499998796     gbest173.seq
 499999076     gbest174.seq
 500000124     gbest175.seq
 500000114     gbest176.seq
  65991139     gbest177.seq
 499999609     gbest178.seq
 403619645     gbest179.seq
 499999551     gbest18.seq
 500000063     gbest180.seq
 500000137     gbest181.seq
 499998032     gbest182.seq
 499996516     gbest183.seq
  42970207     gbest184.seq
 499999115     gbest185.seq
 499997688     gbest186.seq
 499998302     gbest187.seq
 499999590     gbest188.seq
  42185730     gbest189.seq
 499996867     gbest19.seq
 499999341     gbest190.seq
 499997807     gbest191.seq
 499998290     gbest192.seq
 499999140     gbest193.seq
  11541139     gbest194.seq
 499997160     gbest195.seq
 499998835     gbest196.seq
 499997852     gbest197.seq
 499997570     gbest198.seq
  28655853     gbest199.seq
 499997555     gbest2.seq
 263017478     gbest20.seq
 499998890     gbest200.seq
 499998663     gbest201.seq
 499999453     gbest202.seq
 499998138     gbest203.seq
  34237970     gbest204.seq
  13610371     gbest205.seq
 499997974     gbest206.seq
 499999353     gbest207.seq
 329515111     gbest208.seq
 499997954     gbest209.seq
 499995775     gbest21.seq
 500000064     gbest210.seq
 321738245     gbest211.seq
 499999450     gbest212.seq
 499998729     gbest213.seq
 267108910     gbest214.seq
 499997062     gbest215.seq
 499999494     gbest216.seq
 270108380     gbest217.seq
 499997879     gbest218.seq
 499999743     gbest219.seq
 499998528     gbest22.seq
 499997823     gbest220.seq
 499998986     gbest221.seq
  51988594     gbest222.seq
 499998521     gbest223.seq
 499998333     gbest224.seq
 499998770     gbest225.seq
 499998156     gbest226.seq
  47735872     gbest227.seq
 499998310     gbest228.seq
 499999275     gbest229.seq
 244413174     gbest23.seq
 176584566     gbest230.seq
 500000143     gbest231.seq
 499999766     gbest232.seq
 499999388     gbest233.seq
 478350574     gbest234.seq
 499997785     gbest235.seq
 499999603     gbest236.seq
 499997429     gbest237.seq
 462328784     gbest238.seq
 499999067     gbest239.seq
 500000235     gbest24.seq
 499999466     gbest240.seq
 499999246     gbest241.seq
 495323447     gbest242.seq
 499999965     gbest243.seq
 499998071     gbest244.seq
 499999534     gbest245.seq
 499997094     gbest246.seq
  25247852     gbest247.seq
 499999109     gbest248.seq
 499998401     gbest249.seq
 499997506     gbest25.seq
 497267371     gbest250.seq
 499999018     gbest251.seq
 499998363     gbest252.seq
 499998003     gbest253.seq
 499998663     gbest254.seq
  21635727     gbest255.seq
 499997327     gbest256.seq
 499995735     gbest257.seq
 499996372     gbest258.seq
 500000180     gbest259.seq
 499999489     gbest26.seq
  76689108     gbest260.seq
 499998250     gbest261.seq
 499999717     gbest262.seq
 499999134     gbest263.seq
 499998423     gbest264.seq
  15135427     gbest265.seq
 499996394     gbest266.seq
 499999425     gbest267.seq
 499999393     gbest268.seq
 499998368     gbest269.seq
 500000205     gbest27.seq
  61129532     gbest270.seq
 499998700     gbest271.seq
 499999812     gbest272.seq
 499999979     gbest273.seq
 122782773     gbest274.seq
 499996420     gbest275.seq
 499998292     gbest276.seq
 499997583     gbest277.seq
 499997855     gbest278.seq
  54158997     gbest279.seq
  49054642     gbest28.seq
 500000179     gbest280.seq
 499997326     gbest281.seq
 499998024     gbest282.seq
 499999881     gbest283.seq
  57202966     gbest284.seq
 499999206     gbest285.seq
 499997873     gbest286.seq
 499996291     gbest287.seq
 499997209     gbest288.seq
  12666863     gbest289.seq
 499998393     gbest29.seq
 500000262     gbest290.seq
 499999019     gbest291.seq
 499998375     gbest292.seq
 499998356     gbest293.seq
  25130664     gbest294.seq
 499999905     gbest295.seq
 499999169     gbest296.seq
 485346130     gbest297.seq
 499998242     gbest298.seq
 499997484     gbest299.seq
 499998490     gbest3.seq
 499999804     gbest30.seq
 499999366     gbest300.seq
 499998973     gbest301.seq
   5732932     gbest302.seq
 499999157     gbest303.seq
 499998877     gbest304.seq
 499997385     gbest305.seq
 499999779     gbest306.seq
   8706078     gbest307.seq
 499999368     gbest308.seq
 499998936     gbest309.seq
 499999240     gbest31.seq
 499997307     gbest310.seq
 425297121     gbest311.seq
 499998617     gbest312.seq
 499998547     gbest313.seq
 499997281     gbest314.seq
 499998689     gbest315.seq
   2054700     gbest316.seq
 499999089     gbest317.seq
 499997897     gbest318.seq
 469362314     gbest319.seq
 487176114     gbest32.seq
 499999477     gbest320.seq
 499998262     gbest321.seq
 499999719     gbest322.seq
 499998371     gbest323.seq
  40423642     gbest324.seq
 499997688     gbest325.seq
 499998667     gbest326.seq
 499998299     gbest327.seq
 494524513     gbest328.seq
 499998307     gbest329.seq
 499996463     gbest33.seq
 499996037     gbest330.seq
 499998365     gbest331.seq
 499999051     gbest332.seq
  57725922     gbest333.seq
 500000164     gbest334.seq
 500000124     gbest335.seq
 499998630     gbest336.seq
 469710586     gbest337.seq
 499999439     gbest338.seq
 499999631     gbest339.seq
 499996810     gbest34.seq
 500000074     gbest340.seq
 499995997     gbest341.seq
  20360910     gbest342.seq
 499999075     gbest343.seq
 493045559     gbest344.seq
 499999999     gbest345.seq
 499997876     gbest346.seq
 499997587     gbest347.seq
 500000073     gbest348.seq
   7042931     gbest349.seq
 499999828     gbest35.seq
 499998300     gbest350.seq
 499998245     gbest351.seq
 499999943     gbest352.seq
 445169682     gbest353.seq
 499999670     gbest354.seq
 499999568     gbest355.seq
 500000244     gbest356.seq
 385830792     gbest357.seq
 499999372     gbest358.seq
 499997000     gbest359.seq
 465871645     gbest36.seq
 499998073     gbest360.seq
 499999645     gbest361.seq
  23214676     gbest362.seq
 499999898     gbest363.seq
 499998924     gbest364.seq
 499999957     gbest365.seq
 499998301     gbest366.seq
  60128918     gbest367.seq
 166258344     gbest368.seq
 500000179     gbest369.seq
 500000209     gbest37.seq
 499999251     gbest370.seq
 499997687     gbest371.seq
 499997572     gbest372.seq
  87718917     gbest373.seq
 499997252     gbest374.seq
 499999367     gbest375.seq
 499997045     gbest376.seq
 499999546     gbest377.seq
 167121887     gbest378.seq
 499996810     gbest379.seq
 499998451     gbest38.seq
 499998009     gbest380.seq
 499999556     gbest381.seq
 499998335     gbest382.seq
 155306383     gbest383.seq
 499997530     gbest384.seq
 499998520     gbest385.seq
 499999295     gbest386.seq
 496942011     gbest387.seq
 499998244     gbest388.seq
 499997393     gbest389.seq
 499999976     gbest39.seq
 499997868     gbest390.seq
  68565600     gbest391.seq
 499998099     gbest392.seq
 499995721     gbest393.seq
 499997473     gbest394.seq
 499998850     gbest395.seq
  84702116     gbest396.seq
 499999737     gbest397.seq
 499996073     gbest398.seq
 500000191     gbest399.seq
 434902858     gbest4.seq
 499997651     gbest40.seq
 499999645     gbest400.seq
  88021558     gbest401.seq
 499999499     gbest402.seq
 499999746     gbest403.seq
 499999085     gbest404.seq
 499997011     gbest405.seq
  49235799     gbest406.seq
 499999872     gbest407.seq
 499998505     gbest408.seq
 499998914     gbest409.seq
 191428295     gbest41.seq
 500000075     gbest410.seq
  89169665     gbest411.seq
 499997899     gbest412.seq
 499997633     gbest413.seq
 499998876     gbest414.seq
 499999246     gbest415.seq
 124809323     gbest416.seq
 499996953     gbest417.seq
 328041859     gbest418.seq
 499997537     gbest419.seq
 499997364     gbest42.seq
 499999392     gbest420.seq
 499999368     gbest421.seq
 499999290     gbest422.seq
  60418424     gbest423.seq
 499998536     gbest424.seq
 499999639     gbest425.seq
 499997596     gbest426.seq
 410616056     gbest427.seq
 499997260     gbest428.seq
 499999283     gbest429.seq
 499997237     gbest43.seq
 335979604     gbest430.seq
 499997507     gbest431.seq
 500000055     gbest432.seq
 261823894     gbest433.seq
 499999798     gbest434.seq
 499998541     gbest435.seq
 456055484     gbest436.seq
 499999170     gbest437.seq
 499995823     gbest438.seq
 305124852     gbest439.seq
 499997245     gbest44.seq
 499996212     gbest440.seq
 499998106     gbest441.seq
 336207493     gbest442.seq
 500000094     gbest443.seq
 499997705     gbest444.seq
 186758089     gbest445.seq
 499999759     gbest446.seq
 499999483     gbest447.seq
 121142819     gbest448.seq
 500000129     gbest449.seq
 499996431     gbest45.seq
 499998537     gbest450.seq
 144796918     gbest451.seq
 499999611     gbest452.seq
 499998380     gbest453.seq
 146704385     gbest454.seq
 499998626     gbest455.seq
 499997991     gbest456.seq
 499997900     gbest457.seq
 499999409     gbest458.seq
    633136     gbest459.seq
 189558363     gbest46.seq
 499999523     gbest460.seq
 499997491     gbest461.seq
 499998787     gbest462.seq
 499998418     gbest463.seq
  23481118     gbest464.seq
 170019681     gbest465.seq
 499998234     gbest466.seq
 499997948     gbest467.seq
 499998330     gbest468.seq
 499998840     gbest469.seq
 499999360     gbest47.seq
  28589640     gbest470.seq
 499999508     gbest471.seq
 499999012     gbest472.seq
 499998259     gbest473.seq
 499998420     gbest474.seq
  66474714     gbest475.seq
 499999592     gbest476.seq
 499996996     gbest477.seq
 499999140     gbest478.seq
 499999224     gbest479.seq
 499998265     gbest48.seq
  58795708     gbest480.seq
 500000136     gbest481.seq
 499996013     gbest482.seq
 499998950     gbest483.seq
 499998237     gbest484.seq
  36800490     gbest485.seq
 499997365     gbest486.seq
 499997555     gbest487.seq
 499999944     gbest488.seq
 500000006     gbest489.seq
 499997971     gbest49.seq
  74677937     gbest490.seq
 499999195     gbest491.seq
 499999368     gbest492.seq
 499998525     gbest493.seq
 208394234     gbest494.seq
 499996334     gbest495.seq
 499999918     gbest496.seq
 499998243     gbest497.seq
 499999880     gbest498.seq
  93316161     gbest499.seq
 499999604     gbest5.seq
 477020055     gbest50.seq
 499998317     gbest500.seq
 499997831     gbest501.seq
 499993715     gbest502.seq
 499994730     gbest503.seq
  57758916     gbest504.seq
 499995444     gbest505.seq
 499998789     gbest506.seq
 499999487     gbest507.seq
 499997240     gbest508.seq
 143896596     gbest509.seq
 499999116     gbest51.seq
 499999501     gbest510.seq
 499998882     gbest511.seq
 499996883     gbest512.seq
 499998573     gbest513.seq
 145499914     gbest514.seq
 499998334     gbest515.seq
 499998744     gbest516.seq
 500000200     gbest517.seq
 499997366     gbest518.seq
  20673496     gbest519.seq
 356399962     gbest52.seq
 174271459     gbest520.seq
 499999218     gbest521.seq
 499998538     gbest522.seq
  86473925     gbest523.seq
 499998243     gbest524.seq
 499999107     gbest525.seq
  76884582     gbest526.seq
 499998621     gbest527.seq
 499997372     gbest528.seq
 499999336     gbest529.seq
 499999044     gbest53.seq
 499999233     gbest530.seq
 101202718     gbest531.seq
 499998548     gbest532.seq
 499999664     gbest533.seq
 499999051     gbest534.seq
 499997991     gbest535.seq
  10812947     gbest536.seq
 499998167     gbest537.seq
 499999317     gbest538.seq
 499999417     gbest539.seq
 499999947     gbest54.seq
 477043712     gbest540.seq
 499999064     gbest541.seq
 499999411     gbest542.seq
 499998474     gbest543.seq
 418297944     gbest544.seq
 499999742     gbest545.seq
 500000106     gbest546.seq
 499999793     gbest547.seq
 499998376     gbest548.seq
  83233267     gbest549.seq
 499997712     gbest55.seq
 499999705     gbest550.seq
 499999631     gbest551.seq
 499999857     gbest552.seq
 499996947     gbest553.seq
  32801332     gbest554.seq
 499996586     gbest555.seq
 499997837     gbest556.seq
 500000124     gbest557.seq
 499998818     gbest558.seq
  44750131     gbest559.seq
 483687528     gbest56.seq
 499996688     gbest560.seq
 499999939     gbest561.seq
 499998405     gbest562.seq
 499999675     gbest563.seq
  12091398     gbest564.seq
 499999633     gbest565.seq
 500000258     gbest566.seq
 393277770     gbest567.seq
 499997478     gbest568.seq
 499999270     gbest569.seq
 500000017     gbest57.seq
 104498486     gbest570.seq
 499998740     gbest571.seq
 499998382     gbest572.seq
  50523126     gbest573.seq
 499999830     gbest574.seq
 499997136     gbest575.seq
 499999789     gbest576.seq
 255974615     gbest577.seq
 499999533     gbest58.seq
 500000156     gbest59.seq
 499998507     gbest6.seq
 464399310     gbest60.seq
 499997769     gbest61.seq
 500000238     gbest62.seq
 499999713     gbest63.seq
 499999160     gbest64.seq
   7793276     gbest65.seq
 499997879     gbest66.seq
 499997947     gbest67.seq
 499998652     gbest68.seq
 484302210     gbest69.seq
 499997487     gbest7.seq
 499998443     gbest70.seq
 499997272     gbest71.seq
 499997898     gbest72.seq
 499997394     gbest73.seq
  10061830     gbest74.seq
 123413300     gbest75.seq
 499999298     gbest76.seq
 499998245     gbest77.seq
 499998907     gbest78.seq
 499999038     gbest79.seq
 470353887     gbest8.seq
   6590015     gbest80.seq
 499998041     gbest81.seq
 499999051     gbest82.seq
 499997981     gbest83.seq
 499997633     gbest84.seq
  47003058     gbest85.seq
 499998825     gbest86.seq
 499999018     gbest87.seq
 499996860     gbest88.seq
 499998671     gbest89.seq
 499997309     gbest9.seq
  53783169     gbest90.seq
 499998173     gbest91.seq
 499999170     gbest92.seq
 499997913     gbest93.seq
 472228455     gbest94.seq
 499998402     gbest95.seq
 499999565     gbest96.seq
 499997262     gbest97.seq
 499897815     gbest98.seq
  35244903     gbest99.seq
 500000234     gbgss1.seq
  55736677     gbgss10.seq
 499997670     gbgss100.seq
  45810173     gbgss101.seq
 499998099     gbgss102.seq
 499998065     gbgss103.seq
 499997907     gbgss104.seq
 468721568     gbgss105.seq
 499996855     gbgss106.seq
 500000226     gbgss107.seq
 499998462     gbgss108.seq
 499997978     gbgss109.seq
 499999928     gbgss11.seq
  42548343     gbgss110.seq
 499997770     gbgss111.seq
 499999226     gbgss112.seq
 499999211     gbgss113.seq
 319510698     gbgss114.seq
 499999367     gbgss115.seq
 499999051     gbgss116.seq
 499997978     gbgss117.seq
 500000209     gbgss118.seq
 105483484     gbgss119.seq
 499999265     gbgss12.seq
 499997351     gbgss120.seq
 499997815     gbgss121.seq
 499997392     gbgss122.seq
 499998819     gbgss123.seq
   8930221     gbgss124.seq
 499999907     gbgss125.seq
 499998685     gbgss126.seq
 499999539     gbgss127.seq
 451770448     gbgss128.seq
 499998345     gbgss129.seq
 499999682     gbgss13.seq
 499999211     gbgss130.seq
 499997711     gbgss131.seq
 499998622     gbgss132.seq
  29785783     gbgss133.seq
 499997877     gbgss134.seq
 209679641     gbgss135.seq
 500000110     gbgss136.seq
 499999602     gbgss137.seq
 499997969     gbgss138.seq
 500000125     gbgss139.seq
 499998207     gbgss14.seq
  14831686     gbgss140.seq
 499996726     gbgss141.seq
 499997951     gbgss142.seq
 499999528     gbgss143.seq
 499997001     gbgss144.seq
  16786266     gbgss145.seq
 499997786     gbgss146.seq
 499996974     gbgss147.seq
 499999546     gbgss148.seq
 499996547     gbgss149.seq
   4917168     gbgss15.seq
   2045398     gbgss150.seq
 499997382     gbgss151.seq
 499998165     gbgss152.seq
 499998480     gbgss153.seq
 499997367     gbgss154.seq
   6835799     gbgss155.seq
 373479493     gbgss156.seq
 499998266     gbgss157.seq
 499997530     gbgss158.seq
 499998707     gbgss159.seq
 499997659     gbgss16.seq
 456409384     gbgss160.seq
 500000153     gbgss161.seq
 499998610     gbgss162.seq
 499998025     gbgss163.seq
 458152490     gbgss164.seq
 499997998     gbgss165.seq
 499999955     gbgss166.seq
 499998714     gbgss167.seq
 456858700     gbgss168.seq
 499996657     gbgss169.seq
 499998184     gbgss17.seq
 499998104     gbgss170.seq
 499998398     gbgss171.seq
 364091904     gbgss172.seq
 500000047     gbgss173.seq
 499999282     gbgss174.seq
 215788973     gbgss175.seq
 500000172     gbgss176.seq
 499998443     gbgss177.seq
  67688415     gbgss178.seq
 499999079     gbgss179.seq
 499999310     gbgss18.seq
 499999336     gbgss180.seq
 499998518     gbgss181.seq
 499999975     gbgss182.seq
  49671428     gbgss183.seq
 500000207     gbgss184.seq
 499998668     gbgss185.seq
 499998448     gbgss186.seq
 500000134     gbgss187.seq
  41156795     gbgss188.seq
 499999015     gbgss189.seq
 482990292     gbgss19.seq
 499999016     gbgss190.seq
  23955509     gbgss191.seq
 499998791     gbgss192.seq
 499996639     gbgss193.seq
 499997685     gbgss194.seq
 496087090     gbgss195.seq
 499999000     gbgss196.seq
 499999717     gbgss197.seq
 499997511     gbgss198.seq
 499999779     gbgss199.seq
 499998406     gbgss2.seq
 500000183     gbgss20.seq
  55740343     gbgss200.seq
 499998159     gbgss201.seq
 499999372     gbgss202.seq
 499999236     gbgss203.seq
 480794721     gbgss204.seq
 499999696     gbgss205.seq
 499998040     gbgss206.seq
  55217889     gbgss207.seq
 499999671     gbgss208.seq
 499999336     gbgss209.seq
 326438013     gbgss21.seq
 499999851     gbgss210.seq
 483100976     gbgss211.seq
 499996047     gbgss212.seq
 499999857     gbgss213.seq
 499998395     gbgss214.seq
 487406593     gbgss215.seq
 499998512     gbgss216.seq
 499999622     gbgss217.seq
 499998482     gbgss218.seq
 475058258     gbgss219.seq
 499996936     gbgss22.seq
 499999842     gbgss220.seq
 499997438     gbgss221.seq
 499998098     gbgss222.seq
   6323878     gbgss223.seq
 499999723     gbgss224.seq
 499999684     gbgss225.seq
 499998774     gbgss226.seq
 264586823     gbgss227.seq
 499998477     gbgss228.seq
 500000259     gbgss229.seq
 499999113     gbgss23.seq
 499998395     gbgss230.seq
 429772360     gbgss231.seq
 499998680     gbgss232.seq
 499997883     gbgss233.seq
 499999992     gbgss234.seq
 471956638     gbgss235.seq
 499999119     gbgss236.seq
 499999463     gbgss237.seq
 499997873     gbgss238.seq
 419058265     gbgss239.seq
 499998818     gbgss24.seq
 499998792     gbgss240.seq
 499998663     gbgss241.seq
 499998429     gbgss242.seq
 499997477     gbgss243.seq
  17841011     gbgss244.seq
 315572447     gbgss245.seq
 499997744     gbgss246.seq
 499999025     gbgss247.seq
 499998492     gbgss248.seq
 467298948     gbgss249.seq
 499999856     gbgss25.seq
 499998875     gbgss250.seq
 499997169     gbgss251.seq
 499998873     gbgss252.seq
 499997827     gbgss253.seq
  36132488     gbgss254.seq
 499998608     gbgss255.seq
 499999218     gbgss256.seq
 499998113     gbgss257.seq
 499998912     gbgss258.seq
  22042461     gbgss259.seq
  49836535     gbgss26.seq
 499999951     gbgss260.seq
 500000033     gbgss261.seq
 499998742     gbgss262.seq
   2065681     gbgss263.seq
 500000132     gbgss264.seq
 499998920     gbgss265.seq
 499998061     gbgss266.seq
 499491070     gbgss267.seq
 499999723     gbgss268.seq
 499998484     gbgss269.seq
 499996250     gbgss27.seq
 476820066     gbgss270.seq
 500000242     gbgss28.seq
 499996649     gbgss29.seq
 499999721     gbgss3.seq
 499998291     gbgss30.seq
  31243183     gbgss31.seq
 499998298     gbgss32.seq
 499999440     gbgss33.seq
 499999075     gbgss34.seq
 475296111     gbgss35.seq
 499997988     gbgss36.seq
 499998016     gbgss37.seq
 499998968     gbgss38.seq
 499998789     gbgss39.seq
 499999033     gbgss4.seq
  12457092     gbgss40.seq
 499998729     gbgss41.seq
 499997515     gbgss42.seq
 168546271     gbgss43.seq
 499997525     gbgss44.seq
 499997753     gbgss45.seq
 499999140     gbgss46.seq
 486883580     gbgss47.seq
 499998195     gbgss48.seq
 499997635     gbgss49.seq
  41473958     gbgss5.seq
 499997904     gbgss50.seq
 443945964     gbgss51.seq
 499998446     gbgss52.seq
 500000163     gbgss53.seq
 499998431     gbgss54.seq
 421055741     gbgss55.seq
 499998235     gbgss56.seq
 499999740     gbgss57.seq
 500000154     gbgss58.seq
 427947401     gbgss59.seq
 499999218     gbgss6.seq
  67665344     gbgss60.seq
 499997014     gbgss61.seq
 499997577     gbgss62.seq
 499999370     gbgss63.seq
 492412049     gbgss64.seq
 499999868     gbgss65.seq
 499998563     gbgss66.seq
 499998282     gbgss67.seq
 499998811     gbgss68.seq
   2280772     gbgss69.seq
 500000229     gbgss7.seq
 500000229     gbgss70.seq
 499999619     gbgss71.seq
 500000260     gbgss72.seq
 419366282     gbgss73.seq
 500000010     gbgss74.seq
 499997041     gbgss75.seq
 499997295     gbgss76.seq
  34859199     gbgss77.seq
 499997046     gbgss78.seq
 499999706     gbgss79.seq
 499998252     gbgss8.seq
 499999172     gbgss80.seq
 490143115     gbgss81.seq
 499999721     gbgss82.seq
 500000164     gbgss83.seq
 499998945     gbgss84.seq
 499998992     gbgss85.seq
   4092019     gbgss86.seq
 499999480     gbgss87.seq
 500000115     gbgss88.seq
 499999268     gbgss89.seq
 499999125     gbgss9.seq
 499998008     gbgss90.seq
  30709867     gbgss91.seq
 499998289     gbgss92.seq
 499998886     gbgss93.seq
 499998172     gbgss94.seq
 465185709     gbgss95.seq
 244248654     gbgss96.seq
 499999492     gbgss97.seq
 499998457     gbgss98.seq
 500000176     gbgss99.seq
 499999046     gbhtc1.seq
 499988632     gbhtc2.seq
 499995070     gbhtc3.seq
 331480491     gbhtc4.seq
 499997830     gbhtc5.seq
 439766628     gbhtc6.seq
 499999692     gbhtc7.seq
 213789850     gbhtc8.seq
 499949323     gbhtg1.seq
 499980488     gbhtg10.seq
 485100216     gbhtg11.seq
 499977040     gbhtg12.seq
 499847878     gbhtg13.seq
 499963905     gbhtg14.seq
 499701543     gbhtg15.seq
 474637795     gbhtg16.seq
 499709797     gbhtg17.seq
 499810685     gbhtg18.seq
 499965489     gbhtg19.seq
 499847286     gbhtg2.seq
 499990701     gbhtg20.seq
 473198722     gbhtg21.seq
 499919006     gbhtg22.seq
 499967880     gbhtg23.seq
 499100457     gbhtg24.seq
 499962931     gbhtg25.seq
 484453569     gbhtg26.seq
 499959716     gbhtg27.seq
 499868009     gbhtg28.seq
 268058563     gbhtg29.seq
 499869352     gbhtg3.seq
 499922791     gbhtg30.seq
 499807238     gbhtg31.seq
 224934479     gbhtg32.seq
 499945565     gbhtg33.seq
 499927151     gbhtg34.seq
 265477063     gbhtg35.seq
 499867320     gbhtg36.seq
 499972802     gbhtg37.seq
 223152146     gbhtg38.seq
 499806592     gbhtg39.seq
 499846790     gbhtg4.seq
 499974839     gbhtg40.seq
 234952918     gbhtg41.seq
 499825905     gbhtg42.seq
 499886151     gbhtg43.seq
 202125817     gbhtg44.seq
 499805593     gbhtg45.seq
 499927302     gbhtg46.seq
 205797145     gbhtg47.seq
 499976951     gbhtg48.seq
 499932272     gbhtg49.seq
 499934584     gbhtg5.seq
 193865096     gbhtg50.seq
 499927926     gbhtg51.seq
 499933183     gbhtg52.seq
 161356215     gbhtg53.seq
 499991294     gbhtg54.seq
 499991025     gbhtg55.seq
 252731163     gbhtg56.seq
 499944125     gbhtg57.seq
 499990303     gbhtg58.seq
 499843154     gbhtg59.seq
    507366     gbhtg6.seq
 167235113     gbhtg60.seq
 499934810     gbhtg61.seq
 499926029     gbhtg62.seq
 499881289     gbhtg63.seq
 468570824     gbhtg64.seq
 499882387     gbhtg65.seq
 499975194     gbhtg66.seq
 499952537     gbhtg67.seq
 499955759     gbhtg68.seq
 499868574     gbhtg69.seq
 499821927     gbhtg7.seq
 417842665     gbhtg70.seq
 499740722     gbhtg71.seq
 499823072     gbhtg72.seq
 385408676     gbhtg73.seq
 499947980     gbhtg74.seq
 499966173     gbhtg75.seq
 383565091     gbhtg76.seq
 499960780     gbhtg77.seq
 499985240     gbhtg78.seq
 499783914     gbhtg79.seq
 499933840     gbhtg8.seq
 499757763     gbhtg80.seq
 499913110     gbhtg81.seq
 275485053     gbhtg82.seq
 499899726     gbhtg9.seq
 499901143     gbinv1.seq
 490451259     gbinv10.seq
 494640587     gbinv100.seq
 328489973     gbinv101.seq
 484117251     gbinv102.seq
 499999646     gbinv103.seq
 499999851     gbinv104.seq
 116519180     gbinv105.seq
 499997646     gbinv106.seq
 499998978     gbinv107.seq
 407114243     gbinv108.seq
 499998473     gbinv109.seq
 491062219     gbinv11.seq
 499999559     gbinv110.seq
 181576292     gbinv111.seq
 499997996     gbinv112.seq
 499998517     gbinv113.seq
 119780219     gbinv114.seq
 499999491     gbinv115.seq
 499997304     gbinv116.seq
 152739866     gbinv117.seq
 499996977     gbinv118.seq
 499999676     gbinv119.seq
 469688374     gbinv12.seq
 158860343     gbinv120.seq
 499998744     gbinv121.seq
 499999989     gbinv122.seq
 194340748     gbinv123.seq
 499998084     gbinv124.seq
 499998628     gbinv125.seq
 248737713     gbinv126.seq
 499998778     gbinv127.seq
 499999835     gbinv128.seq
 499998891     gbinv129.seq
 485523455     gbinv13.seq
 499999283     gbinv130.seq
  63897814     gbinv131.seq
 499999374     gbinv132.seq
 455573372     gbinv133.seq
 289072816     gbinv134.seq
  54983087     gbinv135.seq
  52942591     gbinv136.seq
 157105258     gbinv137.seq
 499999147     gbinv138.seq
 268190266     gbinv139.seq
 174159504     gbinv14.seq
 499996088     gbinv140.seq
 499997883     gbinv141.seq
 182060786     gbinv142.seq
 499194794     gbinv143.seq
 499849561     gbinv144.seq
 498733817     gbinv145.seq
 135334814     gbinv146.seq
 496684189     gbinv147.seq
  51960557     gbinv148.seq
 466571787     gbinv149.seq
 486730694     gbinv15.seq
 479577598     gbinv150.seq
 450564862     gbinv151.seq
 482003105     gbinv152.seq
 121049467     gbinv153.seq
 494590358     gbinv154.seq
 499152528     gbinv155.seq
 498622770     gbinv156.seq
  70661024     gbinv157.seq
 872662073     gbinv158.seq
 815663159     gbinv159.seq
 495353494     gbinv16.seq
 813528097     gbinv160.seq
 780491774     gbinv161.seq
 734904723     gbinv162.seq
 816941878     gbinv163.seq
 452996658     gbinv164.seq
 480839037     gbinv165.seq
 375796220     gbinv166.seq
 499933895     gbinv167.seq
 485388863     gbinv168.seq
 485283938     gbinv169.seq
 471931517     gbinv17.seq
 498294953     gbinv170.seq
 414580638     gbinv171.seq
 498679440     gbinv172.seq
 495007238     gbinv173.seq
 486086193     gbinv174.seq
 483986740     gbinv175.seq
 479016567     gbinv176.seq
 377180280     gbinv177.seq
 491313703     gbinv178.seq
 482991950     gbinv179.seq
 486628934     gbinv18.seq
 495169229     gbinv180.seq
 493741890     gbinv181.seq
 495500028     gbinv182.seq
 371035005     gbinv183.seq
 470293000     gbinv184.seq
 496252830     gbinv185.seq
 496286826     gbinv186.seq
 472374759     gbinv187.seq
 493442600     gbinv188.seq
 418569182     gbinv189.seq
 497114880     gbinv19.seq
 493158119     gbinv190.seq
 491119641     gbinv191.seq
 465656312     gbinv192.seq
 490891118     gbinv193.seq
 459581775     gbinv194.seq
 406078142     gbinv195.seq
 476900813     gbinv196.seq
 481848725     gbinv197.seq
 496747706     gbinv198.seq
 492742184     gbinv199.seq
 456567720     gbinv2.seq
 487408420     gbinv20.seq
 496271174     gbinv200.seq
 392139815     gbinv201.seq
 496951694     gbinv202.seq
 492317100     gbinv203.seq
 475960728     gbinv204.seq
 498250544     gbinv205.seq
 496664285     gbinv206.seq
 351267284     gbinv207.seq
 454438248     gbinv208.seq
 490109816     gbinv209.seq
 319196831     gbinv21.seq
 477775507     gbinv210.seq
 497117087     gbinv211.seq
 273421111     gbinv212.seq
 484546259     gbinv213.seq
 486200137     gbinv214.seq
 489013669     gbinv215.seq
 499892182     gbinv216.seq
 389960712     gbinv217.seq
 230763287     gbinv218.seq
 433765668     gbinv219.seq
 305989097     gbinv22.seq
 341801067     gbinv220.seq
 488714019     gbinv221.seq
 442232047     gbinv222.seq
 499337745     gbinv223.seq
 499865521     gbinv224.seq
 192432873     gbinv225.seq
 499998458     gbinv226.seq
 500000232     gbinv227.seq
 275136445     gbinv228.seq
 499999044     gbinv229.seq
 499447601     gbinv23.seq
 499998975     gbinv230.seq
 204985605     gbinv231.seq
 499999084     gbinv232.seq
 499999758     gbinv233.seq
 273024838     gbinv234.seq
 499997362     gbinv235.seq
 499988245     gbinv236.seq
 357111204     gbinv237.seq
 499998875     gbinv238.seq
 499997441     gbinv239.seq
 331575178     gbinv24.seq
 499951295     gbinv240.seq
 499968106     gbinv241.seq
  71560487     gbinv242.seq
 499999353     gbinv243.seq
 499954513     gbinv244.seq
 394313230     gbinv245.seq
 499999746     gbinv246.seq
 499862404     gbinv247.seq
 499942773     gbinv248.seq
 261894712     gbinv249.seq
 409329256     gbinv25.seq
 499489044     gbinv250.seq
 499984461     gbinv251.seq
 499999178     gbinv252.seq
 219010924     gbinv253.seq
 499665286     gbinv254.seq
 499954794     gbinv255.seq
 499986274     gbinv256.seq
 349517342     gbinv257.seq
 500000137     gbinv258.seq
 499979428     gbinv259.seq
 337324220     gbinv26.seq
 499915813     gbinv260.seq
 499990759     gbinv261.seq
 499998437     gbinv262.seq
   7826534     gbinv263.seq
 499999636     gbinv264.seq
 499704487     gbinv265.seq
 499897338     gbinv266.seq
 499999895     gbinv267.seq
  68002970     gbinv268.seq
 499977802     gbinv269.seq
 416902989     gbinv27.seq
 499904157     gbinv270.seq
 499970007     gbinv271.seq
 499999529     gbinv272.seq
 499940074     gbinv273.seq
 122380920     gbinv274.seq
 500000224     gbinv275.seq
 499999552     gbinv276.seq
 468683478     gbinv277.seq
 499670167     gbinv278.seq
 499934229     gbinv279.seq
 480340526     gbinv28.seq
 499999149     gbinv280.seq
 499997598     gbinv281.seq
 485047915     gbinv282.seq
 194083497     gbinv283.seq
 481046566     gbinv284.seq
 450037909     gbinv285.seq
 303709221     gbinv286.seq
 293452060     gbinv287.seq
 280090041     gbinv288.seq
 279807726     gbinv289.seq
 470719972     gbinv29.seq
 274554532     gbinv290.seq
 266890122     gbinv291.seq
 491295946     gbinv292.seq
 418047779     gbinv293.seq
 383074444     gbinv294.seq
 489267373     gbinv295.seq
 393039463     gbinv296.seq
 484538449     gbinv297.seq
 482310364     gbinv298.seq
 491415359     gbinv299.seq
 499997350     gbinv3.seq
 478012779     gbinv30.seq
 495004950     gbinv300.seq
 484042623     gbinv301.seq
 495670320     gbinv302.seq
  40846857     gbinv303.seq
 492571202     gbinv304.seq
 490206006     gbinv305.seq
 445709424     gbinv306.seq
 207302902     gbinv307.seq
 370283947     gbinv308.seq
 207800719     gbinv309.seq
 372274412     gbinv31.seq
 403111025     gbinv310.seq
 496953725     gbinv311.seq
 495208718     gbinv312.seq
 486338081     gbinv313.seq
 491884209     gbinv314.seq
  62681775     gbinv315.seq
 487678296     gbinv316.seq
 495933337     gbinv317.seq
 497117994     gbinv318.seq
 485878834     gbinv319.seq
 473605830     gbinv32.seq
 336958408     gbinv320.seq
 470338855     gbinv321.seq
 473857916     gbinv322.seq
 488417194     gbinv323.seq
 472996654     gbinv324.seq
 444602917     gbinv325.seq
 489109149     gbinv326.seq
 489050792     gbinv327.seq
 492903374     gbinv328.seq
 464570821     gbinv329.seq
 476844427     gbinv33.seq
 389647411     gbinv330.seq
 499026549     gbinv331.seq
 459754874     gbinv332.seq
 457336249     gbinv333.seq
 468059538     gbinv334.seq
 487547225     gbinv335.seq
 494629437     gbinv336.seq
 499369066     gbinv337.seq
 425865049     gbinv338.seq
 447701977     gbinv339.seq
 487947504     gbinv34.seq
 471356977     gbinv340.seq
 106487756     gbinv341.seq
 494432647     gbinv342.seq
 499096313     gbinv343.seq
 174717833     gbinv344.seq
 439432672     gbinv345.seq
 315017082     gbinv346.seq
 247279447     gbinv347.seq
 493106968     gbinv348.seq
 482399453     gbinv349.seq
 498796343     gbinv35.seq
 487563600     gbinv350.seq
 495047837     gbinv351.seq
 345419513     gbinv352.seq
 499133273     gbinv353.seq
 496482189     gbinv354.seq
 369581646     gbinv355.seq
 456145557     gbinv356.seq
 200285196     gbinv357.seq
 495154413     gbinv358.seq
 341654330     gbinv359.seq
 499997714     gbinv36.seq
 336683654     gbinv360.seq
 493060580     gbinv361.seq
 107491235     gbinv362.seq
 487968866     gbinv363.seq
 495757046     gbinv364.seq
 481723089     gbinv365.seq
 326169629     gbinv366.seq
 485888763     gbinv367.seq
 492821648     gbinv368.seq
 471307712     gbinv369.seq
 437639110     gbinv37.seq
 311911756     gbinv370.seq
 499380148     gbinv371.seq
 482084817     gbinv372.seq
 479662419     gbinv373.seq
 363343706     gbinv374.seq
 489746713     gbinv375.seq
 499514774     gbinv376.seq
 496438512     gbinv377.seq
 492580046     gbinv378.seq
 486835968     gbinv379.seq
 500000057     gbinv38.seq
 495904776     gbinv380.seq
 482720635     gbinv381.seq
 134241704     gbinv382.seq
 493089306     gbinv383.seq
 490891004     gbinv384.seq
 498098866     gbinv385.seq
 498391590     gbinv386.seq
 493309439     gbinv387.seq
 324291471     gbinv388.seq
 484493924     gbinv389.seq
 407801233     gbinv39.seq
 491069771     gbinv390.seq
 494055574     gbinv391.seq
 235593723     gbinv392.seq
 319983008     gbinv393.seq
 484241023     gbinv394.seq
 216170369     gbinv395.seq
 218804026     gbinv396.seq
 336455655     gbinv397.seq
 297857601     gbinv398.seq
 477593708     gbinv399.seq
 498415647     gbinv4.seq
 497712538     gbinv40.seq
 493171167     gbinv400.seq
  96653657     gbinv401.seq
 401450903     gbinv402.seq
 471214414     gbinv403.seq
 478230772     gbinv404.seq
 481554780     gbinv405.seq
 119372855     gbinv406.seq
 489114034     gbinv407.seq
 418974457     gbinv408.seq
 492119058     gbinv409.seq
 491635604     gbinv41.seq
 488068826     gbinv410.seq
  86400276     gbinv411.seq
 475977385     gbinv412.seq
 479046564     gbinv413.seq
  91925882     gbinv414.seq
 498866242     gbinv415.seq
 475446584     gbinv416.seq
 492109157     gbinv417.seq
 493644048     gbinv418.seq
 450867996     gbinv419.seq
 468890973     gbinv42.seq
 491759397     gbinv420.seq
  84745739     gbinv421.seq
 423732674     gbinv422.seq
 344360076     gbinv423.seq
 487664553     gbinv424.seq
 481798385     gbinv425.seq
 419437489     gbinv426.seq
 447480354     gbinv427.seq
 458542150     gbinv428.seq
  84187054     gbinv429.seq
 480508090     gbinv43.seq
 476248749     gbinv430.seq
 482272438     gbinv431.seq
 498234741     gbinv432.seq
 471043224     gbinv433.seq
 136592520     gbinv434.seq
 495120952     gbinv435.seq
 498047113     gbinv436.seq
 493290837     gbinv437.seq
 467611623     gbinv438.seq
 464868282     gbinv439.seq
  96954549     gbinv44.seq
 485108715     gbinv440.seq
  70627368     gbinv441.seq
 444909632     gbinv442.seq
 457689916     gbinv443.seq
 485064135     gbinv444.seq
 496105931     gbinv445.seq
 484290465     gbinv446.seq
 248432863     gbinv447.seq
 413526452     gbinv448.seq
 438000207     gbinv449.seq
 495716316     gbinv45.seq
 487748206     gbinv450.seq
 498657774     gbinv451.seq
 447485275     gbinv452.seq
 352564218     gbinv453.seq
 457737190     gbinv454.seq
 480925976     gbinv455.seq
 482363288     gbinv456.seq
 490058774     gbinv457.seq
 457330992     gbinv458.seq
 213313220     gbinv459.seq
 459725126     gbinv46.seq
 475683221     gbinv460.seq
 491956738     gbinv461.seq
 488287391     gbinv462.seq
 486753557     gbinv463.seq
 471704294     gbinv464.seq
 318129970     gbinv465.seq
 469807657     gbinv466.seq
 497173372     gbinv467.seq
 486068129     gbinv468.seq
 497761269     gbinv469.seq
 481987024     gbinv47.seq
 483771794     gbinv470.seq
 208973524     gbinv471.seq
 482555865     gbinv472.seq
 489387386     gbinv473.seq
 174750473     gbinv474.seq
 520668510     gbinv475.seq
 439679373     gbinv476.seq
  76608705     gbinv477.seq
 544459462     gbinv478.seq
 291577871     gbinv479.seq
 494130818     gbinv48.seq
 499183575     gbinv480.seq
 449457164     gbinv481.seq
 403099826     gbinv482.seq
 426341523     gbinv483.seq
 452289588     gbinv484.seq
 332054885     gbinv485.seq
 216067190     gbinv486.seq
 363589631     gbinv487.seq
 349108462     gbinv488.seq
 466080521     gbinv489.seq
 170883604     gbinv49.seq
 433540622     gbinv490.seq
 325359681     gbinv491.seq
 414134794     gbinv492.seq
 443362325     gbinv493.seq
 458657490     gbinv494.seq
 469667434     gbinv495.seq
 275644987     gbinv496.seq
 446552014     gbinv497.seq
 480169917     gbinv498.seq
 474041236     gbinv499.seq
 187378027     gbinv5.seq
 473738127     gbinv50.seq
 439739678     gbinv500.seq
 415879374     gbinv501.seq
 467640011     gbinv502.seq
 312202242     gbinv503.seq
 476756260     gbinv504.seq
 477061163     gbinv505.seq
 483683490     gbinv506.seq
 495487713     gbinv507.seq
  69234679     gbinv508.seq
 477792636     gbinv509.seq
 489724528     gbinv51.seq
 492725837     gbinv510.seq
 478184643     gbinv511.seq
 492947595     gbinv512.seq
 116672197     gbinv513.seq
 483642314     gbinv514.seq
 482127664     gbinv515.seq
 470874419     gbinv516.seq
 495029558     gbinv517.seq
  99065870     gbinv518.seq
 477953618     gbinv519.seq
 481853019     gbinv52.seq
 452659060     gbinv520.seq
 467009813     gbinv521.seq
 470035266     gbinv522.seq
 255630047     gbinv523.seq
 496825048     gbinv524.seq
 457058797     gbinv525.seq
 475749694     gbinv526.seq
 458940745     gbinv527.seq
 478290025     gbinv528.seq
 201201186     gbinv529.seq
 480574803     gbinv53.seq
 476458381     gbinv530.seq
 472367130     gbinv531.seq
 491955676     gbinv532.seq
 445112147     gbinv533.seq
 478746373     gbinv534.seq
 213103145     gbinv535.seq
 426002666     gbinv536.seq
 491306479     gbinv537.seq
 485922068     gbinv538.seq
 470774965     gbinv539.seq
 175801402     gbinv54.seq
 259886438     gbinv540.seq
 323358243     gbinv541.seq
 292361181     gbinv542.seq
 472027339     gbinv543.seq
 394618639     gbinv544.seq
 498685113     gbinv545.seq
 252840705     gbinv546.seq
 409818882     gbinv547.seq
 483153478     gbinv548.seq
 356373687     gbinv549.seq
 495890984     gbinv55.seq
 382117771     gbinv550.seq
 414986838     gbinv551.seq
 358562967     gbinv552.seq
 454612949     gbinv553.seq
 397094236     gbinv554.seq
 472022816     gbinv555.seq
 375604154     gbinv556.seq
 260058125     gbinv557.seq
 416870448     gbinv558.seq
 337551656     gbinv559.seq
 496714825     gbinv56.seq
 323476118     gbinv560.seq
 316192878     gbinv561.seq
 483033075     gbinv562.seq
 484553056     gbinv563.seq
 485400895     gbinv564.seq
 443742161     gbinv565.seq
 114051217     gbinv566.seq
 464470649     gbinv567.seq
 452122047     gbinv568.seq
 495339385     gbinv569.seq
 484083642     gbinv57.seq
 358679099     gbinv570.seq
 488960322     gbinv571.seq
 494569731     gbinv572.seq
 446419168     gbinv573.seq
 393089050     gbinv574.seq
 119924885     gbinv575.seq
 475723349     gbinv576.seq
 418498253     gbinv577.seq
 487729463     gbinv578.seq
 442064966     gbinv579.seq
 472142528     gbinv58.seq
 459399034     gbinv580.seq
 476019529     gbinv581.seq
 489445959     gbinv582.seq
 488427181     gbinv583.seq
  39113487     gbinv584.seq
 478318630     gbinv585.seq
 485192704     gbinv586.seq
 487924132     gbinv587.seq
 367187723     gbinv588.seq
 491253033     gbinv589.seq
 487970520     gbinv59.seq
 492099884     gbinv590.seq
 492318782     gbinv591.seq
 490488560     gbinv592.seq
 264709414     gbinv593.seq
 498243322     gbinv594.seq
 461893097     gbinv595.seq
 479536374     gbinv596.seq
 498214872     gbinv597.seq
 358503530     gbinv598.seq
 497880059     gbinv599.seq
 497548247     gbinv6.seq
 473212643     gbinv60.seq
 328840422     gbinv600.seq
 388768319     gbinv601.seq
 497514162     gbinv602.seq
 102760609     gbinv603.seq
 424365480     gbinv604.seq
 415464839     gbinv605.seq
 468645236     gbinv606.seq
 491418312     gbinv607.seq
 422461059     gbinv608.seq
 494059543     gbinv609.seq
 119585423     gbinv61.seq
 492104487     gbinv610.seq
 371661941     gbinv611.seq
 418666111     gbinv612.seq
 385203223     gbinv613.seq
 490161407     gbinv614.seq
 462282120     gbinv615.seq
 497342921     gbinv616.seq
 483355365     gbinv617.seq
 419495810     gbinv618.seq
 495088992     gbinv619.seq
 483414567     gbinv62.seq
 118039128     gbinv620.seq
 460760613     gbinv621.seq
 474795905     gbinv622.seq
 448271770     gbinv623.seq
 447953092     gbinv624.seq
 397698588     gbinv625.seq
 412906977     gbinv626.seq
 414039055     gbinv627.seq
 373499990     gbinv628.seq
 352095009     gbinv629.seq
 490356175     gbinv63.seq
 171624580     gbinv630.seq
 492880950     gbinv631.seq
 496329611     gbinv632.seq
 495293458     gbinv633.seq
 326435281     gbinv634.seq
 478875133     gbinv635.seq
 438224962     gbinv636.seq
 474184048     gbinv637.seq
 357686520     gbinv638.seq
 465465357     gbinv639.seq
 487648025     gbinv64.seq
 485209832     gbinv640.seq
 427730310     gbinv641.seq
 361113223     gbinv642.seq
 482159714     gbinv643.seq
 495382944     gbinv644.seq
 299589099     gbinv645.seq
 321246350     gbinv646.seq
 309309451     gbinv647.seq
 488604492     gbinv648.seq
 410235232     gbinv649.seq
 482729413     gbinv65.seq
 495921982     gbinv650.seq
 434553196     gbinv651.seq
  74348655     gbinv652.seq
 540854821     gbinv653.seq
 355480446     gbinv654.seq
 292922279     gbinv655.seq
 461332257     gbinv656.seq
 387709370     gbinv657.seq
 497786439     gbinv658.seq
 460330963     gbinv659.seq
 500000160     gbinv66.seq
 470769632     gbinv660.seq
 382061135     gbinv661.seq
 352986490     gbinv662.seq
 443627527     gbinv663.seq
 434076487     gbinv664.seq
 478667921     gbinv665.seq
 488044133     gbinv666.seq
 306561625     gbinv667.seq
 385552134     gbinv668.seq
 499040557     gbinv669.seq
 421580481     gbinv67.seq
 137160705     gbinv670.seq
 490413062     gbinv671.seq
 419782269     gbinv672.seq
 398652960     gbinv673.seq
 436288257     gbinv674.seq
 493888501     gbinv675.seq
 447343866     gbinv676.seq
 496175499     gbinv677.seq
  68617791     gbinv678.seq
 483838711     gbinv679.seq
 485232900     gbinv68.seq
 474620265     gbinv680.seq
 480025063     gbinv681.seq
 489133728     gbinv682.seq
 489850852     gbinv683.seq
 483923401     gbinv684.seq
 195051546     gbinv685.seq
 278317571     gbinv686.seq
 405202233     gbinv687.seq
 481613416     gbinv688.seq
 484103430     gbinv689.seq
 497790926     gbinv69.seq
 139765554     gbinv690.seq
 479932810     gbinv691.seq
 496128682     gbinv692.seq
 490899742     gbinv693.seq
 486767668     gbinv694.seq
  27472943     gbinv695.seq
 360080489     gbinv696.seq
 408852378     gbinv697.seq
 494054422     gbinv698.seq
 437725967     gbinv699.seq
 476459766     gbinv7.seq
 492273364     gbinv70.seq
 364183673     gbinv700.seq
 466430597     gbinv701.seq
 417761946     gbinv702.seq
 346875284     gbinv703.seq
 481247126     gbinv704.seq
 454874623     gbinv705.seq
 494951599     gbinv706.seq
 465759119     gbinv707.seq
 476680166     gbinv708.seq
 474564440     gbinv709.seq
 493650304     gbinv71.seq
 154655407     gbinv710.seq
 464570217     gbinv711.seq
 498339612     gbinv712.seq
 474586953     gbinv713.seq
 481881129     gbinv714.seq
 254438016     gbinv715.seq
 319411371     gbinv72.seq
 495485825     gbinv73.seq
 496723738     gbinv74.seq
 492757167     gbinv75.seq
 483899600     gbinv76.seq
 478256052     gbinv77.seq
 492780856     gbinv78.seq
 499976011     gbinv79.seq
 422534062     gbinv8.seq
 498322007     gbinv80.seq
 483551082     gbinv81.seq
 444451717     gbinv82.seq
 483770017     gbinv83.seq
 493575935     gbinv84.seq
 498159916     gbinv85.seq
 461241054     gbinv86.seq
 429126368     gbinv87.seq
 472254506     gbinv88.seq
 487388601     gbinv89.seq
 173964303     gbinv9.seq
 488620999     gbinv90.seq
 492386441     gbinv91.seq
 410012641     gbinv92.seq
 489753781     gbinv93.seq
 486907886     gbinv94.seq
 475277293     gbinv95.seq
 499301158     gbinv96.seq
 356777677     gbinv97.seq
 461771502     gbinv98.seq
 479426528     gbinv99.seq
 499998325     gbmam1.seq
  82798714     gbmam10.seq
 483844712     gbmam100.seq
 437064425     gbmam101.seq
 223540742     gbmam102.seq
 451994163     gbmam103.seq
 449442494     gbmam104.seq
 428332107     gbmam105.seq
 499861182     gbmam106.seq
 414041442     gbmam107.seq
 227944315     gbmam108.seq
 348089742     gbmam109.seq
  71269110     gbmam11.seq
 373183698     gbmam110.seq
 467160879     gbmam111.seq
 457054238     gbmam112.seq
 483676806     gbmam113.seq
 409916232     gbmam114.seq
 398303012     gbmam115.seq
 346294509     gbmam116.seq
 274828976     gbmam117.seq
 266926778     gbmam118.seq
 442156596     gbmam119.seq
  22560541     gbmam12.seq
 394957791     gbmam120.seq
 359859404     gbmam121.seq
 441833934     gbmam122.seq
 467877966     gbmam123.seq
 460914208     gbmam124.seq
  77886529     gbmam125.seq
 383280316     gbmam126.seq
 490312196     gbmam127.seq
 385325611     gbmam128.seq
 473911567     gbmam129.seq
   1268288     gbmam13.seq
 413152711     gbmam130.seq
 479361008     gbmam131.seq
 435411678     gbmam132.seq
 224396449     gbmam133.seq
 378312043     gbmam14.seq
 338653928     gbmam15.seq
 477859984     gbmam16.seq
 445458565     gbmam17.seq
 122412952     gbmam18.seq
 451114191     gbmam19.seq
 399221836     gbmam2.seq
 418062936     gbmam20.seq
 499818179     gbmam21.seq
 462376348     gbmam22.seq
 370510647     gbmam23.seq
 446296416     gbmam24.seq
 431104435     gbmam25.seq
 480602942     gbmam26.seq
 479109855     gbmam27.seq
 483903273     gbmam28.seq
 483307002     gbmam29.seq
 400559326     gbmam3.seq
  48405032     gbmam30.seq
 363174382     gbmam31.seq
 437246747     gbmam32.seq
 470828962     gbmam33.seq
 402408906     gbmam34.seq
 304109928     gbmam35.seq
 452443739     gbmam36.seq
 451303958     gbmam37.seq
 495648598     gbmam38.seq
 405636626     gbmam39.seq
 477148353     gbmam4.seq
 410457734     gbmam40.seq
 441553748     gbmam41.seq
 367146984     gbmam42.seq
 478421809     gbmam43.seq
 316388332     gbmam44.seq
 352226884     gbmam45.seq
 195247700     gbmam46.seq
 474022452     gbmam47.seq
 378020853     gbmam48.seq
 450136561     gbmam49.seq
 374653134     gbmam5.seq
 450750944     gbmam50.seq
 468132660     gbmam51.seq
 494002437     gbmam52.seq
   9943400     gbmam53.seq
  43988539     gbmam54.seq
  91321391     gbmam55.seq
  88809601     gbmam56.seq
   6363486     gbmam57.seq
  20916904     gbmam58.seq
 449453123     gbmam59.seq
 487713568     gbmam6.seq
 423545670     gbmam60.seq
 453840584     gbmam61.seq
 491149506     gbmam62.seq
 425479852     gbmam63.seq
 461110029     gbmam64.seq
 385606603     gbmam65.seq
 489901313     gbmam66.seq
 499999502     gbmam67.seq
 499999891     gbmam68.seq
  19873578     gbmam69.seq
 401181424     gbmam7.seq
 907465328     gbmam70.seq
 839494897     gbmam71.seq
 774395849     gbmam72.seq
 588873740     gbmam73.seq
 364960392     gbmam74.seq
 428298067     gbmam75.seq
 283039896     gbmam76.seq
 266822121     gbmam77.seq
 255007049     gbmam78.seq
 250435254     gbmam79.seq
 435129139     gbmam8.seq
 405637142     gbmam80.seq
 372091504     gbmam81.seq
 465555603     gbmam82.seq
 444923782     gbmam83.seq
 341582143     gbmam84.seq
 257946240     gbmam85.seq
 485829704     gbmam86.seq
 486026993     gbmam87.seq
 483298905     gbmam88.seq
 494677523     gbmam89.seq
 275778831     gbmam9.seq
 335874920     gbmam90.seq
 464872853     gbmam91.seq
 468294587     gbmam92.seq
 497569809     gbmam93.seq
 377746247     gbmam94.seq
 460747191     gbmam95.seq
 150130543     gbmam96.seq
 416665240     gbmam97.seq
 456214449     gbmam98.seq
 486132452     gbmam99.seq
  24603569     gbnew.txt
 499999698     gbpat1.seq
 499999978     gbpat10.seq
 499999036     gbpat100.seq
 499999497     gbpat101.seq
 499997525     gbpat102.seq
 228719622     gbpat103.seq
 500000251     gbpat104.seq
 500000174     gbpat105.seq
 499999692     gbpat106.seq
 335512359     gbpat107.seq
 499998959     gbpat108.seq
 500000168     gbpat109.seq
 499999647     gbpat11.seq
 210384067     gbpat110.seq
 499919646     gbpat111.seq
 499997173     gbpat112.seq
 174108329     gbpat113.seq
 499998922     gbpat114.seq
 499999723     gbpat115.seq
 499997665     gbpat116.seq
   8739702     gbpat117.seq
 499731616     gbpat118.seq
 382811060     gbpat119.seq
 179212727     gbpat12.seq
 499998356     gbpat120.seq
 499999235     gbpat121.seq
 499992723     gbpat122.seq
 499999286     gbpat123.seq
  56338421     gbpat124.seq
 499968107     gbpat125.seq
 499999379     gbpat126.seq
 208443590     gbpat127.seq
 500000191     gbpat128.seq
 500000245     gbpat129.seq
 499980551     gbpat13.seq
  59371144     gbpat130.seq
 499999357     gbpat131.seq
 499998406     gbpat132.seq
 488831283     gbpat133.seq
 499997657     gbpat134.seq
 499997981     gbpat135.seq
  28456466     gbpat136.seq
 499995340     gbpat137.seq
 385117263     gbpat138.seq
 499999648     gbpat139.seq
 499999731     gbpat14.seq
 500000185     gbpat140.seq
 148508589     gbpat141.seq
 499996273     gbpat142.seq
 314551576     gbpat143.seq
 499988381     gbpat144.seq
 499980283     gbpat145.seq
 409538104     gbpat146.seq
 500000154     gbpat147.seq
 499989815     gbpat148.seq
 125987771     gbpat149.seq
  62764516     gbpat15.seq
 499989559     gbpat150.seq
 500000059     gbpat151.seq
 499998857     gbpat152.seq
 499997730     gbpat153.seq
 169882838     gbpat154.seq
 499998912     gbpat155.seq
 426349375     gbpat156.seq
 499999555     gbpat157.seq
 499999618     gbpat158.seq
 499927291     gbpat159.seq
 499998604     gbpat16.seq
 353564353     gbpat160.seq
 500000222     gbpat161.seq
 499998441     gbpat162.seq
 291231769     gbpat163.seq
 500000188     gbpat164.seq
 499998862     gbpat165.seq
 499999445     gbpat166.seq
 102920551     gbpat167.seq
 499994521     gbpat168.seq
 499999159     gbpat169.seq
 499999052     gbpat17.seq
 499997606     gbpat170.seq
 499999511     gbpat171.seq
 301687777     gbpat172.seq
 499999869     gbpat173.seq
 499998924     gbpat174.seq
 500000011     gbpat175.seq
 319831698     gbpat176.seq
 499602681     gbpat177.seq
 499998926     gbpat178.seq
 499999721     gbpat179.seq
 422054332     gbpat18.seq
  13212105     gbpat180.seq
 497266508     gbpat181.seq
 499998857     gbpat182.seq
 499999906     gbpat183.seq
  86834850     gbpat184.seq
 499933188     gbpat185.seq
 499999973     gbpat186.seq
 499998167     gbpat187.seq
  39745949     gbpat188.seq
 499260037     gbpat189.seq
 499926748     gbpat19.seq
 500000078     gbpat190.seq
 499999525     gbpat191.seq
 499999891     gbpat192.seq
  96580549     gbpat193.seq
 499881118     gbpat194.seq
 499997532     gbpat195.seq
 499999338     gbpat196.seq
 500000241     gbpat197.seq
  90172347     gbpat198.seq
 499993295     gbpat199.seq
 499999788     gbpat2.seq
 499999821     gbpat20.seq
 499994277     gbpat200.seq
 499998512     gbpat201.seq
 499999457     gbpat202.seq
   4092526     gbpat203.seq
 499999756     gbpat204.seq
 499999459     gbpat205.seq
 500000244     gbpat206.seq
 478202129     gbpat207.seq
 500000054     gbpat208.seq
 499999577     gbpat209.seq
 499990829     gbpat21.seq
 321705067     gbpat210.seq
 499991396     gbpat211.seq
 499963719     gbpat212.seq
 350635988     gbpat213.seq
 497506292     gbpat214.seq
 499869540     gbpat215.seq
 421452571     gbpat216.seq
 499425936     gbpat217.seq
 499999361     gbpat218.seq
 336263474     gbpat219.seq
 347866113     gbpat22.seq
 499998549     gbpat220.seq
 499999417     gbpat221.seq
 499999671     gbpat222.seq
 361397016     gbpat223.seq
 499999662     gbpat224.seq
 494515367     gbpat225.seq
 341868206     gbpat226.seq
 499999744     gbpat227.seq
 500000159     gbpat228.seq
 366896749     gbpat229.seq
 499893671     gbpat23.seq
 499999946     gbpat230.seq
 499335751     gbpat231.seq
 389256092     gbpat232.seq
 499996721     gbpat233.seq
 500000056     gbpat234.seq
 498671374     gbpat235.seq
 499999167     gbpat236.seq
 143476001     gbpat237.seq
 499998916     gbpat238.seq
 499993601     gbpat239.seq
 499998921     gbpat24.seq
 500000040     gbpat240.seq
 499999382     gbpat241.seq
 203631979     gbpat242.seq
 499999639     gbpat243.seq
 499997091     gbpat244.seq
 499999375     gbpat245.seq
 187729792     gbpat246.seq
 500000259     gbpat247.seq
 499999167     gbpat248.seq
 499999565     gbpat249.seq
 499998170     gbpat25.seq
 499999032     gbpat250.seq
 137671023     gbpat251.seq
 500000121     gbpat26.seq
 165949853     gbpat27.seq
 499998132     gbpat28.seq
 499999730     gbpat29.seq
  61235036     gbpat3.seq
 213218489     gbpat30.seq
 499999775     gbpat31.seq
 406041956     gbpat32.seq
 500000232     gbpat33.seq
 499999610     gbpat34.seq
 126502891     gbpat35.seq
 499998657     gbpat36.seq
 499998589     gbpat37.seq
 500000250     gbpat38.seq
 140149161     gbpat39.seq
 499999693     gbpat4.seq
 499998922     gbpat40.seq
 493982072     gbpat41.seq
 494767338     gbpat42.seq
 499999636     gbpat43.seq
 149226143     gbpat44.seq
 499999126     gbpat45.seq
 499999712     gbpat46.seq
 499999132     gbpat47.seq
  87870778     gbpat48.seq
 499999099     gbpat49.seq
 499999462     gbpat5.seq
 500000016     gbpat50.seq
 499999147     gbpat51.seq
 130957592     gbpat52.seq
 500000102     gbpat53.seq
 499999084     gbpat54.seq
 185001858     gbpat55.seq
 499999726     gbpat56.seq
 499999154     gbpat57.seq
 137265710     gbpat58.seq
 499998902     gbpat59.seq
 419178641     gbpat6.seq
 499638184     gbpat60.seq
 429857173     gbpat61.seq
 499999542     gbpat62.seq
 321038498     gbpat63.seq
 499999785     gbpat64.seq
 500000208     gbpat65.seq
 306249927     gbpat66.seq
 499999595     gbpat67.seq
 499997159     gbpat68.seq
 144919043     gbpat69.seq
 499997454     gbpat7.seq
 499999495     gbpat70.seq
 226235202     gbpat71.seq
 499942763     gbpat72.seq
 500000257     gbpat73.seq
 309555677     gbpat74.seq
 499990988     gbpat75.seq
 499996904     gbpat76.seq
 259606120     gbpat77.seq
 499998418     gbpat78.seq
 499997914     gbpat79.seq
 499999292     gbpat8.seq
  36785301     gbpat80.seq
 500000256     gbpat81.seq
 474123180     gbpat82.seq
 500000218     gbpat83.seq
 331737122     gbpat84.seq
 500000006     gbpat85.seq
 312037004     gbpat86.seq
 499998065     gbpat87.seq
 499999877     gbpat88.seq
 499999042     gbpat89.seq
 317342329     gbpat9.seq
 205600783     gbpat90.seq
 499999444     gbpat91.seq
 455869832     gbpat92.seq
 499962970     gbpat93.seq
 252289610     gbpat94.seq
 499995434     gbpat95.seq
 499998988     gbpat96.seq
  83008041     gbpat97.seq
 499999689     gbpat98.seq
 498236426     gbpat99.seq
 499947976     gbphg1.seq
 499975031     gbphg2.seq
 499937632     gbphg3.seq
 499995845     gbphg4.seq
 499967614     gbphg5.seq
  26537822     gbphg6.seq
 500000046     gbpln1.seq
 269118160     gbpln10.seq
 172948890     gbpln100.seq
 485439355     gbpln101.seq
 339967820     gbpln102.seq
 410604091     gbpln103.seq
 459875355     gbpln104.seq
 499126589     gbpln105.seq
 182005156     gbpln106.seq
 498973363     gbpln107.seq
 472540038     gbpln108.seq
 453105795     gbpln109.seq
 499929013     gbpln11.seq
 445429529     gbpln110.seq
 387853287     gbpln111.seq
 496158394     gbpln112.seq
 499810239     gbpln113.seq
 498684982     gbpln114.seq
 312787398     gbpln115.seq
 489314534     gbpln116.seq
 490138334     gbpln117.seq
 499769121     gbpln118.seq
 489726504     gbpln119.seq
 498517051     gbpln12.seq
 327453311     gbpln120.seq
 499392066     gbpln121.seq
 496453930     gbpln122.seq
 498184035     gbpln123.seq
 248507525     gbpln124.seq
 498469725     gbpln125.seq
 498968398     gbpln126.seq
 486993903     gbpln127.seq
 437631844     gbpln128.seq
 494834656     gbpln129.seq
 469955827     gbpln13.seq
 451431754     gbpln130.seq
 492455661     gbpln131.seq
 496519244     gbpln132.seq
  93142442     gbpln133.seq
     86418     gbpln134.seq
    361751     gbpln135.seq
 164981014     gbpln136.seq
  40086546     gbpln137.seq
  74918158     gbpln138.seq
 499998096     gbpln139.seq
 170594856     gbpln14.seq
 358029370     gbpln140.seq
 499996771     gbpln141.seq
 499999220     gbpln142.seq
 143988284     gbpln143.seq
 499999809     gbpln144.seq
 499623204     gbpln145.seq
 499987809     gbpln146.seq
 290884047     gbpln147.seq
 298790210     gbpln148.seq
 211421374     gbpln149.seq
 496172808     gbpln15.seq
 248643853     gbpln150.seq
 185682353     gbpln151.seq
 997331398     gbpln152.seq
  56523034     gbpln153.seq
 487355057     gbpln154.seq
 473525596     gbpln155.seq
 473209473     gbpln156.seq
 467870636     gbpln157.seq
 168324953     gbpln158.seq
 442168066     gbpln159.seq
 478405727     gbpln16.seq
 460425795     gbpln160.seq
 479222672     gbpln161.seq
  92564056     gbpln162.seq
 609356119     gbpln163.seq
 786074578     gbpln164.seq
 733167229     gbpln165.seq
 736239733     gbpln166.seq
 691575746     gbpln167.seq
 660133963     gbpln168.seq
 739031764     gbpln169.seq
 335223965     gbpln17.seq
 457972471     gbpln170.seq
 425747849     gbpln171.seq
 499999850     gbpln172.seq
  66345180     gbpln173.seq
 499999605     gbpln174.seq
 499999000     gbpln175.seq
 272255728     gbpln176.seq
 499997737     gbpln177.seq
 499999975     gbpln178.seq
  94187000     gbpln179.seq
 418823303     gbpln18.seq
 499999908     gbpln180.seq
 483529904     gbpln181.seq
 499961353     gbpln182.seq
 420449466     gbpln183.seq
 499999140     gbpln184.seq
 389541319     gbpln185.seq
 499997824     gbpln186.seq
 499998802     gbpln187.seq
 499729751     gbpln188.seq
  69710350     gbpln189.seq
 499938071     gbpln19.seq
 499997375     gbpln190.seq
 499711775     gbpln191.seq
 423077618     gbpln192.seq
 499999602     gbpln193.seq
 499927218     gbpln194.seq
 497916084     gbpln195.seq
 386262374     gbpln196.seq
 499834495     gbpln197.seq
 491611151     gbpln198.seq
 402785639     gbpln199.seq
 499906320     gbpln2.seq
 176538317     gbpln20.seq
 445924319     gbpln200.seq
 499814863     gbpln201.seq
   5645589     gbpln202.seq
 492253947     gbpln203.seq
 226945063     gbpln204.seq
 315788399     gbpln205.seq
 665291577     gbpln206.seq
 860028189     gbpln207.seq
 800605872     gbpln208.seq
 794469115     gbpln209.seq
 346155812     gbpln21.seq
 762933697     gbpln210.seq
 729969959     gbpln211.seq
 808217924     gbpln212.seq
 209362173     gbpln213.seq
 924325157     gbpln214.seq
1201978654     gbpln215.seq
1227268207     gbpln216.seq
1152253241     gbpln217.seq
1115248374     gbpln218.seq
1125506105     gbpln219.seq
 384952403     gbpln22.seq
1145303472     gbpln220.seq
 695608615     gbpln221.seq
 494748957     gbpln222.seq
 460644363     gbpln223.seq
 152680390     gbpln224.seq
 463010270     gbpln225.seq
 480459220     gbpln226.seq
 494737040     gbpln227.seq
 446440757     gbpln228.seq
 417743779     gbpln229.seq
 205693038     gbpln23.seq
 250838119     gbpln230.seq
 364689197     gbpln231.seq
 339196729     gbpln232.seq
 386320509     gbpln233.seq
 311828079     gbpln234.seq
 213907446     gbpln235.seq
 547058897     gbpln236.seq
 117077133     gbpln237.seq
 485280656     gbpln238.seq
 153318470     gbpln239.seq
  85942713     gbpln24.seq
 689933987     gbpln240.seq
 887561680     gbpln241.seq
 834970472     gbpln242.seq
 826391913     gbpln243.seq
 792513917     gbpln244.seq
 743209872     gbpln245.seq
 833073712     gbpln246.seq
    564051     gbpln247.seq
 665291577     gbpln248.seq
 860028189     gbpln249.seq
 477917640     gbpln25.seq
 800605872     gbpln250.seq
 794469115     gbpln251.seq
 762933697     gbpln252.seq
 729969959     gbpln253.seq
 808217924     gbpln254.seq
 189166688     gbpln255.seq
 663098252     gbpln256.seq
 855592604     gbpln257.seq
 807031053     gbpln258.seq
 793905039     gbpln259.seq
 499904144     gbpln26.seq
 773303164     gbpln260.seq
 718153248     gbpln261.seq
 804870210     gbpln262.seq
 661762125     gbpln263.seq
 840180304     gbpln264.seq
 796430245     gbpln265.seq
 779180715     gbpln266.seq
 761224530     gbpln267.seq
 725380245     gbpln268.seq
 792983451     gbpln269.seq
 498817673     gbpln27.seq
 652402241     gbpln270.seq
 831209396     gbpln271.seq
 783682955     gbpln272.seq
 775938782     gbpln273.seq
 741958804     gbpln274.seq
 700440901     gbpln275.seq
 788705159     gbpln276.seq
 683172189     gbpln277.seq
 854365289     gbpln278.seq
 802776370     gbpln279.seq
 323729344     gbpln28.seq
 793295936     gbpln280.seq
 769246264     gbpln281.seq
 710912943     gbpln282.seq
 799876839     gbpln283.seq
 635039454     gbpln284.seq
 824184474     gbpln285.seq
 768070182     gbpln286.seq
 758956882     gbpln287.seq
 732189331     gbpln288.seq
 706311232     gbpln289.seq
 499081183     gbpln29.seq
 766293442     gbpln290.seq
 651415133     gbpln291.seq
 830082304     gbpln292.seq
 783385752     gbpln293.seq
 770520351     gbpln294.seq
 753421970     gbpln295.seq
 699441547     gbpln296.seq
 784443196     gbpln297.seq
 702337808     gbpln298.seq
 906907390     gbpln299.seq
 499985187     gbpln3.seq
 497391888     gbpln30.seq
 844110716     gbpln300.seq
 841780855     gbpln301.seq
 805270043     gbpln302.seq
 764396863     gbpln303.seq
 841492595     gbpln304.seq
 714482811     gbpln305.seq
 916127997     gbpln306.seq
 858459407     gbpln307.seq
 848936990     gbpln308.seq
 813129213     gbpln309.seq
 499428080     gbpln31.seq
 765593150     gbpln310.seq
 862731158     gbpln311.seq
 665885340     gbpln312.seq
 629668050     gbpln313.seq
 814320946     gbpln314.seq
 759349720     gbpln315.seq
 762512207     gbpln316.seq
 724647884     gbpln317.seq
 679679449     gbpln318.seq
 784312844     gbpln319.seq
 103294636     gbpln32.seq
 684180819     gbpln320.seq
 873292213     gbpln321.seq
 827422505     gbpln322.seq
 815925825     gbpln323.seq
 779009585     gbpln324.seq
 739747654     gbpln325.seq
 834950434     gbpln326.seq
 663096073     gbpln327.seq
 849628701     gbpln328.seq
 803882830     gbpln329.seq
 496566630     gbpln33.seq
 794420470     gbpln330.seq
 760127459     gbpln331.seq
 714663802     gbpln332.seq
 801095950     gbpln333.seq
 668869887     gbpln334.seq
 854770002     gbpln335.seq
 805931576     gbpln336.seq
 798923954     gbpln337.seq
 766411223     gbpln338.seq
 723133936     gbpln339.seq
 498203430     gbpln34.seq
 803351408     gbpln340.seq
 664176987     gbpln341.seq
 854339916     gbpln342.seq
 803900400     gbpln343.seq
 791449620     gbpln344.seq
 761145205     gbpln345.seq
 715062603     gbpln346.seq
 806379176     gbpln347.seq
 668964953     gbpln348.seq
 870939392     gbpln349.seq
 349198506     gbpln35.seq
 809408813     gbpln350.seq
 801514137     gbpln351.seq
 768794024     gbpln352.seq
 723644689     gbpln353.seq
 815153418     gbpln354.seq
 661177159     gbpln355.seq
 846934671     gbpln356.seq
 794708793     gbpln357.seq
 789781753     gbpln358.seq
 764576068     gbpln359.seq
 454048573     gbpln36.seq
 711115451     gbpln360.seq
 797517245     gbpln361.seq
 691953899     gbpln362.seq
 888406351     gbpln363.seq
 835271741     gbpln364.seq
 823533989     gbpln365.seq
 787819193     gbpln366.seq
 748786657     gbpln367.seq
 838184652     gbpln368.seq
 488796010     gbpln369.seq
 495221947     gbpln37.seq
 439661491     gbpln370.seq
 155752105     gbpln371.seq
 758806100     gbpln372.seq
 898446949     gbpln373.seq
 628489896     gbpln374.seq
1024113089     gbpln375.seq
1032878661     gbpln376.seq
 858694781     gbpln377.seq
 960391204     gbpln378.seq
1090094606     gbpln379.seq
 486126470     gbpln38.seq
 781959143     gbpln380.seq
 946995961     gbpln381.seq
 857542781     gbpln382.seq
 656405285     gbpln383.seq
 907889097     gbpln384.seq
 896386890     gbpln385.seq
 726432335     gbpln386.seq
 798296822     gbpln387.seq
 918393750     gbpln388.seq
 584961784     gbpln389.seq
 498663684     gbpln39.seq
 948865971     gbpln390.seq
 954536271     gbpln391.seq
 819735731     gbpln392.seq
 756588093     gbpln393.seq
 876067119     gbpln394.seq
 625446321     gbpln395.seq
 977801494     gbpln396.seq
 854357980     gbpln397.seq
 807732556     gbpln398.seq
 947696453     gbpln399.seq
 499910963     gbpln4.seq
 471931476     gbpln40.seq
1067629605     gbpln400.seq
 822222048     gbpln401.seq
 950272996     gbpln402.seq
 845138843     gbpln403.seq
 643846993     gbpln404.seq
 894745096     gbpln405.seq
 893352134     gbpln406.seq
 722578984     gbpln407.seq
 776227316     gbpln408.seq
 899750467     gbpln409.seq
 497321365     gbpln41.seq
 592059964     gbpln410.seq
 933986451     gbpln411.seq
 939527664     gbpln412.seq
 810117922     gbpln413.seq
 765938558     gbpln414.seq
 886537018     gbpln415.seq
 623519964     gbpln416.seq
 996940649     gbpln417.seq
1030190034     gbpln418.seq
 832828033     gbpln419.seq
 472649861     gbpln42.seq
 956342979     gbpln420.seq
1134286144     gbpln421.seq
 790513299     gbpln422.seq
 944161893     gbpln423.seq
 860035788     gbpln424.seq
 647268685     gbpln425.seq
 902239623     gbpln426.seq
 611029440     gbpln427.seq
 734907577     gbpln428.seq
 787834228     gbpln429.seq
 478648821     gbpln43.seq
 910724363     gbpln430.seq
 606016896     gbpln431.seq
 961485234     gbpln432.seq
1242775191     gbpln433.seq
 816670128     gbpln434.seq
 636658925     gbpln435.seq
 818591771     gbpln436.seq
 766580884     gbpln437.seq
 752100829     gbpln438.seq
 724519993     gbpln439.seq
  83738365     gbpln44.seq
 690955648     gbpln440.seq
 769738288     gbpln441.seq
 750738544     gbpln442.seq
 872184389     gbpln443.seq
 624480879     gbpln444.seq
 995069022     gbpln445.seq
1012956234     gbpln446.seq
 827074347     gbpln447.seq
 940621783     gbpln448.seq
1079418810     gbpln449.seq
 494333293     gbpln45.seq
 776922106     gbpln450.seq
 938380968     gbpln451.seq
 848757671     gbpln452.seq
 643572913     gbpln453.seq
 891714442     gbpln454.seq
 878638403     gbpln455.seq
 721632671     gbpln456.seq
 779156122     gbpln457.seq
 895553446     gbpln458.seq
 604678568     gbpln459.seq
 475215142     gbpln46.seq
 931006295     gbpln460.seq
 933660027     gbpln461.seq
 810459540     gbpln462.seq
 761872100     gbpln463.seq
 878702815     gbpln464.seq
 627081460     gbpln465.seq
 994320235     gbpln466.seq
 999434327     gbpln467.seq
 823789349     gbpln468.seq
 945629782     gbpln469.seq
 468208544     gbpln47.seq
1062113821     gbpln470.seq
 792298939     gbpln471.seq
 941851700     gbpln472.seq
 850142413     gbpln473.seq
 656955691     gbpln474.seq
 904094753     gbpln475.seq
 900193903     gbpln476.seq
 728906821     gbpln477.seq
 741172650     gbpln478.seq
 898719079     gbpln479.seq
 486858437     gbpln48.seq
 599002526     gbpln480.seq
 937117048     gbpln481.seq
 936021119     gbpln482.seq
 812696702     gbpln483.seq
 746628212     gbpln484.seq
 897168807     gbpln485.seq
 626698501     gbpln486.seq
1007072101     gbpln487.seq
1000831797     gbpln488.seq
 841918855     gbpln489.seq
 272302955     gbpln49.seq
 963426816     gbpln490.seq
1093654114     gbpln491.seq
 791118382     gbpln492.seq
 959940756     gbpln493.seq
 853263842     gbpln494.seq
 648051398     gbpln495.seq
 901282075     gbpln496.seq
 923491092     gbpln497.seq
 732477869     gbpln498.seq
 789987733     gbpln499.seq
 478116829     gbpln5.seq
 172902191     gbpln50.seq
 926022053     gbpln500.seq
 610840579     gbpln501.seq
 949759032     gbpln502.seq
 955444559     gbpln503.seq
 818480442     gbpln504.seq
 752251380     gbpln505.seq
 897893149     gbpln506.seq
 631111272     gbpln507.seq
1022032953     gbpln508.seq
1006306956     gbpln509.seq
 471233536     gbpln51.seq
 837035085     gbpln510.seq
 966140819     gbpln511.seq
1090560006     gbpln512.seq
 800164754     gbpln513.seq
 959884028     gbpln514.seq
 886916735     gbpln515.seq
 641540050     gbpln516.seq
 910168783     gbpln517.seq
 908785549     gbpln518.seq
 729527181     gbpln519.seq
 455042321     gbpln52.seq
 797552105     gbpln520.seq
 910975470     gbpln521.seq
 616026199     gbpln522.seq
 945685366     gbpln523.seq
 953145956     gbpln524.seq
 820081609     gbpln525.seq
 763165947     gbpln526.seq
 870898266     gbpln527.seq
 618200825     gbpln528.seq
1009123187     gbpln529.seq
 488809223     gbpln53.seq
1016689515     gbpln530.seq
 832912303     gbpln531.seq
 952656374     gbpln532.seq
1065835283     gbpln533.seq
 776075044     gbpln534.seq
 935940025     gbpln535.seq
 846831932     gbpln536.seq
 641399988     gbpln537.seq
 892709705     gbpln538.seq
 594848385     gbpln539.seq
 355272263     gbpln54.seq
 720169483     gbpln540.seq
 780564861     gbpln541.seq
 888344689     gbpln542.seq
 610800072     gbpln543.seq
 934713391     gbpln544.seq
1233388213     gbpln545.seq
 807523234     gbpln546.seq
     19542     gbpln547.seq
 757881986     gbpln548.seq
 889760627     gbpln549.seq
 200538454     gbpln55.seq
 635890046     gbpln550.seq
1007873898     gbpln551.seq
1015524558     gbpln552.seq
 836625022     gbpln553.seq
 959076059     gbpln554.seq
1077416379     gbpln555.seq
 789416089     gbpln556.seq
 958430056     gbpln557.seq
 877922843     gbpln558.seq
 648665455     gbpln559.seq
 377219536     gbpln56.seq
 907513209     gbpln560.seq
 904978028     gbpln561.seq
 727024880     gbpln562.seq
 789120540     gbpln563.seq
 898507915     gbpln564.seq
 617229811     gbpln565.seq
 942711764     gbpln566.seq
 964780021     gbpln567.seq
 818917331     gbpln568.seq
 755294557     gbpln569.seq
 375192640     gbpln57.seq
 882064051     gbpln570.seq
 627203691     gbpln571.seq
 993595919     gbpln572.seq
1021497440     gbpln573.seq
 827286497     gbpln574.seq
 962451301     gbpln575.seq
1082256067     gbpln576.seq
 781463827     gbpln577.seq
 919665368     gbpln578.seq
 852133929     gbpln579.seq
 386441749     gbpln58.seq
 645388382     gbpln580.seq
 905574854     gbpln581.seq
 906714977     gbpln582.seq
 718743537     gbpln583.seq
 787529633     gbpln584.seq
 910251919     gbpln585.seq
 608518276     gbpln586.seq
 934541265     gbpln587.seq
 954054955     gbpln588.seq
 806443717     gbpln589.seq
 482478614     gbpln59.seq
1009766480     gbpln590.seq
1253136609     gbpln591.seq
1066198175     gbpln592.seq
1119572655     gbpln593.seq
1040217505     gbpln594.seq
1310077288     gbpln595.seq
 955690374     gbpln596.seq
1230684440     gbpln597.seq
1179787958     gbpln598.seq
1125383520     gbpln599.seq
 499997517     gbpln6.seq
 473293925     gbpln60.seq
1051194518     gbpln600.seq
 965656648     gbpln601.seq
1110281977     gbpln602.seq
     32675     gbpln603.seq
 571276830     gbpln604.seq
 813242428     gbpln605.seq
 666750031     gbpln606.seq
 786165017     gbpln607.seq
 685610716     gbpln608.seq
1310077431     gbpln609.seq
 476593700     gbpln61.seq
 253174689     gbpln610.seq
 654245898     gbpln611.seq
 843080362     gbpln612.seq
 787261705     gbpln613.seq
 773098599     gbpln614.seq
 745082094     gbpln615.seq
 711612756     gbpln616.seq
 801222610     gbpln617.seq
    271464     gbpln618.seq
 398651709     gbpln619.seq
 434249982     gbpln62.seq
 315170317     gbpln620.seq
 306732013     gbpln621.seq
 319872292     gbpln622.seq
 286450423     gbpln623.seq
 220883441     gbpln624.seq
 470283415     gbpln625.seq
 475850186     gbpln626.seq
 499132161     gbpln627.seq
 460644363     gbpln628.seq
 359155255     gbpln629.seq
 440487400     gbpln63.seq
 399402445     gbpln630.seq
 501115666     gbpln631.seq
 413826113     gbpln632.seq
 367000227     gbpln633.seq
 238050627     gbpln634.seq
 352241749     gbpln635.seq
 298781185     gbpln636.seq
 490716477     gbpln637.seq
  86107932     gbpln638.seq
   9838016     gbpln639.seq
 444203819     gbpln64.seq
  10182575     gbpln640.seq
 766528189     gbpln641.seq
 422678220     gbpln642.seq
 133578941     gbpln643.seq
 756143249     gbpln644.seq
 878426054     gbpln645.seq
 631056251     gbpln646.seq
 993852367     gbpln647.seq
1020132695     gbpln648.seq
 830166807     gbpln649.seq
 189178941     gbpln65.seq
 955723315     gbpln650.seq
1057964328     gbpln651.seq
 784007552     gbpln652.seq
 947940191     gbpln653.seq
 857511193     gbpln654.seq
 649137171     gbpln655.seq
 903393879     gbpln656.seq
 908180396     gbpln657.seq
 721135945     gbpln658.seq
 786739709     gbpln659.seq
 460469415     gbpln66.seq
 918070756     gbpln660.seq
 603192844     gbpln661.seq
 938102555     gbpln662.seq
 955978436     gbpln663.seq
 813787878     gbpln664.seq
 639701128     gbpln665.seq
 468559129     gbpln666.seq
 499484875     gbpln667.seq
 498595949     gbpln668.seq
  20796213     gbpln669.seq
 440542307     gbpln67.seq
 768129678     gbpln670.seq
 891209633     gbpln671.seq
1017177961     gbpln672.seq
1036708108     gbpln673.seq
 980496603     gbpln674.seq
1096870510     gbpln675.seq
 964601805     gbpln676.seq
 883690282     gbpln677.seq
 879367269     gbpln678.seq
 922136688     gbpln679.seq
 452992006     gbpln68.seq
 805432021     gbpln680.seq
 912345991     gbpln681.seq
 954500353     gbpln682.seq
 944560088     gbpln683.seq
  29543156     gbpln684.seq
 404132416     gbpln685.seq
 499998110     gbpln686.seq
 499998870     gbpln687.seq
 488724683     gbpln688.seq
 499997219     gbpln689.seq
 497916786     gbpln69.seq
 500000090     gbpln690.seq
 499999079     gbpln691.seq
  68958110     gbpln692.seq
 499795909     gbpln693.seq
 500000232     gbpln694.seq
 499852998     gbpln695.seq
 279330466     gbpln696.seq
 499995621     gbpln697.seq
 500000189     gbpln698.seq
 499999506     gbpln699.seq
 499965622     gbpln7.seq
 480376128     gbpln70.seq
 499811178     gbpln700.seq
 499951659     gbpln701.seq
 424179559     gbpln702.seq
 499928755     gbpln703.seq
 499823604     gbpln704.seq
 499822980     gbpln705.seq
 499853559     gbpln706.seq
 201358594     gbpln707.seq
 499758215     gbpln708.seq
 499999549     gbpln709.seq
  71745252     gbpln71.seq
 442976502     gbpln710.seq
 393602368     gbpln711.seq
 674055631     gbpln712.seq
 865045961     gbpln713.seq
 815791689     gbpln714.seq
 802718902     gbpln715.seq
 776304595     gbpln716.seq
 721531499     gbpln717.seq
 809857060     gbpln718.seq
 679344023     gbpln719.seq
 470916910     gbpln72.seq
 873797632     gbpln720.seq
 820367220     gbpln721.seq
 806296382     gbpln722.seq
 775209384     gbpln723.seq
 744231520     gbpln724.seq
 817156402     gbpln725.seq
 771380170     gbpln726.seq
 913253142     gbpln727.seq
 634934982     gbpln728.seq
1019175188     gbpln729.seq
 472129613     gbpln73.seq
1023638564     gbpln730.seq
 822225605     gbpln731.seq
 961290952     gbpln732.seq
1090804562     gbpln733.seq
 813694518     gbpln734.seq
 962545328     gbpln735.seq
 873725319     gbpln736.seq
 673190932     gbpln737.seq
 905064826     gbpln738.seq
 908590682     gbpln739.seq
 477884160     gbpln74.seq
 742712720     gbpln740.seq
 793279946     gbpln741.seq
 934932909     gbpln742.seq
 640700840     gbpln743.seq
 961568346     gbpln744.seq
 952066709     gbpln745.seq
 827214105     gbpln746.seq
 455119462     gbpln747.seq
 225684096     gbpln748.seq
 606043508     gbpln749.seq
 460004048     gbpln75.seq
 672463125     gbpln750.seq
 670817585     gbpln751.seq
 780744058     gbpln752.seq
 709786512     gbpln753.seq
 699981562     gbpln754.seq
 605149255     gbpln755.seq
 587850547     gbpln756.seq
 521338120     gbpln757.seq
 584041437     gbpln758.seq
 586940588     gbpln759.seq
 430418757     gbpln76.seq
 609718005     gbpln760.seq
 520752700     gbpln761.seq
 615367005     gbpln762.seq
 678802656     gbpln763.seq
 605705300     gbpln764.seq
 527901029     gbpln765.seq
 594666424     gbpln766.seq
 615720876     gbpln767.seq
 576353787     gbpln768.seq
 633125913     gbpln769.seq
 441540984     gbpln77.seq
 548771038     gbpln770.seq
 692441926     gbpln771.seq
 738372723     gbpln772.seq
 858786609     gbpln773.seq
 737516125     gbpln774.seq
 745059790     gbpln775.seq
 651602876     gbpln776.seq
 604402452     gbpln777.seq
 664905852     gbpln778.seq
 584308779     gbpln779.seq
 433637010     gbpln78.seq
 534160827     gbpln780.seq
 630362011     gbpln781.seq
 371796154     gbpln782.seq
 630301669     gbpln783.seq
 687847932     gbpln784.seq
 613107925     gbpln785.seq
 667785968     gbpln786.seq
 650171823     gbpln787.seq
 580307298     gbpln788.seq
 567733798     gbpln789.seq
 498225038     gbpln79.seq
 731990266     gbpln790.seq
 671427656     gbpln791.seq
 677581011     gbpln792.seq
 698173221     gbpln793.seq
 745221924     gbpln794.seq
 582651670     gbpln795.seq
 703621750     gbpln796.seq
 577456739     gbpln797.seq
 645348701     gbpln798.seq
 738102834     gbpln799.seq
 226173587     gbpln8.seq
 107502759     gbpln80.seq
 718402060     gbpln800.seq
 581705801     gbpln801.seq
 731196724     gbpln802.seq
 559541923     gbpln803.seq
 676833439     gbpln804.seq
   5774756     gbpln805.seq
 777312364     gbpln806.seq
1006352199     gbpln807.seq
 962815279     gbpln808.seq
 975138624     gbpln809.seq
 449964742     gbpln81.seq
 906550423     gbpln810.seq
 790269619     gbpln811.seq
 956926034     gbpln812.seq
 908369814     gbpln813.seq
1035806383     gbpln814.seq
1095241384     gbpln815.seq
 889046375     gbpln816.seq
 920177986     gbpln817.seq
 934896187     gbpln818.seq
 972756494     gbpln819.seq
 422837725     gbpln82.seq
 639243888     gbpln820.seq
 839211114     gbpln821.seq
 802168717     gbpln822.seq
 677231763     gbpln823.seq
 740101369     gbpln824.seq
 642539818     gbpln825.seq
 835613563     gbpln826.seq
 284703679     gbpln827.seq
 252385105     gbpln828.seq
 408962039     gbpln829.seq
 383453843     gbpln83.seq
 329779393     gbpln830.seq
 332794404     gbpln831.seq
 418495189     gbpln832.seq
 443558619     gbpln833.seq
 449429603     gbpln834.seq
 403262216     gbpln835.seq
 477398793     gbpln836.seq
 434368515     gbpln837.seq
 443534393     gbpln838.seq
 467732940     gbpln839.seq
 376172115     gbpln84.seq
 495326106     gbpln840.seq
 324405875     gbpln841.seq
 434627789     gbpln842.seq
 412605137     gbpln843.seq
 487251291     gbpln844.seq
 475651653     gbpln845.seq
 480188814     gbpln846.seq
 445114184     gbpln847.seq
  94039783     gbpln848.seq
 598056431     gbpln849.seq
 326317072     gbpln85.seq
 774899230     gbpln850.seq
 723495076     gbpln851.seq
 714415062     gbpln852.seq
 677999217     gbpln853.seq
 629027473     gbpln854.seq
 732833308     gbpln855.seq
 468595438     gbpln856.seq
 493393841     gbpln857.seq
 474777368     gbpln858.seq
 380656625     gbpln859.seq
 320571252     gbpln86.seq
 467899242     gbpln860.seq
 253241093     gbpln861.seq
 752395251     gbpln862.seq
 890282441     gbpln863.seq
 626588937     gbpln864.seq
1004358313     gbpln865.seq
1028945402     gbpln866.seq
 838465030     gbpln867.seq
 950517847     gbpln868.seq
1082441570     gbpln869.seq
 286199716     gbpln87.seq
 789583361     gbpln870.seq
 950035125     gbpln871.seq
 853507173     gbpln872.seq
 659807142     gbpln873.seq
 902654821     gbpln874.seq
 890952839     gbpln875.seq
 721824594     gbpln876.seq
 785634142     gbpln877.seq
 909002040     gbpln878.seq
 625532225     gbpln879.seq
 277716231     gbpln88.seq
 945667284     gbpln880.seq
 953425672     gbpln881.seq
 821771931     gbpln882.seq
  49581757     gbpln883.seq
 685150899     gbpln884.seq
 568933027     gbpln885.seq
 539200572     gbpln886.seq
 586715283     gbpln887.seq
 614749845     gbpln888.seq
 568071180     gbpln889.seq
 499733063     gbpln89.seq
 625152324     gbpln890.seq
 586214038     gbpln891.seq
 746226242     gbpln892.seq
 808684234     gbpln893.seq
 907082737     gbpln894.seq
 776688083     gbpln895.seq
 793241091     gbpln896.seq
 698856800     gbpln897.seq
 613367786     gbpln898.seq
 674018870     gbpln899.seq
 500000209     gbpln9.seq
  79413455     gbpln90.seq
 609236499     gbpln900.seq
 576790769     gbpln901.seq
 632368980     gbpln902.seq
 377507333     gbpln903.seq
 669127592     gbpln904.seq
 466233189     gbpln905.seq
 475319363     gbpln906.seq
 487661076     gbpln907.seq
 318504137     gbpln908.seq
 198037398     gbpln909.seq
 391026515     gbpln91.seq
 752395251     gbpln910.seq
 890282441     gbpln911.seq
 626588937     gbpln912.seq
1004358313     gbpln913.seq
1028945402     gbpln914.seq
 838465030     gbpln915.seq
 950517847     gbpln916.seq
1082441570     gbpln917.seq
 789583361     gbpln918.seq
 950035125     gbpln919.seq
 362500946     gbpln92.seq
 853507173     gbpln920.seq
 659807142     gbpln921.seq
 902654821     gbpln922.seq
 890952839     gbpln923.seq
 721824594     gbpln924.seq
 785634142     gbpln925.seq
 909002040     gbpln926.seq
 625532225     gbpln927.seq
 945667284     gbpln928.seq
 953425672     gbpln929.seq
 390024684     gbpln93.seq
 821771931     gbpln930.seq
 459014377     gbpln931.seq
 468913443     gbpln932.seq
 341773034     gbpln94.seq
 199854530     gbpln95.seq
 483137201     gbpln96.seq
 493810295     gbpln97.seq
 497201312     gbpln98.seq
 498939460     gbpln99.seq
 148373644     gbpri1.seq
 499825465     gbpri10.seq
 499966274     gbpri11.seq
 248882813     gbpri12.seq
 499849548     gbpri13.seq
 352976792     gbpri14.seq
 162644199     gbpri15.seq
 494716433     gbpri16.seq
 499956353     gbpri17.seq
 499952905     gbpri18.seq
 499962255     gbpri19.seq
 499849627     gbpri2.seq
 254317986     gbpri20.seq
 317623598     gbpri21.seq
 301999301     gbpri22.seq
 491210434     gbpri23.seq
 445784934     gbpri24.seq
 381564573     gbpri25.seq
 343180385     gbpri26.seq
 476587750     gbpri27.seq
 474072351     gbpri28.seq
 368094033     gbpri29.seq
 499891275     gbpri3.seq
 500000086     gbpri30.seq
  73914612     gbpri31.seq
 499936200     gbpri32.seq
 445709575     gbpri33.seq
 427947001     gbpri34.seq
 376529642     gbpri35.seq
 483909975     gbpri36.seq
 361488390     gbpri37.seq
 388660134     gbpri38.seq
 448630862     gbpri39.seq
 499855408     gbpri4.seq
 499942041     gbpri40.seq
 307422469     gbpri41.seq
 314630532     gbpri42.seq
 499799729     gbpri43.seq
 499998264     gbpri44.seq
 213803014     gbpri45.seq
 499994934     gbpri46.seq
 499999185     gbpri47.seq
 316412523     gbpri48.seq
 499987377     gbpri49.seq
 499729176     gbpri5.seq
 499997295     gbpri50.seq
 322639302     gbpri51.seq
 258775295     gbpri52.seq
 499996685     gbpri53.seq
 499999737     gbpri54.seq
 500000042     gbpri55.seq
 499925165     gbpri56.seq
  19842823     gbpri57.seq
 393528728     gbpri6.seq
 499802910     gbpri7.seq
 499984899     gbpri8.seq
 499967070     gbpri9.seq
    791922     gbrel.txt
 499762712     gbrod1.seq
 499989119     gbrod10.seq
 304437665     gbrod100.seq
 466850318     gbrod101.seq
 387285795     gbrod102.seq
 374061085     gbrod103.seq
 353646450     gbrod104.seq
 160857006     gbrod105.seq
 461956463     gbrod106.seq
 433837685     gbrod107.seq
 474478560     gbrod108.seq
 316311285     gbrod109.seq
   6045317     gbrod11.seq
 418985555     gbrod110.seq
 371050541     gbrod111.seq
 363244190     gbrod112.seq
 482685616     gbrod113.seq
 448001148     gbrod114.seq
 413360146     gbrod115.seq
 419878182     gbrod116.seq
 403492494     gbrod117.seq
 439526332     gbrod118.seq
 248164111     gbrod119.seq
 499810642     gbrod12.seq
 405939473     gbrod120.seq
 384447340     gbrod121.seq
 355679333     gbrod122.seq
 497729616     gbrod123.seq
 445498035     gbrod124.seq
 480858122     gbrod125.seq
 424097302     gbrod126.seq
 389168953     gbrod127.seq
 364557408     gbrod128.seq
 496236266     gbrod129.seq
 203924668     gbrod13.seq
 457035537     gbrod130.seq
 397907216     gbrod131.seq
 303919253     gbrod132.seq
 472719372     gbrod133.seq
 199611566     gbrod134.seq
 379735208     gbrod135.seq
 373874236     gbrod136.seq
 492612107     gbrod137.seq
 455685049     gbrod138.seq
 424015225     gbrod139.seq
 499996367     gbrod14.seq
 422109961     gbrod140.seq
 402489078     gbrod141.seq
 150585215     gbrod142.seq
 432875924     gbrod143.seq
 473809988     gbrod144.seq
 493341944     gbrod145.seq
 369899434     gbrod146.seq
 352286248     gbrod147.seq
 495134062     gbrod148.seq
 469349893     gbrod149.seq
 499997685     gbrod15.seq
 385134441     gbrod150.seq
 370752989     gbrod151.seq
 350782953     gbrod152.seq
 472215298     gbrod153.seq
 440418647     gbrod154.seq
 390673256     gbrod155.seq
 299732413     gbrod156.seq
 469102685     gbrod157.seq
 389834819     gbrod158.seq
 372942018     gbrod159.seq
 499996465     gbrod16.seq
 357041751     gbrod160.seq
 471802981     gbrod161.seq
 442335356     gbrod162.seq
 391897511     gbrod163.seq
 301532802     gbrod164.seq
 249506719     gbrod165.seq
 431031986     gbrod166.seq
 392811039     gbrod167.seq
 374963024     gbrod168.seq
 339853098     gbrod169.seq
 296404600     gbrod17.seq
 465902366     gbrod170.seq
 448509046     gbrod171.seq
 478088985     gbrod172.seq
  74225189     gbrod173.seq
 401026287     gbrod174.seq
 438450513     gbrod175.seq
 392223411     gbrod176.seq
 298791488     gbrod177.seq
 421037306     gbrod178.seq
 377024222     gbrod179.seq
 410578993     gbrod18.seq
 358182039     gbrod180.seq
 498127194     gbrod181.seq
 395007403     gbrod182.seq
 420940299     gbrod183.seq
 420418108     gbrod184.seq
 416033149     gbrod185.seq
 371638158     gbrod186.seq
 322372560     gbrod187.seq
 348873196     gbrod188.seq
 359066586     gbrod189.seq
 485622431     gbrod19.seq
 223330366     gbrod190.seq
 499801667     gbrod2.seq
 447177606     gbrod20.seq
 401874104     gbrod21.seq
 366906621     gbrod22.seq
 178573599     gbrod23.seq
 488460708     gbrod24.seq
 424418862     gbrod25.seq
 451727059     gbrod26.seq
 499112036     gbrod27.seq
 467946548     gbrod28.seq
 425428799     gbrod29.seq
 499860799     gbrod3.seq
 380509124     gbrod30.seq
 359291146     gbrod31.seq
 441031541     gbrod32.seq
 489661762     gbrod33.seq
 301541840     gbrod34.seq
 245696968     gbrod35.seq
 444533522     gbrod36.seq
 404901396     gbrod37.seq
 350079181     gbrod38.seq
 484303888     gbrod39.seq
 499965631     gbrod4.seq
 464197213     gbrod40.seq
 311672321     gbrod41.seq
 441713729     gbrod42.seq
 398906813     gbrod43.seq
 493373336     gbrod44.seq
 407105696     gbrod45.seq
 117842878     gbrod46.seq
 488265022     gbrod47.seq
 434197329     gbrod48.seq
 412800312     gbrod49.seq
 499960342     gbrod5.seq
 454365663     gbrod50.seq
 382748472     gbrod51.seq
 428038719     gbrod52.seq
 487918369     gbrod53.seq
 440586747     gbrod54.seq
 359290553     gbrod55.seq
 442154815     gbrod56.seq
 258123670     gbrod57.seq
 390007635     gbrod58.seq
 346418766     gbrod59.seq
  80291490     gbrod6.seq
 345548222     gbrod60.seq
 465925928     gbrod61.seq
 403537722     gbrod62.seq
 386823577     gbrod63.seq
 403462511     gbrod64.seq
 391812927     gbrod65.seq
 346719868     gbrod66.seq
 491742089     gbrod67.seq
 445010312     gbrod68.seq
 493387550     gbrod69.seq
 499846851     gbrod7.seq
 300864949     gbrod70.seq
 466768965     gbrod71.seq
 374387663     gbrod72.seq
 350248940     gbrod73.seq
 470230178     gbrod74.seq
 465917437     gbrod75.seq
 493546372     gbrod76.seq
 164945760     gbrod77.seq
 484628774     gbrod78.seq
 454009565     gbrod79.seq
 499742719     gbrod8.seq
 499721619     gbrod80.seq
 424825986     gbrod81.seq
 446890073     gbrod82.seq
 474708148     gbrod83.seq
  90079693     gbrod84.seq
 467225531     gbrod85.seq
 482028227     gbrod86.seq
 424295181     gbrod87.seq
 483251778     gbrod88.seq
 409115226     gbrod89.seq
 499945822     gbrod9.seq
 498639764     gbrod90.seq
 439654066     gbrod91.seq
 498614634     gbrod92.seq
 454047523     gbrod93.seq
 391614658     gbrod94.seq
 298912803     gbrod95.seq
 421388313     gbrod96.seq
 353125249     gbrod97.seq
 339090141     gbrod98.seq
 372648418     gbrod99.seq
 499999294     gbsts1.seq
 499998244     gbsts10.seq
 433474352     gbsts11.seq
 499999314     gbsts2.seq
  38297726     gbsts3.seq
 499998792     gbsts4.seq
 499998127     gbsts5.seq
 456725186     gbsts6.seq
 499997583     gbsts7.seq
 500000071     gbsts8.seq
  21007264     gbsts9.seq
 300852153     gbsyn1.seq
 484840372     gbsyn10.seq
 420813753     gbsyn11.seq
 490139440     gbsyn12.seq
 343340422     gbsyn13.seq
 372527348     gbsyn14.seq
 417861289     gbsyn15.seq
 448312981     gbsyn16.seq
 416378132     gbsyn17.seq
 453065790     gbsyn18.seq
 263307032     gbsyn19.seq
 343340424     gbsyn2.seq
 484840366     gbsyn20.seq
 420813747     gbsyn21.seq
 498979310     gbsyn22.seq
 499965897     gbsyn23.seq
  48600940     gbsyn24.seq
 499993129     gbsyn25.seq
 499998662     gbsyn26.seq
 499992485     gbsyn27.seq
 247568381     gbsyn28.seq
 381173931     gbsyn29.seq
 372527353     gbsyn3.seq
 417861297     gbsyn4.seq
 448312992     gbsyn5.seq
  81377357     gbsyn6.seq
 470781602     gbsyn7.seq
 317285242     gbsyn8.seq
 263307034     gbsyn9.seq
 499999170     gbtsa1.seq
 499998753     gbtsa10.seq
 499997439     gbtsa100.seq
 499999811     gbtsa101.seq
 499996108     gbtsa102.seq
 404671505     gbtsa103.seq
 499996434     gbtsa104.seq
 499998444     gbtsa105.seq
 499998535     gbtsa106.seq
 473627173     gbtsa107.seq
 499999949     gbtsa108.seq
 499998832     gbtsa109.seq
 499998190     gbtsa11.seq
 236669988     gbtsa110.seq
 499991596     gbtsa111.seq
 499999834     gbtsa112.seq
 499999770     gbtsa113.seq
 499998939     gbtsa114.seq
  34150369     gbtsa115.seq
 499995781     gbtsa116.seq
 499999069     gbtsa117.seq
 499994937     gbtsa118.seq
 470659755     gbtsa119.seq
 280433046     gbtsa12.seq
 499998218     gbtsa120.seq
 499998672     gbtsa121.seq
 499999924     gbtsa122.seq
 280313902     gbtsa123.seq
 499999116     gbtsa124.seq
 499998111     gbtsa125.seq
 499999818     gbtsa126.seq
 423256101     gbtsa127.seq
 499999281     gbtsa13.seq
 499999878     gbtsa14.seq
 161278711     gbtsa15.seq
 500000121     gbtsa16.seq
 499997432     gbtsa17.seq
 259479616     gbtsa18.seq
 499997528     gbtsa19.seq
 499999528     gbtsa2.seq
 499999892     gbtsa20.seq
 499999414     gbtsa21.seq
  67906184     gbtsa22.seq
 499999284     gbtsa23.seq
 499997823     gbtsa24.seq
 500000065     gbtsa25.seq
 283359410     gbtsa26.seq
 499999395     gbtsa27.seq
 499999391     gbtsa28.seq
  79267140     gbtsa29.seq
 147857334     gbtsa3.seq
 499999538     gbtsa30.seq
 500000008     gbtsa31.seq
 158524644     gbtsa32.seq
 499997307     gbtsa33.seq
 499997530     gbtsa34.seq
 499998210     gbtsa35.seq
 491429005     gbtsa36.seq
 499999905     gbtsa37.seq
 499998822     gbtsa38.seq
 500000094     gbtsa39.seq
 499998486     gbtsa4.seq
 230791770     gbtsa40.seq
 499998695     gbtsa41.seq
 499995446     gbtsa42.seq
 499998871     gbtsa43.seq
 177089009     gbtsa44.seq
 499998570     gbtsa45.seq
 499998681     gbtsa46.seq
 355874071     gbtsa47.seq
 499999532     gbtsa48.seq
 499998797     gbtsa49.seq
 499998583     gbtsa5.seq
 298479435     gbtsa50.seq
 499997916     gbtsa51.seq
 499999651     gbtsa52.seq
 403016270     gbtsa53.seq
 499999771     gbtsa54.seq
 499999873     gbtsa55.seq
 499997210     gbtsa56.seq
 345607399     gbtsa57.seq
 499999894     gbtsa58.seq
 499999942     gbtsa59.seq
  58525382     gbtsa6.seq
 499998719     gbtsa60.seq
 226591463     gbtsa61.seq
 499999722     gbtsa62.seq
 499999282     gbtsa63.seq
 260001225     gbtsa64.seq
 499999567     gbtsa65.seq
 464262990     gbtsa66.seq
 499998462     gbtsa67.seq
 499999620     gbtsa68.seq
 499998268     gbtsa69.seq
 500000064     gbtsa7.seq
 168770314     gbtsa70.seq
 499997567     gbtsa71.seq
 500000162     gbtsa72.seq
 499998185     gbtsa73.seq
   2512297     gbtsa74.seq
 499998125     gbtsa75.seq
 499999999     gbtsa76.seq
 131338866     gbtsa77.seq
 500000012     gbtsa78.seq
 499999875     gbtsa79.seq
 499999969     gbtsa8.seq
  34997856     gbtsa80.seq
 499999375     gbtsa81.seq
 499999860     gbtsa82.seq
 499998711     gbtsa83.seq
 499998835     gbtsa84.seq
  48558845     gbtsa85.seq
 499997725     gbtsa86.seq
 499999047     gbtsa87.seq
 499999084     gbtsa88.seq
  82598188     gbtsa89.seq
 274241542     gbtsa9.seq
 499999824     gbtsa90.seq
 389215892     gbtsa91.seq
 499998191     gbtsa92.seq
 499994249     gbtsa93.seq
 499998640     gbtsa94.seq
 208350764     gbtsa95.seq
 499999734     gbtsa96.seq
 499998253     gbtsa97.seq
 499996332     gbtsa98.seq
 230879944     gbtsa99.seq
   7022810     gbuna1.seq
 499999716     gbvrl1.seq
 499999545     gbvrl10.seq
 499990445     gbvrl100.seq
 182282469     gbvrl101.seq
 500000111     gbvrl102.seq
 499944642     gbvrl103.seq
 499981824     gbvrl104.seq
 229514895     gbvrl105.seq
 499978308     gbvrl106.seq
 499937976     gbvrl107.seq
 499958138     gbvrl108.seq
 440131791     gbvrl109.seq
 499999069     gbvrl11.seq
 499935447     gbvrl110.seq
 499986317     gbvrl111.seq
 499996918     gbvrl112.seq
 143211706     gbvrl113.seq
 499976344     gbvrl114.seq
 499937345     gbvrl115.seq
 499955265     gbvrl116.seq
 496107906     gbvrl117.seq
 499939550     gbvrl118.seq
 499978098     gbvrl119.seq
 499975237     gbvrl12.seq
 499992738     gbvrl120.seq
 257903353     gbvrl121.seq
 499963459     gbvrl122.seq
 499973710     gbvrl123.seq
 499951127     gbvrl124.seq
 499934584     gbvrl125.seq
   7536759     gbvrl126.seq
 499977180     gbvrl127.seq
 499934716     gbvrl128.seq
 499976492     gbvrl129.seq
 163663449     gbvrl13.seq
 499941831     gbvrl130.seq
 312537265     gbvrl131.seq
 499962058     gbvrl132.seq
 499981138     gbvrl133.seq
 499984933     gbvrl134.seq
 499973977     gbvrl135.seq
 499980876     gbvrl136.seq
 225381409     gbvrl137.seq
 499977355     gbvrl138.seq
 499973749     gbvrl139.seq
 499997590     gbvrl14.seq
 499972808     gbvrl140.seq
 322004308     gbvrl141.seq
 499982106     gbvrl142.seq
 499982070     gbvrl143.seq
 499962746     gbvrl144.seq
 293162836     gbvrl145.seq
 499949846     gbvrl146.seq
 499938823     gbvrl147.seq
 499938341     gbvrl148.seq
 183770350     gbvrl149.seq
 499997995     gbvrl15.seq
 499974412     gbvrl150.seq
 499970579     gbvrl151.seq
 499973759     gbvrl152.seq
 499984075     gbvrl153.seq
 254894351     gbvrl154.seq
 499978947     gbvrl155.seq
 499933392     gbvrl156.seq
 499989629     gbvrl157.seq
 238143042     gbvrl158.seq
 499998728     gbvrl159.seq
 134145435     gbvrl16.seq
 499980370     gbvrl160.seq
 499969424     gbvrl161.seq
 499959985     gbvrl162.seq
 280511721     gbvrl163.seq
 499954203     gbvrl164.seq
 499951684     gbvrl165.seq
 499934611     gbvrl166.seq
 499995341     gbvrl167.seq
 227209062     gbvrl168.seq
 499956575     gbvrl169.seq
 499999183     gbvrl17.seq
 499967669     gbvrl170.seq
 499965959     gbvrl171.seq
 336837565     gbvrl172.seq
 499974931     gbvrl173.seq
 499972398     gbvrl174.seq
 499957688     gbvrl175.seq
 149221505     gbvrl176.seq
 499940413     gbvrl177.seq
 499951441     gbvrl178.seq
 499996509     gbvrl179.seq
 499998049     gbvrl18.seq
 152210392     gbvrl180.seq
 499981668     gbvrl181.seq
 499984635     gbvrl182.seq
 499977428     gbvrl183.seq
 466450218     gbvrl184.seq
 499942504     gbvrl185.seq
 499954344     gbvrl186.seq
 499955117     gbvrl187.seq
 499979786     gbvrl188.seq
    267837     gbvrl189.seq
 315633518     gbvrl19.seq
 499990413     gbvrl190.seq
 499956445     gbvrl191.seq
 499969028     gbvrl192.seq
 171691968     gbvrl193.seq
 499952800     gbvrl194.seq
 499943082     gbvrl195.seq
 499953251     gbvrl196.seq
 499954631     gbvrl197.seq
 266046833     gbvrl198.seq
 499964579     gbvrl199.seq
 499998505     gbvrl2.seq
 500000196     gbvrl20.seq
 499960290     gbvrl200.seq
 499954402     gbvrl201.seq
 499943296     gbvrl202.seq
 261481183     gbvrl203.seq
 499971073     gbvrl204.seq
 499962064     gbvrl205.seq
 499987243     gbvrl206.seq
 499975066     gbvrl207.seq
 280634892     gbvrl208.seq
 499941372     gbvrl209.seq
 499994102     gbvrl21.seq
 499988467     gbvrl210.seq
 499959950     gbvrl211.seq
 499963731     gbvrl212.seq
 265786556     gbvrl213.seq
 499949335     gbvrl214.seq
 499965707     gbvrl215.seq
 499974738     gbvrl216.seq
 499979552     gbvrl217.seq
 266820703     gbvrl218.seq
 499992182     gbvrl219.seq
 345422894     gbvrl22.seq
 499953960     gbvrl220.seq
 499979334     gbvrl221.seq
 499979236     gbvrl222.seq
 274396451     gbvrl223.seq
 499935698     gbvrl224.seq
 499991134     gbvrl225.seq
 499958801     gbvrl226.seq
 499966477     gbvrl227.seq
 280516368     gbvrl228.seq
 499999309     gbvrl229.seq
 499998175     gbvrl23.seq
 499947598     gbvrl230.seq
 499979344     gbvrl231.seq
 499933640     gbvrl232.seq
 266982175     gbvrl233.seq
 499950236     gbvrl234.seq
 499984681     gbvrl235.seq
 499934035     gbvrl236.seq
 499992817     gbvrl237.seq
 257223350     gbvrl238.seq
 499967117     gbvrl239.seq
 499998686     gbvrl24.seq
 499938525     gbvrl240.seq
 499975574     gbvrl241.seq
 499954993     gbvrl242.seq
 258453456     gbvrl243.seq
 499974093     gbvrl244.seq
 499941227     gbvrl245.seq
 499966406     gbvrl246.seq
 499990128     gbvrl247.seq
 260456944     gbvrl248.seq
 499959248     gbvrl249.seq
 369074361     gbvrl25.seq
 499969797     gbvrl250.seq
 499969042     gbvrl251.seq
 499992242     gbvrl252.seq
 260057892     gbvrl253.seq
 499992143     gbvrl254.seq
 499980599     gbvrl255.seq
 499966056     gbvrl256.seq
 499996575     gbvrl257.seq
 499958126     gbvrl258.seq
 499944647     gbvrl259.seq
 499996993     gbvrl26.seq
 267319780     gbvrl260.seq
 499975040     gbvrl261.seq
 499990247     gbvrl262.seq
 499990062     gbvrl263.seq
 499946019     gbvrl264.seq
 499973035     gbvrl265.seq
 499959289     gbvrl266.seq
 239420320     gbvrl267.seq
 499983387     gbvrl268.seq
 499971793     gbvrl269.seq
 499998820     gbvrl27.seq
 499991180     gbvrl270.seq
 499968059     gbvrl271.seq
 246823906     gbvrl272.seq
 499982222     gbvrl273.seq
 499990400     gbvrl274.seq
 499993067     gbvrl275.seq
 499952589     gbvrl276.seq
 255550607     gbvrl277.seq
 499980921     gbvrl278.seq
 499990796     gbvrl279.seq
 314152920     gbvrl28.seq
 499951325     gbvrl280.seq
 499974521     gbvrl281.seq
 416501454     gbvrl282.seq
 499977944     gbvrl283.seq
 499993399     gbvrl284.seq
 499962321     gbvrl285.seq
 164656950     gbvrl286.seq
 499934323     gbvrl287.seq
 499988575     gbvrl288.seq
 499932781     gbvrl289.seq
 499999905     gbvrl29.seq
 225217116     gbvrl290.seq
 499972794     gbvrl291.seq
 499948833     gbvrl292.seq
 499981172     gbvrl293.seq
 306559769     gbvrl294.seq
 499983220     gbvrl295.seq
 499962520     gbvrl296.seq
 499976944     gbvrl297.seq
 263560534     gbvrl298.seq
 499949491     gbvrl299.seq
 499958295     gbvrl3.seq
 499987808     gbvrl30.seq
 499953635     gbvrl300.seq
 499945445     gbvrl301.seq
 369852710     gbvrl302.seq
 499991676     gbvrl303.seq
 499972422     gbvrl304.seq
 499959743     gbvrl305.seq
 379658701     gbvrl306.seq
 499949067     gbvrl307.seq
 499992827     gbvrl308.seq
 499993503     gbvrl309.seq
 499991854     gbvrl31.seq
 499984506     gbvrl310.seq
  20643023     gbvrl311.seq
 499959039     gbvrl312.seq
 499944541     gbvrl313.seq
 499964832     gbvrl314.seq
 262275713     gbvrl315.seq
 499982207     gbvrl316.seq
 499972631     gbvrl317.seq
 499995618     gbvrl318.seq
 243189649     gbvrl319.seq
 287974089     gbvrl32.seq
 499952620     gbvrl320.seq
 499983286     gbvrl321.seq
 499992585     gbvrl322.seq
 159829461     gbvrl323.seq
 499971620     gbvrl324.seq
 499996290     gbvrl325.seq
 499949241     gbvrl326.seq
 499944987     gbvrl327.seq
  61263611     gbvrl328.seq
 499949729     gbvrl329.seq
 499997786     gbvrl33.seq
 499973638     gbvrl330.seq
 499997127     gbvrl331.seq
 460920988     gbvrl332.seq
 499967918     gbvrl333.seq
 499980016     gbvrl334.seq
 499944940     gbvrl335.seq
 495096452     gbvrl336.seq
 499951782     gbvrl337.seq
 499951054     gbvrl338.seq
 499967115     gbvrl339.seq
 499933363     gbvrl34.seq
 499976157     gbvrl340.seq
 125846972     gbvrl341.seq
 499966341     gbvrl342.seq
 499945691     gbvrl343.seq
 499988424     gbvrl344.seq
 185092889     gbvrl345.seq
 499958340     gbvrl346.seq
 499968403     gbvrl347.seq
 499962183     gbvrl348.seq
 445576286     gbvrl349.seq
 430157038     gbvrl35.seq
 499950113     gbvrl350.seq
 499999939     gbvrl351.seq
 499999815     gbvrl352.seq
 219954104     gbvrl353.seq
 499937354     gbvrl354.seq
 499980347     gbvrl355.seq
 499939989     gbvrl356.seq
 356935815     gbvrl357.seq
 499941522     gbvrl358.seq
 499937214     gbvrl359.seq
 499999796     gbvrl36.seq
 499946933     gbvrl360.seq
 499989802     gbvrl361.seq
 149446523     gbvrl362.seq
 499934435     gbvrl363.seq
 499961862     gbvrl364.seq
 499984771     gbvrl365.seq
 485906893     gbvrl366.seq
 499969337     gbvrl367.seq
 499951034     gbvrl368.seq
 499984304     gbvrl369.seq
 499986893     gbvrl37.seq
 487507516     gbvrl370.seq
 499945106     gbvrl371.seq
 499974090     gbvrl372.seq
 499962439     gbvrl373.seq
 273975544     gbvrl374.seq
 499991014     gbvrl375.seq
 499994222     gbvrl376.seq
 499940452     gbvrl377.seq
 252522553     gbvrl378.seq
 499967105     gbvrl379.seq
 422204490     gbvrl38.seq
 499977960     gbvrl380.seq
 499942838     gbvrl381.seq
 228580313     gbvrl382.seq
 499963329     gbvrl383.seq
 499951540     gbvrl384.seq
 499941974     gbvrl385.seq
 270913309     gbvrl386.seq
 499965557     gbvrl387.seq
 499958694     gbvrl388.seq
 499978101     gbvrl389.seq
 499999336     gbvrl39.seq
 189993164     gbvrl390.seq
 499999168     gbvrl391.seq
 499977196     gbvrl392.seq
 499964823     gbvrl393.seq
 155201169     gbvrl394.seq
 499969826     gbvrl395.seq
 499937426     gbvrl396.seq
 499949431     gbvrl397.seq
 224613505     gbvrl398.seq
 499984711     gbvrl399.seq
 140551193     gbvrl4.seq
 499952436     gbvrl40.seq
 499977539     gbvrl400.seq
 499948782     gbvrl401.seq
 176493324     gbvrl402.seq
 499961340     gbvrl403.seq
 499947946     gbvrl404.seq
 499958136     gbvrl405.seq
 352575905     gbvrl406.seq
 499997913     gbvrl407.seq
 499998085     gbvrl408.seq
 499936884     gbvrl409.seq
 499981624     gbvrl41.seq
 183233923     gbvrl410.seq
 499982826     gbvrl411.seq
 499984149     gbvrl412.seq
 499988051     gbvrl413.seq
 234800838     gbvrl414.seq
 499997569     gbvrl415.seq
 499951235     gbvrl416.seq
 499985091     gbvrl417.seq
 202319618     gbvrl418.seq
 499977049     gbvrl419.seq
 317867528     gbvrl42.seq
 499963240     gbvrl420.seq
 499986320     gbvrl421.seq
 387840077     gbvrl422.seq
 499985722     gbvrl423.seq
 499984211     gbvrl424.seq
 499963114     gbvrl425.seq
 290381294     gbvrl426.seq
 499987421     gbvrl427.seq
 499996503     gbvrl428.seq
 499953972     gbvrl429.seq
 499975016     gbvrl43.seq
 373822722     gbvrl430.seq
 499951413     gbvrl431.seq
 499937993     gbvrl432.seq
 499985554     gbvrl433.seq
 499933160     gbvrl434.seq
  77577797     gbvrl435.seq
 499988402     gbvrl436.seq
 499997928     gbvrl437.seq
 499973377     gbvrl438.seq
 196639130     gbvrl439.seq
 499982677     gbvrl44.seq
 499971723     gbvrl440.seq
 499942430     gbvrl441.seq
 499953175     gbvrl442.seq
 499945867     gbvrl443.seq
  81830260     gbvrl444.seq
 499988498     gbvrl445.seq
 499941024     gbvrl446.seq
 499972116     gbvrl447.seq
 460860024     gbvrl448.seq
 499972243     gbvrl449.seq
 499994750     gbvrl45.seq
 499974023     gbvrl450.seq
 499946668     gbvrl451.seq
 499949628     gbvrl452.seq
 370581589     gbvrl453.seq
 490034647     gbvrl454.seq
 499992743     gbvrl455.seq
 252280844     gbvrl456.seq
  76663525     gbvrl457.seq
 499994999     gbvrl458.seq
 499995584     gbvrl459.seq
 289466505     gbvrl46.seq
 499996567     gbvrl460.seq
 248641304     gbvrl461.seq
 499989573     gbvrl462.seq
 500000038     gbvrl463.seq
 499968650     gbvrl464.seq
 276758229     gbvrl465.seq
 499978647     gbvrl466.seq
 499976370     gbvrl467.seq
 499964458     gbvrl468.seq
 167625331     gbvrl469.seq
 499938508     gbvrl47.seq
 499970093     gbvrl470.seq
 499998175     gbvrl471.seq
 499964697     gbvrl472.seq
 142301334     gbvrl473.seq
 499990556     gbvrl474.seq
 499997285     gbvrl475.seq
 499978295     gbvrl476.seq
 256225795     gbvrl477.seq
 499986708     gbvrl478.seq
 499985173     gbvrl479.seq
 499990250     gbvrl48.seq
 499977224     gbvrl480.seq
 138895446     gbvrl481.seq
 499971782     gbvrl482.seq
 499992483     gbvrl483.seq
 499997479     gbvrl484.seq
 113029750     gbvrl485.seq
 146006095     gbvrl486.seq
 499985590     gbvrl487.seq
 499993796     gbvrl488.seq
 499994199     gbvrl489.seq
 499937927     gbvrl49.seq
 123126465     gbvrl490.seq
 499980380     gbvrl491.seq
 499988258     gbvrl492.seq
 499993469     gbvrl493.seq
 467905182     gbvrl494.seq
 499990734     gbvrl495.seq
 499992968     gbvrl496.seq
 499986113     gbvrl497.seq
 145264338     gbvrl498.seq
 499978200     gbvrl499.seq
 499999330     gbvrl5.seq
 350758532     gbvrl50.seq
 499993493     gbvrl500.seq
 499968772     gbvrl501.seq
 359291402     gbvrl502.seq
 499994806     gbvrl503.seq
 499976458     gbvrl504.seq
 499994839     gbvrl505.seq
 499997400     gbvrl506.seq
 276920328     gbvrl507.seq
 499962348     gbvrl508.seq
 499996245     gbvrl509.seq
 499997786     gbvrl51.seq
 499985335     gbvrl510.seq
 499999032     gbvrl511.seq
  52275837     gbvrl512.seq
 499966368     gbvrl513.seq
 499977083     gbvrl514.seq
 499987313     gbvrl515.seq
 400921695     gbvrl516.seq
 499965920     gbvrl517.seq
 499974118     gbvrl518.seq
 499974403     gbvrl519.seq
 499954273     gbvrl52.seq
 354399856     gbvrl520.seq
 499965668     gbvrl521.seq
 499981585     gbvrl522.seq
 499974560     gbvrl523.seq
 244319415     gbvrl524.seq
 499969047     gbvrl525.seq
 499998527     gbvrl526.seq
 499963466     gbvrl527.seq
 311694760     gbvrl528.seq
 499996186     gbvrl529.seq
 499951050     gbvrl53.seq
 499999637     gbvrl530.seq
 499971886     gbvrl531.seq
 284078641     gbvrl532.seq
 499984225     gbvrl533.seq
 499994328     gbvrl534.seq
 499989778     gbvrl535.seq
 281653037     gbvrl536.seq
 499967068     gbvrl537.seq
 499988696     gbvrl538.seq
 500000213     gbvrl539.seq
 278279748     gbvrl54.seq
 287645668     gbvrl540.seq
 499992125     gbvrl541.seq
 499986719     gbvrl542.seq
 499976175     gbvrl543.seq
 285778503     gbvrl544.seq
 499973965     gbvrl545.seq
 499963703     gbvrl546.seq
 499958708     gbvrl547.seq
 276980179     gbvrl548.seq
 499969873     gbvrl549.seq
 499970106     gbvrl55.seq
 499965020     gbvrl550.seq
 499993460     gbvrl551.seq
 499998475     gbvrl552.seq
  93707975     gbvrl553.seq
 499970858     gbvrl554.seq
 499982951     gbvrl555.seq
 499981682     gbvrl556.seq
 499973466     gbvrl557.seq
  74925382     gbvrl558.seq
 499984765     gbvrl559.seq
 499985236     gbvrl56.seq
 499988248     gbvrl560.seq
 499996733     gbvrl561.seq
 499979030     gbvrl562.seq
  95202028     gbvrl563.seq
 499976537     gbvrl564.seq
 499995836     gbvrl565.seq
 499962777     gbvrl566.seq
 115358284     gbvrl567.seq
 499978190     gbvrl568.seq
 499975152     gbvrl569.seq
 499963259     gbvrl57.seq
 499997076     gbvrl570.seq
 124158523     gbvrl571.seq
 499994764     gbvrl572.seq
 499962213     gbvrl573.seq
 499993317     gbvrl574.seq
 124383381     gbvrl575.seq
 499987030     gbvrl576.seq
 499995509     gbvrl577.seq
 499974440     gbvrl578.seq
 499985340     gbvrl579.seq
 499992200     gbvrl58.seq
 150761071     gbvrl580.seq
 499970071     gbvrl581.seq
 499993808     gbvrl582.seq
 499995759     gbvrl583.seq
 256400863     gbvrl584.seq
 499996408     gbvrl585.seq
 499983357     gbvrl586.seq
 499974024     gbvrl587.seq
 499971758     gbvrl588.seq
 311176065     gbvrl589.seq
 184620307     gbvrl59.seq
 499993059     gbvrl590.seq
 499977303     gbvrl591.seq
 499967523     gbvrl592.seq
 396261764     gbvrl593.seq
 499981077     gbvrl594.seq
 499994906     gbvrl595.seq
 499980237     gbvrl596.seq
 499973503     gbvrl597.seq
 499968352     gbvrl598.seq
 499997266     gbvrl599.seq
 499999396     gbvrl6.seq
 499968384     gbvrl60.seq
 121375985     gbvrl600.seq
 499985960     gbvrl601.seq
 499977284     gbvrl602.seq
 499964686     gbvrl603.seq
 499999171     gbvrl604.seq
 499972433     gbvrl605.seq
 471344149     gbvrl606.seq
 499998632     gbvrl607.seq
 499975315     gbvrl608.seq
 499985525     gbvrl609.seq
 499971620     gbvrl61.seq
 499987240     gbvrl610.seq
 386872031     gbvrl611.seq
 499973225     gbvrl612.seq
 499975933     gbvrl613.seq
 499992983     gbvrl614.seq
 499991282     gbvrl615.seq
  76963472     gbvrl616.seq
 499996306     gbvrl617.seq
 499969630     gbvrl618.seq
 499997681     gbvrl619.seq
 499953979     gbvrl62.seq
 499998229     gbvrl620.seq
 499971828     gbvrl621.seq
 320305108     gbvrl622.seq
 499973082     gbvrl623.seq
 499962147     gbvrl624.seq
 499977605     gbvrl625.seq
 499984076     gbvrl626.seq
 352825116     gbvrl627.seq
 499983912     gbvrl628.seq
 499965199     gbvrl629.seq
 499987343     gbvrl63.seq
 499993939     gbvrl630.seq
 499993868     gbvrl631.seq
  20376151     gbvrl632.seq
 499992617     gbvrl633.seq
 499966090     gbvrl634.seq
 499992442     gbvrl635.seq
 499999039     gbvrl636.seq
  18841910     gbvrl637.seq
 499966678     gbvrl638.seq
 499989292     gbvrl639.seq
 168861414     gbvrl64.seq
 499987517     gbvrl640.seq
 499985782     gbvrl641.seq
  43440266     gbvrl642.seq
 499970790     gbvrl643.seq
 499986514     gbvrl644.seq
 499998554     gbvrl645.seq
 499985921     gbvrl646.seq
   7517707     gbvrl647.seq
 499961633     gbvrl648.seq
 499984587     gbvrl649.seq
 499997121     gbvrl65.seq
 499995182     gbvrl650.seq
 239968307     gbvrl651.seq
 499981110     gbvrl652.seq
 499998886     gbvrl653.seq
 499990602     gbvrl654.seq
 499982388     gbvrl655.seq
  48338806     gbvrl656.seq
 499999759     gbvrl657.seq
 499988341     gbvrl658.seq
 499984232     gbvrl659.seq
 499991491     gbvrl66.seq
 499982748     gbvrl660.seq
  56169592     gbvrl661.seq
 499985701     gbvrl662.seq
 499971693     gbvrl663.seq
 499989145     gbvrl664.seq
 187868585     gbvrl665.seq
 499999964     gbvrl666.seq
 499999021     gbvrl667.seq
 499988675     gbvrl668.seq
 183858787     gbvrl669.seq
 499971474     gbvrl67.seq
 499965480     gbvrl670.seq
 499992217     gbvrl671.seq
 499989381     gbvrl672.seq
 190832299     gbvrl673.seq
 499972461     gbvrl674.seq
 499977843     gbvrl675.seq
 499986711     gbvrl676.seq
 220385288     gbvrl677.seq
 499992847     gbvrl678.seq
 499960570     gbvrl679.seq
 499954553     gbvrl68.seq
 499969016     gbvrl680.seq
 221098935     gbvrl681.seq
 499972196     gbvrl682.seq
 499986542     gbvrl683.seq
 499969289     gbvrl684.seq
 188709005     gbvrl685.seq
 499963289     gbvrl686.seq
 499981565     gbvrl687.seq
 499981233     gbvrl688.seq
 193922255     gbvrl689.seq
 149636381     gbvrl69.seq
 499977956     gbvrl690.seq
 499984308     gbvrl691.seq
 499962583     gbvrl692.seq
 499965726     gbvrl693.seq
 499992115     gbvrl694.seq
 205653911     gbvrl695.seq
 499982716     gbvrl696.seq
 499991160     gbvrl697.seq
 499975836     gbvrl698.seq
 370021944     gbvrl699.seq
 499996429     gbvrl7.seq
 499984236     gbvrl70.seq
 499997000     gbvrl700.seq
 499979732     gbvrl701.seq
 499995653     gbvrl702.seq
 114860218     gbvrl703.seq
 499961623     gbvrl704.seq
 499995838     gbvrl705.seq
 499990116     gbvrl706.seq
 304097299     gbvrl707.seq
 499981552     gbvrl708.seq
 499984495     gbvrl709.seq
 499983821     gbvrl71.seq
 499972552     gbvrl710.seq
 286774873     gbvrl711.seq
 499940029     gbvrl72.seq
 406548359     gbvrl73.seq
 499934667     gbvrl74.seq
 499979862     gbvrl75.seq
 499944775     gbvrl76.seq
 357587175     gbvrl77.seq
 499950178     gbvrl78.seq
 499991487     gbvrl79.seq
 499987606     gbvrl8.seq
 499988666     gbvrl80.seq
 319939390     gbvrl81.seq
 499995032     gbvrl82.seq
 499990777     gbvrl83.seq
 499960880     gbvrl84.seq
  42273715     gbvrl85.seq
 499943358     gbvrl86.seq
 499969399     gbvrl87.seq
 499937635     gbvrl88.seq
 185772582     gbvrl89.seq
 301524385     gbvrl9.seq
 499950802     gbvrl90.seq
 499943446     gbvrl91.seq
 499936106     gbvrl92.seq
 182289247     gbvrl93.seq
 499945022     gbvrl94.seq
 499987132     gbvrl95.seq
 499966466     gbvrl96.seq
 221899235     gbvrl97.seq
 499947854     gbvrl98.seq
 499948149     gbvrl99.seq
 499937893     gbvrt1.seq
 290137512     gbvrt10.seq
1063697373     gbvrt100.seq
1045817456     gbvrt101.seq
 754876698     gbvrt102.seq
 616753988     gbvrt103.seq
 490283916     gbvrt104.seq
 470651151     gbvrt105.seq
 397152890     gbvrt106.seq
 351566814     gbvrt107.seq
 339881554     gbvrt108.seq
 404716166     gbvrt109.seq
  87351602     gbvrt11.seq
 489465929     gbvrt110.seq
 499108511     gbvrt111.seq
 486719349     gbvrt112.seq
  58362562     gbvrt113.seq
 436489699     gbvrt114.seq
 486735687     gbvrt115.seq
 492786702     gbvrt116.seq
 424170309     gbvrt117.seq
 281367593     gbvrt118.seq
 478264522     gbvrt119.seq
 499806077     gbvrt12.seq
 485840122     gbvrt120.seq
 493662272     gbvrt121.seq
  75046811     gbvrt122.seq
 979125221     gbvrt123.seq
 838606764     gbvrt124.seq
 678362247     gbvrt125.seq
 476490051     gbvrt126.seq
 461393141     gbvrt127.seq
 438814149     gbvrt128.seq
 394334276     gbvrt129.seq
 284674796     gbvrt13.seq
 313818221     gbvrt130.seq
 288999697     gbvrt131.seq
 280186115     gbvrt132.seq
 407765043     gbvrt133.seq
 421856869     gbvrt134.seq
 478932645     gbvrt135.seq
 480028007     gbvrt136.seq
 438022009     gbvrt137.seq
 174441466     gbvrt138.seq
 487902327     gbvrt139.seq
  15637437     gbvrt14.seq
 456814552     gbvrt140.seq
 462308829     gbvrt141.seq
 168813991     gbvrt142.seq
 455915969     gbvrt143.seq
 469542169     gbvrt144.seq
 479148432     gbvrt145.seq
 211438035     gbvrt146.seq
 481255007     gbvrt147.seq
 475910680     gbvrt148.seq
 366785231     gbvrt149.seq
  36035214     gbvrt15.seq
 464881586     gbvrt150.seq
 474452025     gbvrt151.seq
 234874130     gbvrt152.seq
 697335450     gbvrt153.seq
 670835803     gbvrt154.seq
 524090553     gbvrt155.seq
 413420126     gbvrt156.seq
 345317144     gbvrt157.seq
 329841089     gbvrt158.seq
 250750417     gbvrt159.seq
  18509260     gbvrt16.seq
 486600390     gbvrt160.seq
 364885711     gbvrt161.seq
 448395879     gbvrt162.seq
 471877569     gbvrt163.seq
 393642536     gbvrt164.seq
 355134416     gbvrt165.seq
 470602746     gbvrt166.seq
 448657488     gbvrt167.seq
 384724558     gbvrt168.seq
 432320923     gbvrt169.seq
 497676963     gbvrt17.seq
 471132362     gbvrt170.seq
 497676594     gbvrt171.seq
 207882210     gbvrt172.seq
 397267013     gbvrt173.seq
 366771863     gbvrt174.seq
 351249970     gbvrt175.seq
 309532358     gbvrt176.seq
 296271444     gbvrt177.seq
 286321426     gbvrt178.seq
 268164730     gbvrt179.seq
 497173924     gbvrt18.seq
 253329800     gbvrt180.seq
 494939336     gbvrt181.seq
 424426418     gbvrt182.seq
 410896883     gbvrt183.seq
 369957025     gbvrt184.seq
 169574120     gbvrt185.seq
 426847158     gbvrt186.seq
 496824508     gbvrt187.seq
 434394791     gbvrt188.seq
 494363156     gbvrt189.seq
 481350583     gbvrt19.seq
  61896426     gbvrt190.seq
 431425246     gbvrt191.seq
 474666330     gbvrt192.seq
 479195821     gbvrt193.seq
 352877651     gbvrt194.seq
 479851070     gbvrt195.seq
 497038176     gbvrt196.seq
 432867963     gbvrt197.seq
 439843808     gbvrt198.seq
 469531790     gbvrt199.seq
 499982082     gbvrt2.seq
 400795564     gbvrt20.seq
 496015817     gbvrt200.seq
 488626307     gbvrt201.seq
 432135676     gbvrt202.seq
  70119528     gbvrt203.seq
 491056051     gbvrt204.seq
 328508705     gbvrt205.seq
 497328806     gbvrt206.seq
 499238966     gbvrt207.seq
 187508760     gbvrt208.seq
 490842556     gbvrt209.seq
 488197715     gbvrt21.seq
 463385772     gbvrt210.seq
 446788975     gbvrt211.seq
 438416202     gbvrt212.seq
 170595769     gbvrt213.seq
 451342688     gbvrt214.seq
 474563355     gbvrt215.seq
 461335548     gbvrt216.seq
 436658187     gbvrt217.seq
 154682616     gbvrt218.seq
 456837606     gbvrt219.seq
 479291185     gbvrt22.seq
 488930196     gbvrt220.seq
 466502331     gbvrt221.seq
 455725140     gbvrt222.seq
 453475816     gbvrt223.seq
 462276007     gbvrt224.seq
 497473221     gbvrt225.seq
 499283767     gbvrt226.seq
 481742871     gbvrt227.seq
  54779872     gbvrt228.seq
 477445338     gbvrt229.seq
 480798341     gbvrt23.seq
 495314530     gbvrt230.seq
 486008997     gbvrt231.seq
 489201368     gbvrt232.seq
 499536480     gbvrt233.seq
 347470388     gbvrt234.seq
1068402516     gbvrt235.seq
1067356333     gbvrt236.seq
 896844819     gbvrt237.seq
 805318347     gbvrt238.seq
 718662677     gbvrt239.seq
 499274554     gbvrt24.seq
 556944666     gbvrt240.seq
 299728838     gbvrt241.seq
 293507186     gbvrt242.seq
 484357811     gbvrt243.seq
 130768604     gbvrt244.seq
 874873715     gbvrt245.seq
 685858825     gbvrt246.seq
 627564227     gbvrt247.seq
 610271897     gbvrt248.seq
 543871783     gbvrt249.seq
 483255218     gbvrt25.seq
 284797667     gbvrt250.seq
 269299175     gbvrt251.seq
 474717664     gbvrt252.seq
 402979396     gbvrt253.seq
 343325815     gbvrt254.seq
 450550965     gbvrt255.seq
 494368803     gbvrt256.seq
 470727126     gbvrt257.seq
 470514883     gbvrt258.seq
 229648794     gbvrt259.seq
 484153949     gbvrt26.seq
 499998233     gbvrt260.seq
 499998421     gbvrt261.seq
 499975873     gbvrt262.seq
   3368115     gbvrt263.seq
 500000123     gbvrt264.seq
 393728465     gbvrt265.seq
 495882826     gbvrt266.seq
 489261085     gbvrt267.seq
 461041823     gbvrt268.seq
 137259368     gbvrt269.seq
  65325620     gbvrt27.seq
 477156039     gbvrt270.seq
 499226352     gbvrt271.seq
 477696169     gbvrt272.seq
 353039605     gbvrt273.seq
 438196164     gbvrt274.seq
 489809255     gbvrt275.seq
 460938782     gbvrt276.seq
 425935508     gbvrt277.seq
 463055690     gbvrt278.seq
 486381290     gbvrt279.seq
 437233554     gbvrt28.seq
 437842391     gbvrt280.seq
 440417012     gbvrt281.seq
 475637321     gbvrt282.seq
 477247535     gbvrt283.seq
 464765084     gbvrt284.seq
 442158629     gbvrt285.seq
 490038950     gbvrt286.seq
 437760826     gbvrt287.seq
 442760644     gbvrt288.seq
 386023782     gbvrt289.seq
 488520688     gbvrt29.seq
 474713745     gbvrt290.seq
 485232834     gbvrt291.seq
 481700105     gbvrt292.seq
 437634375     gbvrt293.seq
 484571077     gbvrt294.seq
 497401344     gbvrt295.seq
 473482376     gbvrt296.seq
 467112365     gbvrt297.seq
 391814406     gbvrt298.seq
 447682143     gbvrt299.seq
 467569857     gbvrt3.seq
 456456384     gbvrt30.seq
 458968414     gbvrt300.seq
 489671978     gbvrt301.seq
 499998533     gbvrt302.seq
  40839284     gbvrt303.seq
 341830916     gbvrt31.seq
  14152653     gbvrt32.seq
  21384662     gbvrt33.seq
  90973101     gbvrt34.seq
 499951059     gbvrt35.seq
 500000051     gbvrt36.seq
 499997728     gbvrt37.seq
  56082217     gbvrt38.seq
 499998154     gbvrt39.seq
 179100370     gbvrt4.seq
 270032818     gbvrt40.seq
 389257659     gbvrt41.seq
 498775863     gbvrt42.seq
 390277643     gbvrt43.seq
 499998995     gbvrt44.seq
 119189096     gbvrt45.seq
 499997952     gbvrt46.seq
 448655067     gbvrt47.seq
 499998485     gbvrt48.seq
  28960976     gbvrt49.seq
 448778544     gbvrt5.seq
 444442905     gbvrt50.seq
 500000120     gbvrt51.seq
 388472874     gbvrt52.seq
 499999458     gbvrt53.seq
 280264080     gbvrt54.seq
 499998303     gbvrt55.seq
 500000116     gbvrt56.seq
 493838837     gbvrt57.seq
 497618498     gbvrt58.seq
 490981487     gbvrt59.seq
 490703641     gbvrt6.seq
 450977918     gbvrt60.seq
 202128841     gbvrt61.seq
 123737443     gbvrt62.seq
 483315419     gbvrt63.seq
 481925744     gbvrt64.seq
 499146212     gbvrt65.seq
 499983703     gbvrt66.seq
 297372571     gbvrt67.seq
 492215762     gbvrt68.seq
 492375887     gbvrt69.seq
 499120716     gbvrt7.seq
 479677491     gbvrt70.seq
 480814553     gbvrt71.seq
 362168611     gbvrt72.seq
 490950275     gbvrt73.seq
 475405574     gbvrt74.seq
 489430322     gbvrt75.seq
 352377326     gbvrt76.seq
 465372186     gbvrt77.seq
 488788789     gbvrt78.seq
 189348250     gbvrt79.seq
 483706459     gbvrt8.seq
 451948482     gbvrt80.seq
 443703248     gbvrt81.seq
 400719178     gbvrt82.seq
 427517644     gbvrt83.seq
 319264824     gbvrt84.seq
 275756309     gbvrt85.seq
 252640763     gbvrt86.seq
 251496345     gbvrt87.seq
 466369516     gbvrt88.seq
 418722220     gbvrt89.seq
 263827641     gbvrt9.seq
 186091498     gbvrt90.seq
 404212770     gbvrt91.seq
 481131817     gbvrt92.seq
 474827267     gbvrt93.seq
 480710662     gbvrt94.seq
  89576280     gbvrt95.seq
 435880706     gbvrt96.seq
 487966705     gbvrt97.seq
 497561523     gbvrt98.seq
 468911614     gbvrt99.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         101910     185833069
BCT10        102        249277539
BCT100       62         225168570
BCT101       64         140507059
BCT102       97         233623581
BCT103       82         229505918
BCT104       100        238937572
BCT105       24         34605217
BCT106       94         226656782
BCT107       118        229172914
BCT108       127        232212861
BCT109       90         178403076
BCT11        146        243121765
BCT110       114        212138354
BCT111       75         222053892
BCT112       112        225347102
BCT113       124        217786851
BCT114       3          5977905
BCT115       246        222256023
BCT116       104        221252195
BCT117       100        224644129
BCT118       83         222703364
BCT119       21         86233168
BCT12        168        262124003
BCT120       68         221578114
BCT121       87         219795809
BCT122       87         223588406
BCT123       80         226303150
BCT124       20         45564131
BCT125       124        217933644
BCT126       53         217706139
BCT127       90         227492926
BCT128       57         149506400
BCT129       94         223837173
BCT13        4          9982539
BCT130       73         221711999
BCT131       113        222996943
BCT132       78         197436829
BCT133       156        218173209
BCT134       84         220629983
BCT135       79         216070642
BCT136       141        228566924
BCT137       106        221256144
BCT138       80         221199213
BCT139       92         196245950
BCT14        170        237845538
BCT140       115        225967887
BCT141       92         220409897
BCT142       158        214217907
BCT143       88         207032597
BCT144       140        220978157
BCT145       63         217844098
BCT146       90         215013764
BCT147       125        217101319
BCT148       88         223616604
BCT149       21         65066945
BCT15        151        240481452
BCT150       174        220602866
BCT151       128        221993348
BCT152       118        216449560
BCT153       170        220678969
BCT154       54         177570665
BCT155       104        218683705
BCT156       113        217389079
BCT157       151        218678288
BCT158       105        221932350
BCT159       107        225710916
BCT16        199        251875813
BCT160       120        169133018
BCT161       95         229134325
BCT162       104        222093509
BCT163       97         225362965
BCT164       116        220401677
BCT165       94         219188969
BCT166       134        220654115
BCT167       36         70525291
BCT168       169        220902025
BCT169       100        223727909
BCT17        206        224187394
BCT170       96         223995439
BCT171       95         219439398
BCT172       71         223304376
BCT173       123        228309968
BCT174       150        228808455
BCT175       80         212893326
BCT176       100        233591727
BCT177       96         224405035
BCT178       134        223606319
BCT179       84         221873830
BCT18        6          19096587
BCT180       25         88330083
BCT181       119        222185746
BCT182       151        231715107
BCT183       72         216080650
BCT184       81         120955479
BCT185       111        216184725
BCT186       156        227708035
BCT187       111        220250972
BCT188       89         136614524
BCT189       133        229717687
BCT19        137        236069130
BCT190       111        208992481
BCT191       108        219925553
BCT192       77         222877345
BCT193       19         34014599
BCT194       98         220152536
BCT195       133        227333368
BCT196       125        230906352
BCT197       118        245874590
BCT198       114        233627230
BCT199       32         86501281
BCT2         107        227274960
BCT20        117        231992486
BCT200       131        216438017
BCT201       93         226438829
BCT202       108        224087651
BCT203       116        221458112
BCT204       65         122261042
BCT205       127        225144984
BCT206       137        258852104
BCT207       100        226683783
BCT208       158        215934234
BCT209       69         111557509
BCT21        136        223706407
BCT210       123        222422665
BCT211       115        218469346
BCT212       89         219209021
BCT213       103        229936404
BCT214       104        209481600
BCT215       97         234475408
BCT216       102        220656832
BCT217       100        218053674
BCT218       94         224743372
BCT219       104        226992367
BCT22        200        220790159
BCT220       104        228420529
BCT221       75         159759480
BCT222       104        221826114
BCT223       108        221051727
BCT224       98         226007841
BCT225       76         270744187
BCT226       75         254647899
BCT227       101        225874656
BCT228       178        218571314
BCT229       132        228118798
BCT23        32         45001243
BCT230       59         111805614
BCT231       324        275336670
BCT232       116        218712797
BCT233       116        218756155
BCT234       49         79557253
BCT235       89         220099828
BCT236       87         228427298
BCT237       78         232624772
BCT238       108        225429540
BCT239       26         68688386
BCT24        174        220036188
BCT240       60         216868170
BCT241       120        221119124
BCT242       86         223426276
BCT243       85         217663772
BCT244       31         72411893
BCT245       157        275025230
BCT246       82         232627723
BCT247       84         220566907
BCT248       144        212385076
BCT249       20         28670539
BCT25        157        217996559
BCT250       109        262921422
BCT251       72         217635148
BCT252       100        214909619
BCT253       79         210171996
BCT254       143        306547296
BCT255       72         239204396
BCT256       88         216728836
BCT257       131        224161084
BCT258       140        264048514
BCT259       50         101444202
BCT26        52         221902715
BCT260       146        273570514
BCT261       109        252612009
BCT262       35         229012536
BCT263       56         209847636
BCT264       110        218761905
BCT265       130        219578217
BCT266       90         250893937
BCT267       85         208900141
BCT268       124        215159011
BCT269       98         220607386
BCT27        115        226443985
BCT270       65         210721442
BCT271       137        229645801
BCT272       114        224459507
BCT273       112        224813211
BCT274       120        228230620
BCT275       28         84141934
BCT276       106        218843831
BCT277       82         215186387
BCT278       94         233476721
BCT279       97         183022758
BCT28        197        239757955
BCT280       93         235647841
BCT281       104        235928514
BCT282       69         223063860
BCT283       99         208185886
BCT284       119        216777827
BCT285       166        226651969
BCT286       161        212763762
BCT287       133        231781514
BCT288       101        229640338
BCT289       123        230260380
BCT29        1          9254808
BCT290       153        246159646
BCT291       109        240994010
BCT292       1          4908920
BCT293       122        221777912
BCT294       112        212578426
BCT295       91         227407856
BCT296       110        219522945
BCT297       163        226171329
BCT298       150        213744827
BCT299       113        172260629
BCT3         37541      123332243
BCT30        83         236556551
BCT300       130        228756073
BCT301       104        220860438
BCT302       84         215327663
BCT303       67         212286790
BCT304       120        189367846
BCT305       88         244048892
BCT306       107        228886299
BCT307       83         221776690
BCT308       57         215803598
BCT309       80         175042090
BCT31        96         221838262
BCT310       115        219540003
BCT311       101        218974130
BCT312       124        216924787
BCT313       90         217527347
BCT314       140        185056878
BCT315       124        248813935
BCT316       110        222498371
BCT317       82         228432498
BCT318       61         221300332
BCT319       88         179376157
BCT32        96         219816445
BCT320       128        238885544
BCT321       197        234044756
BCT322       142        219590522
BCT323       137        217866459
BCT324       110        213514098
BCT325       30         39687036
BCT326       141        246427155
BCT327       167        279237902
BCT328       170        216918027
BCT329       131        214725307
BCT33        117        236937870
BCT330       16         117485943
BCT331       72         228738867
BCT332       128        242193459
BCT333       1240       225059545
BCT334       117        224614018
BCT335       73         186373828
BCT336       101        222185425
BCT337       125        212414477
BCT338       97         209352135
BCT339       136        219595918
BCT34        49         66740266
BCT340       208        233566614
BCT341       212        223033892
BCT342       123        222870544
BCT343       55         119107156
BCT344       137        223613724
BCT345       144        220140457
BCT346       146        218600953
BCT347       128        228023657
BCT348       150        237141523
BCT349       92         239548214
BCT35        82         218519132
BCT350       51         102693253
BCT351       111        224832352
BCT352       162        232659243
BCT353       124        226584190
BCT354       128        225705292
BCT355       79         190763925
BCT356       130        230534195
BCT357       126        226096115
BCT358       67         214519538
BCT359       90         224232763
BCT36        116        237484491
BCT360       58         216978287
BCT361       50         220959735
BCT362       133        225778925
BCT363       46         14896968
BCT364       195        229604129
BCT365       127        252087880
BCT366       118        224055068
BCT367       214        224990613
BCT368       69         100304035
BCT369       90         239192530
BCT37        74         220213724
BCT370       114        247991308
BCT371       46         214210162
BCT372       53         216377196
BCT373       19         73275105
BCT374       128        213375994
BCT375       113        228373833
BCT376       92         226874676
BCT377       173        247247381
BCT378       163        228156358
BCT379       98         222805919
BCT38        162        230896961
BCT380       115        229449109
BCT381       184        265248059
BCT382       179        234651071
BCT383       467        230319600
BCT384       128        233603494
BCT385       165        242239693
BCT386       101        235430551
BCT387       97         184754571
BCT388       109        231106509
BCT389       85         216600207
BCT39        43         45638917
BCT390       94         218713981
BCT391       104        231233239
BCT392       164        223448175
BCT393       52         101329617
BCT394       88         219801256
BCT395       93         227925056
BCT396       164        299659575
BCT397       120        258141650
BCT398       95         287356860
BCT399       85         191291891
BCT4         41292      139253673
BCT40        155        239125067
BCT400       114        227850421
BCT401       146        217630758
BCT402       97         218658836
BCT403       148        227279321
BCT404       123        218756918
BCT405       117        232232626
BCT406       136        207769718
BCT407       112        226781216
BCT408       150        225579081
BCT409       115        233034050
BCT41        76         241562309
BCT410       177        218584818
BCT411       40         86041988
BCT412       129        231508633
BCT413       141        220573282
BCT414       141        220438911
BCT415       101        218482295
BCT416       89         204749777
BCT417       107        232528182
BCT418       119        237505662
BCT419       102        312787629
BCT42        129        224459732
BCT420       96         215503192
BCT421       86         124951076
BCT422       119        224699181
BCT423       121        218255731
BCT424       90         214222203
BCT425       101        265954624
BCT426       34         86340742
BCT427       121        215033983
BCT428       119        228238575
BCT429       115        218990236
BCT43        141        221486905
BCT430       110        215552489
BCT431       20         36810645
BCT432       144        219919128
BCT433       104        251665529
BCT434       156        212575427
BCT435       159        212139624
BCT436       12         11443917
BCT437       238        214458452
BCT438       127        213318904
BCT439       102        217958513
BCT44        409        28005557
BCT440       110        242026946
BCT441       134        261820691
BCT442       62         149015338
BCT443       103        236047200
BCT444       117        234581408
BCT445       134        216175271
BCT446       102        228030499
BCT447       89         215885427
BCT448       57         218952374
BCT449       72         126593743
BCT45        5200       7533877
BCT450       167        217620314
BCT451       108        222790705
BCT452       119        228259309
BCT453       124        211537589
BCT454       6          22893915
BCT455       78         220992704
BCT456       139        212603090
BCT457       157        216271864
BCT458       317        213898340
BCT459       364        210657095
BCT46        10402      13141863
BCT460       117        212804246
BCT461       134        211491923
BCT462       150        212215499
BCT463       174        222080619
BCT464       168        211415286
BCT465       49         74787780
BCT466       161        208257957
BCT467       162        212193463
BCT468       114        210605338
BCT469       157        213126972
BCT47        53922      202025650
BCT470       132        209356669
BCT471       131        195243107
BCT472       183        210687290
BCT473       116        210811583
BCT474       136        211510245
BCT475       167        220748430
BCT476       52         97685124
BCT477       162        242896622
BCT478       136        229918475
BCT479       198        225307683
BCT48        186        213888772
BCT480       113        217680503
BCT481       133        235643999
BCT482       104        217748429
BCT483       129        229750358
BCT484       193        216112686
BCT485       107        232838404
BCT486       101        227203532
BCT487       96         227788551
BCT488       66         224087470
BCT489       123        266645848
BCT49        102        231272752
BCT490       101        252863553
BCT491       46         67611684
BCT492       187        217128552
BCT493       119        232657387
BCT494       134        220545928
BCT495       132        217984048
BCT496       188        219936994
BCT497       112        227598589
BCT498       138        213596182
BCT499       104        257584275
BCT5         20642      162919204
BCT50        119        210208155
BCT500       131        213504732
BCT501       97         217669944
BCT502       159        215593112
BCT503       9          23842321
BCT504       140        218732960
BCT505       111        223798413
BCT506       82         212535141
BCT507       195        222222774
BCT508       52         48327012
BCT509       145        239450950
BCT51        103        222777517
BCT510       139        343630078
BCT511       104        243338112
BCT512       190        274251828
BCT513       118        214522556
BCT514       71         232126296
BCT515       99         221849706
BCT516       15         41864165
BCT517       101        223784323
BCT518       76         214366141
BCT519       103        234847991
BCT52        131        222293417
BCT520       125        218833876
BCT521       112        213235364
BCT522       102        125479564
BCT523       127        216734105
BCT524       140        214709902
BCT525       124        233094898
BCT526       128        222935950
BCT527       291        217901069
BCT528       32         43453534
BCT529       137        226896937
BCT53        121        218256338
BCT530       114        217333383
BCT531       155        215515734
BCT532       182        209706134
BCT533       135        165131614
BCT534       156        208447709
BCT535       130        240718341
BCT536       124        219596071
BCT537       157        217736390
BCT538       86         144421816
BCT539       152        223412671
BCT54        146        224934131
BCT540       46         210247612
BCT541       227        248372082
BCT542       119        233622462
BCT543       95         224978693
BCT544       118        174393509
BCT545       157        217899942
BCT546       128        274180671
BCT547       198        209416107
BCT548       141        243795838
BCT549       94         256110558
BCT55        145        227211700
BCT550       9          26513249
BCT551       126        229963741
BCT552       143        224119815
BCT553       136        229104904
BCT554       100        219380593
BCT555       93         216847419
BCT556       8          20644528
BCT557       118        217936102
BCT558       134        226337379
BCT559       112        220983835
BCT56        125        133390248
BCT560       86         222222154
BCT561       116        227364231
BCT562       40         105329358
BCT563       126        228011316
BCT564       153        220572749
BCT565       162        217718410
BCT566       136        219520010
BCT567       124        233391210
BCT568       69         99428415
BCT569       199        240937555
BCT57        255        227294457
BCT570       149        228519909
BCT571       154        209768078
BCT572       88         219166399
BCT573       149        221041214
BCT574       40         44796390
BCT575       116        217623369
BCT576       61         208737714
BCT577       60         209982617
BCT578       87         228395061
BCT579       72         211351206
BCT58        86         220119558
BCT580       13         42898379
BCT581       74         211800342
BCT582       94         212424978
BCT583       135        218344517
BCT584       144        270563076
BCT585       203        241848508
BCT586       121        211787169
BCT587       92         212686871
BCT588       120        222061173
BCT589       117        221596960
BCT59        113        224688543
BCT590       96         213960896
BCT591       102        215264630
BCT592       105        213980954
BCT593       70         77908534
BCT594       119        239316957
BCT595       106        223438030
BCT596       125        214730653
BCT597       129        226364873
BCT598       110        295079348
BCT599       109        389125604
BCT6         2600       37759883
BCT60        128        222273877
BCT600       60         152188291
BCT601       91         317300604
BCT602       172        223400352
BCT603       144        221485882
BCT604       130        284924277
BCT605       145        166420926
BCT606       103        219830578
BCT607       93         223886488
BCT608       87         218961958
BCT609       166        281275337
BCT61        135        219981644
BCT610       110        236498984
BCT611       323        218712182
BCT612       64         168095571
BCT613       146        258774155
BCT614       122        224996822
BCT615       134        215509668
BCT616       138        214999244
BCT617       80         120856069
BCT618       112        211778878
BCT619       106        213135673
BCT62        111        162805198
BCT620       219        212375773
BCT621       154        227156695
BCT622       173        219044865
BCT623       120        212155742
BCT624       166        227854943
BCT625       109        210346287
BCT626       185        242674729
BCT627       119        227041392
BCT628       98         222539752
BCT629       153        212743716
BCT63        136        223054995
BCT630       1          5258072
BCT631       132        235716335
BCT632       223        237305721
BCT633       48         211639980
BCT634       64         210261202
BCT635       14         21880090
BCT636       85         213343638
BCT637       119        216986327
BCT638       85         222402355
BCT639       94         244320860
BCT64        112        217399067
BCT640       5          19465688
BCT641       175        216896079
BCT642       190        221847379
BCT643       261        210588195
BCT644       139        224607991
BCT645       82         155540624
BCT646       73         213958470
BCT647       102        216091410
BCT648       113        225831335
BCT649       146        206757576
BCT65        131        223635367
BCT650       124        204967785
BCT651       142        206612759
BCT652       110        211938027
BCT653       117        217949911
BCT654       109        219185495
BCT655       50         122381118
BCT656       129        226986290
BCT657       99         242309176
BCT658       151        222501100
BCT659       124        223727948
BCT66        121        221481204
BCT660       120        202941876
BCT661       113        222184301
BCT662       113        225519933
BCT663       151        235634140
BCT664       91         210760922
BCT665       131        223756097
BCT666       78         217294343
BCT667       149        220029600
BCT668       90         115107194
BCT669       81         218044573
BCT67        138        232661918
BCT670       146        214303429
BCT671       155        225063774
BCT672       123        228590011
BCT673       145        229759022
BCT674       1          3309710
BCT675       82         208204879
BCT676       90         218231049
BCT677       124        251827738
BCT678       106        218216624
BCT679       83         172664458
BCT68        108        225781339
BCT680       134        214049803
BCT681       139        210970984
BCT682       134        219656335
BCT683       147        221888950
BCT684       63         105830351
BCT685       146        235474055
BCT686       206        228318163
BCT687       169        227149568
BCT688       130        217595076
BCT689       5          15834721
BCT69        38         50860113
BCT690       104        206366561
BCT691       130        215544823
BCT692       114        223119710
BCT693       105        205506213
BCT694       12         7801742
BCT695       142        240001326
BCT696       112        208624743
BCT697       129        207951848
BCT698       108        206198997
BCT699       91         103492490
BCT7         1310       133308362
BCT70        94         229475332
BCT700       528        115589384
BCT701       1589       2511957
BCT702       3172       5268484
BCT703       6338       7796395
BCT704       12613      14997690
BCT705       25523      27672494
BCT706       50566      54072396
BCT707       148788     156612934
BCT708       14295      193620231
BCT709       3297       203942569
BCT71        117        227983621
BCT710       2509       213411401
BCT711       7215       212675624
BCT712       164        249069009
BCT713       39928      39703867
BCT714       75102      180239641
BCT715       11057      202910557
BCT716       6079       198788687
BCT717       97306      180440016
BCT718       64013      70613586
BCT719       148982     156841439
BCT72        160        232898310
BCT720       84745      88171394
BCT721       144493     150958399
BCT722       25985      25685871
BCT723       132447     167402312
BCT724       31618      43819173
BCT725       116246     178574102
BCT726       7836       17259946
BCT727       32959      53339119
BCT728       33463      238400910
BCT729       4311       302235718
BCT73        154        221704284
BCT730       2282       19875519
BCT731       5035       225442726
BCT732       3847       224092509
BCT733       1442       273316652
BCT734       109        222593498
BCT735       55         216844860
BCT736       70         213822191
BCT737       34         137765382
BCT738       69         224394912
BCT739       364        238323955
BCT74        128        238275556
BCT740       889        289911825
BCT741       316        85816731
BCT742       1274       198668008
BCT743       333        211837174
BCT744       514        379401000
BCT745       883        314043216
BCT746       263        74702522
BCT747       3148       246273076
BCT748       719        287380877
BCT749       347        391585216
BCT75        114        230664549
BCT750       302        299282949
BCT751       362        393266490
BCT752       364        392445913
BCT753       2141       260289909
BCT754       63         145106063
BCT755       86         222746849
BCT756       78         227354684
BCT757       3023       245927078
BCT758       1230       124242115
BCT759       1412       261424764
BCT76        54         123393656
BCT760       47         241352896
BCT761       45         243003094
BCT762       2180       269716913
BCT763       945        54278114
BCT764       2288       268994823
BCT765       83         274582043
BCT766       422        283036369
BCT767       3015       248690235
BCT768       11940      19905115
BCT769       25214      42009550
BCT77        300        239582260
BCT770       118334     188581407
BCT771       115287     191487567
BCT772       89680      164457297
BCT773       97768      200788076
BCT774       113567     195779472
BCT775       70086      295469778
BCT776       661        243768297
BCT777       283        247888035
BCT778       169        203376789
BCT779       208        202958057
BCT78        142        231562727
BCT780       191        205686012
BCT781       192        201576397
BCT782       163        201478520
BCT783       9          10798711
BCT784       179        205883676
BCT785       202        206537177
BCT786       226        205678653
BCT787       173        206520918
BCT788       197        205901203
BCT789       24186      176765647
BCT79        354        225466658
BCT8         191        234251938
BCT80        110        222922994
BCT81        120        208517065
BCT82        120        227473574
BCT83        98         224926366
BCT84        90         224039666
BCT85        98         225070223
BCT86        58         138528232
BCT87        53         211054879
BCT88        45         210584326
BCT89        45         210864282
BCT9         133        236750743
BCT90        45         212727898
BCT91        76         222861078
BCT92        40         115080869
BCT93        112        227959956
BCT94        129        231316827
BCT95        99         245428056
BCT96        87         223381451
BCT97        59         181990919
BCT98        93         237302287
BCT99        103        223843089
ENV1         189926     141860212
ENV10        57967      203047865
ENV11        181161     141739163
ENV12        218978     102576801
ENV13        176373     159888494
ENV14        19566      17068765
ENV15        204689     124199503
ENV16        186231     146018488
ENV17        209645     130958491
ENV18        180177     144835146
ENV19        858        1149492
ENV2         148930     161118230
ENV20        155453     156525429
ENV21        244836     67514607
ENV22        92621      21368672
ENV23        220959     118335235
ENV24        255268     109063044
ENV25        205255     126404405
ENV26        27324      25829511
ENV27        152285     158742579
ENV28        201169     103404756
ENV29        68240      51323420
ENV3         66085      142857265
ENV30        213263     108913091
ENV31        170986     153761110
ENV32        135007     163685077
ENV33        11558      15746646
ENV34        179947     128303912
ENV35        218039     118475767
ENV36        78503      41734034
ENV37        143980     98002213
ENV38        100617     112272508
ENV39        130603     80420660
ENV4         126        289839815
ENV40        173942     138869886
ENV41        163638     139585976
ENV42        179853     114600773
ENV43        200964     107345399
ENV44        196350     109549827
ENV45        111592     97824736
ENV46        158040     134817437
ENV47        145080     136774307
ENV48        169141     47806283
ENV49        172157     133102337
ENV5         86         221966004
ENV50        210923     100423114
ENV51        142444     62213510
ENV52        216479     84260093
ENV53        212739     92631460
ENV54        108076     43437556
ENV55        224285     98781551
ENV56        224801     91743994
ENV57        142913     92475300
ENV58        198696     110740676
ENV59        182654     90462970
ENV6         95         218048894
ENV60        192288     111910079
ENV61        40072      31101704
ENV62        128581     185683947
ENV63        222838     135650807
ENV64        235193     93441340
ENV65        89801      42201093
ENV66        194647     111920729
ENV67        127865     172579763
ENV68        69699      226141964
ENV69        92596      174581041
ENV7         66         210788759
ENV70        151614     148074450
ENV8         76         217162029
ENV9         88         227519317
EST1         152676     59069390
EST10        155710     67094244
EST100       152778     76471565
EST101       145010     99279907
EST102       145172     85252768
EST103       148873     93081688
EST104       7515       4350644
EST105       149617     109417790
EST106       135201     99318378
EST107       136259     97454300
EST108       136240     94831240
EST109       2404       1587299
EST11        163513     69162725
EST110       136751     77270907
EST111       176402     105757023
EST112       193953     119226230
EST113       236921     141663216
EST114       6625       4068145
EST115       229453     127643708
EST116       181481     102909630
EST117       190332     93492765
EST118       5099       3955929
EST119       148552     100253258
EST12        150942     64842625
EST120       154735     119130491
EST121       166280     97900067
EST122       22063      15461205
EST123       130028     82530428
EST124       83543      30920786
EST125       36769      12485692
EST126       84106      31034635
EST127       84264      34515269
EST128       33711      11378339
EST129       85031      32709177
EST13        186630     83471161
EST130       82017      34968192
EST131       83454      35266094
EST132       84118      32965334
EST133       14468      5903340
EST134       83460      51063090
EST135       173481     87480434
EST136       170361     77647991
EST137       145527     91797238
EST138       29659      18775715
EST139       140355     87014374
EST14        104811     47840316
EST140       149335     97877743
EST141       157292     78661333
EST142       181198     92623099
EST143       8928       5198058
EST144       141571     76041135
EST145       151601     73227132
EST146       148413     87031476
EST147       155752     83569790
EST148       11737      6920241
EST149       166215     102160051
EST15        197269     111601119
EST150       202194     107310927
EST151       158867     93286369
EST152       102222     51075859
EST153       155639     79042501
EST154       135075     80133731
EST155       141690     88158876
EST156       165810     85752287
EST157       9314       5218716
EST158       178963     104151551
EST159       218711     94419352
EST16        147215     104725379
EST160       145773     85810763
EST161       161375     87629314
EST162       3060       1522277
EST163       140660     82396713
EST164       132522     83740466
EST165       147239     88250074
EST166       146465     80718685
EST167       20643      10465005
EST168       117769     61073260
EST169       115690     61941713
EST17        156631     83466519
EST170       122419     54128062
EST171       121107     48630686
EST172       29423      11431564
EST173       122215     48678047
EST174       125709     48482605
EST175       165795     83310643
EST176       172205     75576921
EST177       24657      15513157
EST178       147743     104364925
EST179       163429     99358064
EST18        190911     116773263
EST180       205284     116217156
EST181       167108     93350542
EST182       154079     103286743
EST183       134219     92993843
EST184       10781      6013701
EST185       146582     94120876
EST186       155009     80959254
EST187       131944     71058979
EST188       160849     90599706
EST189       13374      8457055
EST19        177388     113010572
EST190       148856     87653960
EST191       153702     95467761
EST192       175523     99184477
EST193       140426     77130017
EST194       5069       4154661
EST195       123969     64274913
EST196       162724     90851367
EST197       173182     99602063
EST198       149608     92840359
EST199       6208       3890993
EST2         157282     60510852
EST20        71052      55760620
EST200       164744     79130838
EST201       122494     84334397
EST202       163360     96333381
EST203       163857     96044460
EST204       14391      6877097
EST205       5847       2580354
EST206       111104     63044686
EST207       151046     87021627
EST208       107364     63627194
EST209       164131     100717476
EST21        194393     109147209
EST210       168271     124553548
EST211       82827      67366748
EST212       186418     95121486
EST213       145276     90199387
EST214       87375      65650378
EST215       141901     85212151
EST216       137926     75159382
EST217       95589      30683406
EST218       146906     86273980
EST219       148603     82462097
EST22        179810     92394847
EST220       141349     94228845
EST221       155430     90012111
EST222       9685       6801701
EST223       161751     99534043
EST224       154087     93665386
EST225       123359     88322855
EST226       146025     90242566
EST227       6970       4220792
EST228       128831     82021098
EST229       127856     89666249
EST23        107374     50540264
EST230       44462      31954010
EST231       156429     83331488
EST232       167399     92029721
EST233       166930     92691445
EST234       158125     88082990
EST235       163896     91508682
EST236       163228     92242200
EST237       166033     91294921
EST238       154891     85088026
EST239       168030     90687163
EST24        190973     61391053
EST240       187909     98489047
EST241       191353     107062803
EST242       168339     100302935
EST243       180025     103224685
EST244       190025     112759300
EST245       186323     113230756
EST246       178010     115392887
EST247       7071       5607359
EST248       140678     86230531
EST249       212608     138834650
EST25        136526     39210780
EST250       226939     111326329
EST251       164069     113913134
EST252       183146     95756964
EST253       197974     98471029
EST254       123046     89289573
EST255       7475       5185523
EST256       140224     82365172
EST257       206165     112641063
EST258       162520     106390912
EST259       93652      92365147
EST26        102354     27619605
EST260       15350      19976681
EST261       147622     99189632
EST262       150774     89759199
EST263       139173     101743187
EST264       216340     99354102
EST265       4557       2818031
EST266       133637     96436732
EST267       129480     90284216
EST268       135534     98319212
EST269       113351     81419970
EST27        201338     85169852
EST270       17506      11098660
EST271       136224     84348047
EST272       125703     85851017
EST273       127790     96577160
EST274       36547      26163272
EST275       126643     89388805
EST276       116516     79036312
EST277       138891     83673395
EST278       145961     114899511
EST279       15595      11031908
EST28        19821      8893541
EST280       125396     117389437
EST281       132432     98774167
EST282       162340     97564182
EST283       165664     104470460
EST284       19254      12068797
EST285       142244     92439543
EST286       168937     115104815
EST287       151680     103900486
EST288       136290     103152104
EST289       3477       2302058
EST29        203801     100091766
EST290       159549     97229973
EST291       222526     90766361
EST292       152836     111325212
EST293       160406     71767282
EST294       10503      1187900
EST295       208917     37980980
EST296       212285     83331327
EST297       150079     115258622
EST298       168109     97764449
EST299       154827     103149238
EST3         156018     54727763
EST30        216481     109022941
EST300       169088     109995501
EST301       149449     109855556
EST302       2107       1417749
EST303       180762     102245085
EST304       178557     93089320
EST305       168969     109474760
EST306       158896     104101649
EST307       2398       1914056
EST308       225882     106204624
EST309       266222     115901760
EST31        153821     67061608
EST310       185439     112102698
EST311       151095     28710339
EST312       227853     99483459
EST313       175581     100343452
EST314       156175     99883140
EST315       159727     95006074
EST316       543        410397
EST317       166298     114042738
EST318       179946     95180769
EST319       143779     97256505
EST32        149596     63761513
EST320       188320     110423173
EST321       187360     49128528
EST322       201669     33864879
EST323       174165     95391984
EST324       14772      9232819
EST325       158235     113265480
EST326       184738     110428476
EST327       167352     97719994
EST328       166041     109775761
EST329       165849     71375282
EST33        165157     65679151
EST330       127597     80015094
EST331       121219     80441264
EST332       146648     101336767
EST333       22532      8283129
EST334       250611     26632520
EST335       254708     23392212
EST336       152004     94195783
EST337       152251     98608210
EST338       150981     99685495
EST339       145900     92252316
EST34        147003     64492650
EST340       237635     43478768
EST341       185545     80776253
EST342       4109       5065294
EST343       168809     99763180
EST344       163997     101146005
EST345       145649     92756666
EST346       189443     103114177
EST347       156147     109738593
EST348       153297     101566189
EST349       2426       915498
EST35        162551     70856183
EST350       184325     108355450
EST351       169903     94662060
EST352       169193     105186170
EST353       178502     59668526
EST354       195269     72030896
EST355       194748     75388710
EST356       197291     74551080
EST357       134728     70211808
EST358       174807     127367579
EST359       148418     85121620
EST36        160819     65982591
EST360       150542     86642955
EST361       121468     94919785
EST362       5854       4644851
EST363       142701     94368059
EST364       155337     94314170
EST365       162092     90166056
EST366       157051     100309750
EST367       23514      10344877
EST368       45656      24624838
EST369       155288     104534407
EST37        107941     33682655
EST370       137851     97031462
EST371       158407     101966985
EST372       152636     109698741
EST373       30251      25770943
EST374       173564     146756127
EST375       163563     85431475
EST376       127556     80910067
EST377       137828     94040600
EST378       51292      35914739
EST379       131619     88276056
EST38        99513      30489875
EST380       137093     89601408
EST381       139337     96986761
EST382       147122     97080674
EST383       51285      41115140
EST384       164163     86543504
EST385       143622     81414969
EST386       144917     86070913
EST387       144174     103725090
EST388       155671     93199334
EST389       137838     87384737
EST39        99154      31399112
EST390       132358     84149156
EST391       20621      12735139
EST392       196942     107257732
EST393       136851     75001285
EST394       92969      54570705
EST395       120408     80237774
EST396       23482      14313208
EST397       131163     83003777
EST398       119637     76596555
EST399       147254     80733353
EST4         142972     56362966
EST40        98816      29786908
EST400       210376     82562780
EST401       30530      12823111
EST402       163629     84365124
EST403       163915     99171904
EST404       159146     95828367
EST405       125988     81300508
EST406       12160      7968720
EST407       129505     86703580
EST408       137395     90180185
EST409       178547     111875412
EST41        39236      11600145
EST410       154171     93123046
EST411       27993      12149931
EST412       166707     92004584
EST413       168827     124876758
EST414       87406      56144923
EST415       69679      41105540
EST416       34123      16799504
EST417       137508     79953191
EST418       82435      49421981
EST419       139695     56837590
EST42        101326     31351096
EST420       148165     29996844
EST421       148030     30296764
EST422       162600     80122839
EST423       28322      14992272
EST424       201213     115842274
EST425       237755     108748070
EST426       220152     107479554
EST427       127106     74508992
EST428       128057     85803248
EST429       131704     80409324
EST43        102633     36243427
EST430       93228      56881081
EST431       174105     110064955
EST432       213136     84698644
EST433       106574     28506785
EST434       183805     112197780
EST435       204013     111450866
EST436       179865     106142376
EST437       199825     118151636
EST438       132833     62169230
EST439       110244     60113023
EST44        95475      48218258
EST440       162601     108614110
EST441       181152     115720728
EST442       108077     86015819
EST443       177406     140114098
EST444       150416     90428046
EST445       53727      34187139
EST446       166032     106944103
EST447       178087     101018025
EST448       43119      24597584
EST449       195531     106623447
EST45        121121     52335541
EST450       183938     94245324
EST451       52079      38877556
EST452       189908     115817461
EST453       180010     117991164
EST454       54577      33991762
EST455       196573     133887305
EST456       219857     123775014
EST457       190083     126954064
EST458       189310     147446971
EST459       245        208987
EST46        55810      33167886
EST460       204235     155997292
EST461       192186     115131159
EST462       160757     96336104
EST463       181270     94921873
EST464       7385       612837
EST465       53496      4381716
EST466       158232     12239421
EST467       144975     12987161
EST468       147925     29931089
EST469       148356     29501756
EST47        176557     89017795
EST470       8452       1761940
EST471       148043     30264080
EST472       141212     81174487
EST473       171838     100380170
EST474       161774     110922855
EST475       18854      13397322
EST476       160791     92777315
EST477       150647     104119272
EST478       133681     93216563
EST479       141645     98055934
EST48        158183     65088174
EST480       16388      8448969
EST481       157370     103674753
EST482       146436     105285396
EST483       162033     97575888
EST484       165803     50894471
EST485       11878      1866206
EST486       160476     40344382
EST487       150798     102143723
EST488       146645     96524317
EST489       170799     112268881
EST49        162221     91938423
EST490       21942      11899307
EST491       132527     75702844
EST492       189749     107907416
EST493       149390     109146835
EST494       53584      36369591
EST495       126855     87064282
EST496       145499     90195929
EST497       147490     88692569
EST498       163221     89104389
EST499       36874      18813959
EST5         162046     62591557
EST50        154876     80579871
EST500       151814     92135788
EST501       155897     91913883
EST502       168266     101949309
EST503       136388     85421194
EST504       15962      9035730
EST505       100253     71169364
EST506       78626      60620272
EST507       97487      64759548
EST508       143372     80452947
EST509       37226      21222196
EST51        156390     74771983
EST510       120541     73310508
EST511       133322     87344399
EST512       135156     79264445
EST513       151334     92889729
EST514       47409      25670700
EST515       155622     85762323
EST516       184607     110438354
EST517       120137     78951230
EST518       178635     94897883
EST519       5702       2164823
EST52        108219     61222574
EST520       52576      18674859
EST521       182541     100649496
EST522       152157     81325643
EST523       23072      13939109
EST524       162316     94446797
EST525       211236     123658554
EST526       30185      19341621
EST527       147947     99619943
EST528       158450     97593385
EST529       134306     87493560
EST53        153908     88947693
EST530       128606     87864927
EST531       26187      16360625
EST532       178675     74362205
EST533       179255     79447754
EST534       198851     83514482
EST535       194840     80581746
EST536       3966       1342650
EST537       178841     95307232
EST538       174453     102491582
EST539       180226     107868953
EST54        154192     84966111
EST540       171846     103644370
EST541       196638     126473040
EST542       186422     103125636
EST543       178905     82832538
EST544       148055     94312963
EST545       206518     125003286
EST546       205657     126701639
EST547       188926     108266858
EST548       208317     121345654
EST549       34317      17820709
EST55        152219     92235100
EST550       154052     96415299
EST551       188393     117732246
EST552       166519     98776846
EST553       133844     98369794
EST554       8620       7015823
EST555       157219     92146041
EST556       170362     84878810
EST557       149196     85129124
EST558       151163     81926921
EST559       11956      7150822
EST56        150016     69955319
EST560       156467     79957632
EST561       181230     106299047
EST562       162169     102992106
EST563       175036     107727454
EST564       4117       2840067
EST565       170731     117095565
EST566       183760     113528803
EST567       129213     83786164
EST568       168581     97326794
EST569       184898     110421593
EST57        142162     76714634
EST570       37576      24548024
EST571       204465     119127975
EST572       269500     91747576
EST573       25706      9441749
EST574       262208     83553217
EST575       157809     57578785
EST576       162272     59124446
EST577       80841      30900587
EST58        151712     83218730
EST59        161193     65788370
EST6         166112     64978985
EST60        144589     70133092
EST61        160365     89939140
EST62        150338     92593245
EST63        150109     99271395
EST64        157599     94514967
EST65        2728       1149257
EST66        154753     103415401
EST67        162949     82998651
EST68        166589     84840478
EST69        142352     77836923
EST7         163846     67720202
EST70        148310     82501319
EST71        149036     86112123
EST72        148460     92218214
EST73        150500     87400835
EST74        3304       1952687
EST75        29919      18235506
EST76        186623     102758272
EST77        170455     90769208
EST78        212135     115450370
EST79        179537     103352293
EST8         161154     67906089
EST80        2595       1769868
EST81        196745     121640362
EST82        167534     93333044
EST83        136015     63285830
EST84        128081     62611512
EST85        11180      5737805
EST86        150319     92587484
EST87        154531     96912480
EST88        130223     66329267
EST89        140169     89287993
EST9         169372     69362188
EST90        14619      7602591
EST91        183459     91893008
EST92        204450     119806817
EST93        202071     108015966
EST94        192047     90419584
EST95        203805     86998966
EST96        145901     86952813
EST97        137792     84713096
EST98        158917     76747059
EST99        9280       6073374
GSS1         172819     126566183
GSS10        15066      14536259
GSS100       156116     139401502
GSS101       16660      10968419
GSS102       168722     143967545
GSS103       157878     109069542
GSS104       156130     106446313
GSS105       152737     105718247
GSS106       168005     122783070
GSS107       149452     126270758
GSS108       161684     125096177
GSS109       186494     115925678
GSS11        145620     106560749
GSS110       16921      10328517
GSS111       185687     119751799
GSS112       201287     103923207
GSS113       219837     124103198
GSS114       87631      57036303
GSS115       151983     114077516
GSS116       155174     118808941
GSS117       155138     118870338
GSS118       163306     106817361
GSS119       37488      21562888
GSS12        199550     104018945
GSS120       179013     131661113
GSS121       189765     117491847
GSS122       166053     55057548
GSS123       169938     76249060
GSS124       3108       2065491
GSS125       161448     105035511
GSS126       188861     124688564
GSS127       200296     82002210
GSS128       168220     79987296
GSS129       137268     94431217
GSS13        191750     84122956
GSS130       129855     104605133
GSS131       132043     108777560
GSS132       132451     106048276
GSS133       8056       5958858
GSS134       135214     112032054
GSS135       56598      47104660
GSS136       132584     107786768
GSS137       139149     116140565
GSS138       140043     114408742
GSS139       138251     109584898
GSS14        173813     89351023
GSS140       4155       2820771
GSS141       134784     106426486
GSS142       134049     108003847
GSS143       134400     111531585
GSS144       138188     116474348
GSS145       4675       3643453
GSS146       139468     108106612
GSS147       136810     113648547
GSS148       136898     113473892
GSS149       137299     112649085
GSS15        1923       979546
GSS150       559        466085
GSS151       137155     110923756
GSS152       134480     106278327
GSS153       133002     107665198
GSS154       138659     116136290
GSS155       1985       1674795
GSS156       127182     92203837
GSS157       174120     105055177
GSS158       184500     110115659
GSS159       162396     108642438
GSS16        167993     83936759
GSS160       177410     102425568
GSS161       195461     128380839
GSS162       201536     133264449
GSS163       200713     134063851
GSS164       180958     126497988
GSS165       198341     136948587
GSS166       196713     139067120
GSS167       196064     138671402
GSS168       174299     134354206
GSS169       144474     97339661
GSS17        159730     81436785
GSS170       138053     80502012
GSS171       165315     73484620
GSS172       130293     57961944
GSS173       162971     140972883
GSS174       170929     113510307
GSS175       80876      52984365
GSS176       191836     128985792
GSS177       196309     117886155
GSS178       28746      15068170
GSS179       180225     98140530
GSS18        155963     85601456
GSS180       181302     123365801
GSS181       178800     126906476
GSS182       181098     127179984
GSS183       19114      12799890
GSS184       165902     130533276
GSS185       170769     155442034
GSS186       219492     123624062
GSS187       216568     103419657
GSS188       17938      8362456
GSS189       210015     95106166
GSS19        153512     95921722
GSS190       156360     134164103
GSS191       7026       6971057
GSS192       125540     102753347
GSS193       122235     93469471
GSS194       156641     154268782
GSS195       167926     158459909
GSS196       131396     104305071
GSS197       149360     107958474
GSS198       170087     141609204
GSS199       173854     119768130
GSS2         172571     106974789
GSS20        153653     72718658
GSS200       20783      12070044
GSS201       181326     133978343
GSS202       184903     120111167
GSS203       180120     93026884
GSS204       172833     121727487
GSS205       189431     117159380
GSS206       189632     116856204
GSS207       21296      12387505
GSS208       200656     130020228
GSS209       215713     142627344
GSS21        106600     59132682
GSS210       217639     140378671
GSS211       166383     136378793
GSS212       152462     108697496
GSS213       159546     120179342
GSS214       159222     144721125
GSS215       159710     141551694
GSS216       160025     145012269
GSS217       161623     143744366
GSS218       162207     142682743
GSS219       161901     124660013
GSS22        132522     64635660
GSS220       168118     139542770
GSS221       162158     116272085
GSS222       180581     88741808
GSS223       2336       1590941
GSS224       251369     52150506
GSS225       262481     40466091
GSS226       262523     40408947
GSS227       122800     38229504
GSS228       253355     52912344
GSS229       182565     86129448
GSS23        125192     56723722
GSS230       188824     55952203
GSS231       154340     118464017
GSS232       177033     144334259
GSS233       160566     145786280
GSS234       158963     146486119
GSS235       175119     110481562
GSS236       238210     57319690
GSS237       198799     101427029
GSS238       228515     39541879
GSS239       119354     74753574
GSS24        133968     72981771
GSS240       173535     111783710
GSS241       148018     90088400
GSS242       140582     83903957
GSS243       159746     149647104
GSS244       6365       5418280
GSS245       112668     95722541
GSS246       180351     149222837
GSS247       172952     122406011
GSS248       201906     127716686
GSS249       188212     120277412
GSS25        142794     74274291
GSS250       166175     94403497
GSS251       159865     84500591
GSS252       156428     119869599
GSS253       203515     148105542
GSS254       14310      9406216
GSS255       171523     67875770
GSS256       176316     96175653
GSS257       195480     152066346
GSS258       199052     153893384
GSS259       8581       7079434
GSS26        12574      5388027
GSS260       197557     157030943
GSS261       197584     124265372
GSS262       194871     142522000
GSS263       895        619641
GSS264       214431     131244295
GSS265       189953     57620998
GSS266       211774     108913136
GSS267       177797     157192397
GSS268       163847     150141472
GSS269       233829     131848785
GSS27        140896     65655631
GSS270       241255     120361822
GSS28        159848     79832938
GSS29        156477     92542330
GSS3         138092     115758007
GSS30        164870     85222547
GSS31        10249      5303517
GSS32        171961     102867176
GSS33        182793     109077642
GSS34        182275     87047073
GSS35        172993     102196407
GSS36        190487     103919871
GSS37        162239     112347665
GSS38        160381     98321810
GSS39        173084     108449557
GSS4         140070     112435882
GSS40        4447       3196273
GSS41        183985     122974505
GSS42        181741     117322404
GSS43        52286      27335335
GSS44        177820     102905200
GSS45        164518     141969870
GSS46        179633     148569334
GSS47        139686     92499212
GSS48        182873     132017102
GSS49        181617     114554523
GSS5         12738      9524807
GSS50        204428     116967955
GSS51        185581     99459566
GSS52        211954     108037045
GSS53        211747     108318359
GSS54        197283     132772792
GSS55        158243     124832316
GSS56        185583     139405028
GSS57        196772     63136393
GSS58        171739     96411428
GSS59        157707     106161954
GSS6         152750     116376137
GSS60        23373      13575160
GSS61        166615     156644394
GSS62        177186     98817414
GSS63        161235     115244635
GSS64        172264     112294127
GSS65        175437     118749924
GSS66        184317     127706706
GSS67        205680     128787401
GSS68        187487     111746271
GSS69        904        494120
GSS7         170823     119988374
GSS70        200507     134082593
GSS71        215979     158545254
GSS72        188980     137988156
GSS73        173702     107612445
GSS74        198148     111946385
GSS75        140507     76313882
GSS76        163068     95818066
GSS77        10997      7015314
GSS78        159270     97756741
GSS79        159481     96970229
GSS8         177093     108887521
GSS80        172278     114346124
GSS81        170756     109404389
GSS82        174615     122489482
GSS83        188951     105344114
GSS84        175437     126363935
GSS85        163968     106294793
GSS86        1150       906691
GSS87        189456     108638630
GSS88        181502     114048174
GSS89        166782     118040332
GSS9         141917     118718850
GSS90        192391     105704417
GSS91        9238       5335682
GSS92        213831     107550639
GSS93        226833     89047322
GSS94        213068     138993481
GSS95        183490     92580894
GSS96        94686      37020965
GSS97        193805     75823638
GSS98        201086     123394316
GSS99        191020     122180795
HTC1         41190      63371632
HTC2         32318      72271528
HTC3         32081      77888423
HTC4         84851      50686507
HTC5         129507     161162980
HTC6         125281     123134227
HTC7         137566     130735831
HTC8         68242      61511758
HTG1         3784       374870703
HTG10        2848       363016285
HTG11        1976       365940103
HTG12        1714       382089084
HTG13        1718       381796340
HTG14        1659       383118453
HTG15        1835       380424998
HTG16        1750       361896240
HTG17        1843       380599315
HTG18        1752       382301790
HTG19        1775       381824019
HTG2         5068       373604329
HTG20        1891       380883515
HTG21        2135       355865123
HTG22        2426       376351102
HTG23        2269       379507879
HTG24        2442       381163865
HTG25        2175       382733656
HTG26        2070       368006459
HTG27        2074       380458182
HTG28        2061       380108509
HTG29        1047       202962639
HTG3         2556       370662362
HTG30        2040       379446758
HTG31        2203       375546591
HTG32        986        170706729
HTG33        2152       379221269
HTG34        2348       376393195
HTG35        1372       195850538
HTG36        2462       370234045
HTG37        2428       372528369
HTG38        1015       169191937
HTG39        2235       381490266
HTG4         2735       369989641
HTG40        2336       385145188
HTG41        1069       180930974
HTG42        2312       384776536
HTG43        2363       384490832
HTG44        906        155597869
HTG45        2500       379735659
HTG46        2319       385244375
HTG47        927        158722850
HTG48        2315       385567657
HTG49        2293       386023883
HTG5         2500       373389217
HTG50        900        149450476
HTG51        2237       385154833
HTG52        2106       380011723
HTG53        657        122585305
HTG54        2010       379525743
HTG55        1981       378955508
HTG56        1184       193581815
HTG57        2144       380658486
HTG58        2686       383430148
HTG59        2972       383122016
HTG6         2          386956
HTG60        885        128384665
HTG61        2959       380503057
HTG62        3012       366231486
HTG63        2990       372824610
HTG64        2953       336850403
HTG65        3178       359117111
HTG66        3179       359260560
HTG67        3186       360427818
HTG68        3128       367889098
HTG69        2913       377859052
HTG7         2327       375791086
HTG70        1846       312468258
HTG71        3415       365492036
HTG72        2071       381329139
HTG73        1668       298160154
HTG74        2088       382520375
HTG75        2244       384445864
HTG76        1669       296247510
HTG77        2201       385233869
HTG78        2249       384504439
HTG79        3218       384021459
HTG8         1500       384347777
HTG80        2165       384532378
HTG81        3034       373057359
HTG82        2058       208470424
HTG9         1582       384062276
INV1         154211     140125474
INV10        14         359428768
INV100       38         390437780
INV101       20         259303673
INV102       35         382133951
INV103       38872      329071928
INV104       150512     102088339
INV105       33023      23688070
INV106       148733     103480811
INV107       151701     116047646
INV108       122516     84173487
INV109       154551     113287938
INV11        9          363281720
INV110       153225     120338348
INV111       54906      36642078
INV112       152540     109209011
INV113       153315     115160877
INV114       37699      32658911
INV115       141179     88268133
INV116       147135     93439006
INV117       45303      34239701
INV118       147826     97090733
INV119       138817     81291223
INV12        52         355336707
INV120       43613      25842201
INV121       138017     82536983
INV122       137808     82608639
INV123       54195      35775624
INV124       138713     83223666
INV125       135046     98662356
INV126       75414      58987397
INV127       141713     107958089
INV128       150260     120621219
INV129       155573     117637924
INV13        14         371434550
INV130       111360     212966781
INV131       16794      35645279
INV132       181112     235169059
INV133       218151     167649786
INV134       38629      187147326
INV135       800        42674647
INV136       566        40635863
INV137       8037       115580217
INV138       23265      332345847
INV139       23319      172531536
INV14        78         134821644
INV140       67585      303875862
INV141       121343     264933975
INV142       66775      80327893
INV143       180562     231780487
INV144       41599      303967104
INV145       314        393292454
INV146       1015       105322314
INV147       2059       383654064
INV148       2          41011863
INV149       591        361654729
INV15        6          384224499
INV150       8          378508614
INV151       974        354275690
INV152       6          380479040
INV153       2          95552909
INV154       22         390382246
INV155       10036      362338941
INV156       377        367082657
INV157       3442       40201456
INV158       1          685423969
INV159       1          640667275
INV16        14         390998271
INV160       1          639123876
INV161       1          612949391
INV162       1          577192767
INV163       1          641629864
INV164       542        321015205
INV165       2          371500015
INV166       2          289902239
INV167       2965       358959205
INV168       59278      333080964
INV169       34         383065485
INV17        25         372322353
INV170       19         393344928
INV171       14         327270017
INV172       27         393651567
INV173       32         390738662
INV174       24         383706815
INV175       25         382049854
INV176       31         378115211
INV177       13         297748085
INV178       18         387848062
INV179       24         381271345
INV18        18         383937723
INV180       36         390867092
INV181       34         389743485
INV182       26         391141334
INV183       19         292893418
INV184       11         371260264
INV185       19         391738075
INV186       12         391781067
INV187       13         372901688
INV188       32         389502835
INV189       22         330411078
INV19        26         392368732
INV190       29         389284801
INV191       38         387663352
INV192       17         367589223
INV193       12         387517245
INV194       17         362786034
INV195       10         320557524
INV196       13         376469258
INV197       35         380323776
INV198       26         392110960
INV199       24         388964019
INV2         2291       316412759
INV20        36         375055431
INV200       21         391745060
INV201       22         309540561
INV202       27         392282931
INV203       24         388632304
INV204       12         375724207
INV205       16         393313708
INV206       13         392068861
INV207       10         277290815
INV208       15         358735036
INV209       11         386907833
INV21        4          251686535
INV210       16         377160064
INV211       21         392427759
INV212       5          215849302
INV213       15         382505853
INV214       743        382889760
INV215       26         386022184
INV216       28         394591284
INV217       7          307846648
INV218       4          182170525
INV219       2          342421305
INV22        3          241225934
INV220       2          269826459
INV221       18         385786230
INV222       1901       346423954
INV223       8863       319021282
INV224       11615      311682508
INV225       29307      83537282
INV226       149617     106226519
INV227       152634     93735941
INV228       83925      48859680
INV229       151004     93686866
INV23        3          393880593
INV230       150800     109796050
INV231       60547      51166423
INV232       151315     122942685
INV233       149592     121132393
INV234       82786      67518899
INV235       148464     115315196
INV236       143005     123214767
INV237       93908      113364482
INV238       144921     128174570
INV239       137711     120448200
INV24        3          261336042
INV240       27634      321212814
INV241       3385       376521042
INV242       913        53485129
INV243       96781      321023124
INV244       217342     232110336
INV245       60949      250981301
INV246       104213     292697254
INV247       28749      364829410
INV248       1766       378350697
INV249       2736       196647685
INV25        3          322765503
INV250       184144     268358078
INV251       1785       378880292
INV252       5583       374469857
INV253       20768      153711624
INV254       288223     205808194
INV255       1224       379793465
INV256       4515       373876603
INV257       92490      210334617
INV258       391527     140904810
INV259       109733     258294965
INV26        2          265971290
INV260       62463      308727005
INV261       4162       375136162
INV262       44629      350112618
INV263       2155       4626806
INV264       298725     199657065
INV265       214334     249067665
INV266       2226       377046597
INV267       19303      366955288
INV268       16948      41978773
INV269       298408     186907243
INV27        4          328757598
INV270       1355       379516794
INV271       3687       378313727
INV272       136930     300095839
INV273       38349      357698579
INV274       664        92151452
INV275       8529       370827851
INV276       197744     256830145
INV277       359558     128682792
INV278       93023      322972837
INV279       2568       378355489
INV28        5          378753109
INV280       61847      343439542
INV281       197199     120632237
INV282       47569      293457529
INV283       11         153204655
INV284       15         379655485
INV285       6          355188453
INV286       1          239744465
INV287       1          231634122
INV288       1          221096292
INV289       1          220877407
INV29        5          371191486
INV290       1          216720617
INV291       1          210676062
INV292       2          387811394
INV293       2          329972158
INV294       2          302384449
INV295       20         360081608
INV296       9          301825222
INV297       23         382490317
INV298       23         380735444
INV299       18         387931948
INV3         104568     181897231
INV30        4          376987297
INV300       33         390736486
INV301       795        381170065
INV302       20         391287680
INV303       2          32244328
INV304       27         388830496
INV305       21         386972019
INV306       9          351834369
INV307       5          163634948
INV308       1          292306469
INV309       1          164045107
INV31        4          293537168
INV310       2          318230244
INV311       862        391032735
INV312       30         390895475
INV313       25         383908286
INV314       25         388289419
INV315       3          49480870
INV316       25         384967207
INV317       26         391482668
INV318       22         392427991
INV319       26         383547221
INV32        4          373434888
INV320       26         265978999
INV321       6          371290168
INV322       13         374069663
INV323       19         385560269
INV324       15         373391572
INV325       13         350978987
INV326       22         386100611
INV327       24         386055502
INV328       23         389090030
INV329       31         366704932
INV33        42         369246043
INV330       12         307588661
INV331       24         393918543
INV332       16         362929629
INV333       8          361035446
INV334       13         369493806
INV335       13         384884009
INV336       18         390461886
INV337       22         394170044
INV338       11         336163521
INV339       6          353407420
INV34        85         349384053
INV340       7          372089599
INV341       3          84055540
INV342       9          390324178
INV343       19         393988728
INV344       11         137914990
INV345       1          346874609
INV346       1          248688513
INV347       1          195213701
INV348       21         389226046
INV349       16         380802157
INV35        32         393731299
INV350       17         384888603
INV351       24         390785021
INV352       14         272669524
INV353       19         394017224
INV354       17         391933486
INV355       7          291754234
INV356       2          360067285
INV357       1          158111693
INV358       5          390880948
INV359       1          269711166
INV36        14751      304415600
INV360       1          265788494
INV361       5          389225578
INV362       8          84827761
INV363       32         385162699
INV364       29         391336068
INV365       26         380265073
INV366       8          257485661
INV367       20         383534539
INV368       18         388997674
INV369       13         372064491
INV37        138306     111708740
INV370       12         246225518
INV371       18         394216238
INV372       18         380558243
INV373       10         378653212
INV374       35         286756574
INV375       57         386542022
INV376       41         394290459
INV377       30         391877099
INV378       23         388833300
INV379       17         384297034
INV38        167056     133948959
INV380       29         391447036
INV381       26         381054851
INV382       8          105967983
INV383       29         389236155
INV384       23         387510109
INV385       25         393194949
INV386       29         393406758
INV387       10         389413895
INV388       12         256001243
INV389       25         382453876
INV39        127005     112723961
INV390       25         387644779
INV391       17         390017898
INV392       13         185974631
INV393       1          252586203
INV394       2          382245123
INV395       1          170640157
INV396       3          172715237
INV397       1          265601162
INV398       1          235131548
INV399       8          377013040
INV4         59425      271472954
INV40        37136      273256295
INV400       18         389308576
INV401       6          76294397
INV402       2          316929497
INV403       5          371999024
INV404       13         377525467
INV405       22         380131966
INV406       4          94235370
INV407       20         386111019
INV408       10         330750052
INV409       8          388492156
INV41        2779       371575686
INV410       29         385235322
INV411       3          68204675
INV412       1          375708846
INV413       156        377889012
INV414       3          72566929
INV415       18         393806697
INV416       12         375328864
INV417       13         388485421
INV418       17         389690952
INV419       10         355855682
INV42        44         370097884
INV420       12         388165924
INV421       5          66893570
INV422       2          334507981
INV423       2          271847796
INV424       9          384970046
INV425       14         380331769
INV426       17         331062789
INV427       4          353245537
INV428       5          361980503
INV429       1          66459093
INV43        24         379282269
INV430       6          375950524
INV431       11         380698960
INV432       13         393299321
INV433       16         371834617
INV434       4          107829629
INV435       16         390859621
INV436       35         393136677
INV437       18         389411089
INV438       79         348191088
INV439       10         366985680
INV44        5          76533839
INV440       18         382945053
INV441       3          55752453
INV442       23         351194891
INV443       4          361297550
INV444       9          382900679
INV445       16         391635138
INV446       22         382293034
INV447       15         196095018
INV448       12         326431359
INV449       3          345780114
INV45        32         391299062
INV450       4          385052575
INV451       7          393658431
INV452       34         353200314
INV453       2          278332741
INV454       8          361353987
INV455       10         379658367
INV456       13         380787037
INV457       8          386860579
INV458       6          361028373
INV459       3          168396230
INV46        25         362900281
INV460       7          375518624
INV461       11         388354722
INV462       34         385429758
INV463       20         384238059
INV464       9          372379570
INV465       10         251128019
INV466       11         370878851
INV467       38         392392993
INV468       39         383674587
INV469       29         392907305
INV47        18         380479131
INV470       24         381869223
INV471       13         164951452
INV472       41         380881166
INV473       15         386326246
INV474       9          137942415
INV475       1          410988561
INV476       2          347081175
INV477       2          60458881
INV478       1          429819325
INV479       1          230177572
INV48        19         390062857
INV480       2          394052085
INV481       35         354776638
INV482       7          318208416
INV483       5          336561253
INV484       7          357043306
INV485       7          262116983
INV486       1          170575982
INV487       2          287036945
INV488       2          275604705
INV489       3          367947227
INV49        5          134896453
INV490       3          342256987
INV491       5          256844362
INV492       13         321847114
INV493       5          332460113
INV494       95         319933371
INV495       12         328718900
INV496       9          217598510
INV497       20         352503315
INV498       9          379049671
INV499       14         374215308
INV5         37250      77357097
INV50        18         373966012
INV500       15         347131978
INV501       3          328312092
INV502       4          369177951
INV503       3          246468438
INV504       5          376372316
INV505       11         376604127
INV506       17         381822991
INV507       22         391138986
INV508       6          54648714
INV509       12         377183847
INV51        24         386582132
INV510       29         388951608
INV511       18         377484507
INV512       27         389125135
INV513       7          92098153
INV514       22         381784561
INV515       21         380590911
INV516       13         371720425
INV517       17         390781836
INV518       3          78204341
INV519       17         377301939
INV52        8          380395300
INV520       12         357316218
INV521       6          368644317
INV522       11         310901032
INV523       11         175929272
INV524       22         392193755
INV525       13         360806743
INV526       11         375564408
INV527       9          362288897
INV528       3          377576368
INV529       4          158823784
INV53        19         379365223
INV530       12         376095937
INV531       6          372905819
INV532       7          388366567
INV533       7          351386075
INV534       12         377931078
INV535       10         168222845
INV536       21         336280653
INV537       11         387853015
INV538       17         383594904
INV539       12         371624632
INV54        9          138772803
INV540       4          205127384
INV541       1          255265360
INV542       1          230794410
INV543       2          372619140
INV544       2          311523487
INV545       13         393665610
INV546       24         199571394
INV547       2          323510804
INV548       12         381394394
INV549       12         281321844
INV55        28         391443577
INV550       6          301645505
INV551       3          327580854
INV552       2          283053804
INV553       4          358883688
INV554       3          313487646
INV555       12         372628339
INV556       11         296511468
INV557       12         205288598
INV558       1          329103898
INV559       1          266482116
INV56        28         392100242
INV560       1          255371252
INV561       1          249620899
INV562       11         381319634
INV563       28         382489592
INV564       15         383181010
INV565       13         350295444
INV566       1          90036834
INV567       5          366673549
INV568       4          356917330
INV569       6          390997169
INV57        45         382097969
INV570       1          283143227
INV571       7          386003187
INV572       18         390420686
INV573       14         352409616
INV574       3          310319640
INV575       1          94671628
INV576       4          375545906
INV577       2          330374624
INV578       9          385008187
INV579       36         348936130
INV58        27         372689086
INV580       7          362657616
INV581       12         375776805
INV582       21         386373372
INV583       28         385558874
INV584       2          30875957
INV585       30         377576257
INV586       16         383023174
INV587       25         385163881
INV588       20         289852567
INV589       11         387811488
INV59        18         385206419
INV590       13         388478264
INV591       20         388641472
INV592       37         387165660
INV593       14         208952549
INV594       33         393285708
INV595       13         364621498
INV596       12         378544770
INV597       14         393303348
INV598       17         283001740
INV599       25         393022599
INV6         129080     165753959
INV60        12         373566826
INV600       6          259595995
INV601       2          306898484
INV602       22         392724989
INV603       11         81108636
INV604       1          334972678
INV605       1          327956322
INV606       4          369938243
INV607       10         387945021
INV608       6          333511012
INV609       3          390034570
INV61        1          94407144
INV610       6          388490213
INV611       20         293384913
INV612       3          330508129
INV613       3          304092200
INV614       4          386935527
INV615       16         364918260
INV616       10         392609098
INV617       30         381548007
INV618       2          331139274
INV619       5          390800394
INV62        15         381614547
INV620       2          93184197
INV621       9          363742103
INV622       11         374818742
INV623       13         353874383
INV624       29         353592845
INV625       6          313902203
INV626       2          325968719
INV627       2          326866526
INV628       2          294862287
INV629       2          277963616
INV63        29         387067226
INV630       1          135489923
INV631       5          389105293
INV632       21         334259074
INV633       19         374293438
INV634       21         257681977
INV635       15         378008119
INV636       18         345890599
INV637       9          374177525
INV638       13         282334662
INV639       13         367448714
INV64        25         384930026
INV640       14         383036237
INV641       9          337662876
INV642       4          285079875
INV643       13         380626621
INV644       20         391060643
INV645       17         236492487
INV646       1          253604678
INV647       1          244180387
INV648       2          385719063
INV649       2          323852856
INV65        18         381070342
INV650       3          391496974
INV651       21         343038339
INV652       3          58690555
INV653       1          426962397
INV654       1          280620585
INV655       1          231242557
INV656       2          364184527
INV657       2          306065281
INV658       4          392956885
INV659       8          363398391
INV66        96841      235144884
INV660       10         371633511
INV661       13         301596009
INV662       2          278659155
INV663       5          350216916
INV664       5          342671345
INV665       7          377861791
INV666       14         385253530
INV667       25         241982210
INV668       2          304372650
INV669       5          393935960
INV67        124373     97268391
INV670       6          108274197
INV671       30         387119400
INV672       27         331364413
INV673       3          314705854
INV674       4          344406745
INV675       5          389867528
INV676       5          353121931
INV677       14         391689562
INV678       2          54168395
INV679       17         381948627
INV68        28933      319691631
INV680       13         374678762
INV681       15         378941994
INV682       49         385802294
INV683       20         386688731
INV684       18         382007266
INV685       57         153866701
INV686       5          219711870
INV687       2          319873814
INV688       6          380185718
INV689       3          382167823
INV69        28941      347133943
INV690       1          110337179
INV691       5          378872341
INV692       12         391648754
INV693       24         387492965
INV694       20         384242131
INV695       1          21687151
INV696       18         284239773
INV697       2          322765580
INV698       3          390029089
INV699       4          345523436
INV7         207        346774014
INV70        20         388604938
INV700       2          287481868
INV701       3          368157705
INV702       4          329783768
INV703       2          273830049
INV704       11         379905555
INV705       21         359076897
INV706       12         390721062
INV707       8          367683301
INV708       9          376300554
INV709       10         374632505
INV71        15         389699299
INV710       2          122089777
INV711       7          366744808
INV712       18         393384596
INV713       28         374632208
INV714       17         380406226
INV715       20088      165780341
INV72        16         252138391
INV73        34         391108693
INV74        71         392017627
INV75        24         388974367
INV76        21         381982755
INV77        20         377528210
INV78        24         388990898
INV79        29         394663938
INV8         85         322154899
INV80        27         393364046
INV81        23         381713426
INV82        137        350719386
INV83        4          381900476
INV84        24         389620289
INV85        33         393229173
INV86        9          344807465
INV87        23         323415557
INV88        32         372768847
INV89        20         384740836
INV9         3          136766944
INV90        25         385708589
INV91        29         388680045
INV92        22         323658394
INV93        25         386606940
INV94        22         384360764
INV95        22         375170759
INV96        31         394116451
INV97        20         281624502
INV98        11         364532943
INV99        14         378464462
MAM1         32389      323884866
MAM10        26814      24994146
MAM100       5          381968701
MAM101       4          345040697
MAM102       3          176472919
MAM103       6          356825309
MAM104       3          354814440
MAM105       3336       333279354
MAM106       67564      268779115
MAM107       82303      159682056
MAM108       1          179953079
MAM109       4          274800947
MAM11        13731      20581276
MAM110       4          294612101
MAM111       4          368804057
MAM112       5          360824188
MAM113       3          381844289
MAM114       4          323611747
MAM115       5          314441637
MAM116       261        273069064
MAM117       1          216965501
MAM118       1          210729441
MAM119       2          349064804
MAM12        3445       7368868
MAM120       2          311803703
MAM121       2          284093331
MAM122       3          348809871
MAM123       4          369368223
MAM124       5          363867118
MAM125       1          61486999
MAM126       4          302576983
MAM127       2          387082860
MAM128       2          304198725
MAM129       3          374133223
MAM13        107        699953
MAM130       3          326166110
MAM131       4          378433792
MAM132       4          343736516
MAM133       8054       164155453
MAM14        20         277696380
MAM15        1          249270926
MAM16        2          343930246
MAM17        3          325384739
MAM18        1          90795278
MAM19        4          322903327
MAM2         22251      277070695
MAM20        4          298795355
MAM21        6          353843759
MAM22        5          329700903
MAM23        2          289079565
MAM24        3          348530310
MAM25        4          336581445
MAM26        5          375256260
MAM27        6          373952570
MAM28        8          377813420
MAM29        5          379300313
MAM3         2          316219032
MAM30        1          38035513
MAM31        5          285741626
MAM32        5          342804543
MAM33        8          370485433
MAM34        6          316655225
MAM35        4          238884849
MAM36        4          355768297
MAM37        6          355037276
MAM38        7          389945117
MAM39        6          319172640
MAM4         2          376685399
MAM40        5          323047396
MAM41        4          347221982
MAM42        5          288444151
MAM43        5          375232988
MAM44        5          248962388
MAM45        1          277956744
MAM46        1          154038104
MAM47        3          374028897
MAM48        2          298256496
MAM49        3          355148320
MAM5         2          295769989
MAM50        3          355658200
MAM51        3          369352591
MAM52        15         389812204
MAM53        54         7614329
MAM54        215        34073042
MAM55        431        71272130
MAM56        861        68509101
MAM57        1706       2411269
MAM58        6836       6159435
MAM59        110526     193401624
MAM6         2          385026516
MAM60        33190      281607634
MAM61        4          358286156
MAM62        5          387739617
MAM63        5          335893012
MAM64        6          364021592
MAM65        6          304412506
MAM66        10         386743576
MAM67        132590     153979627
MAM68        117922     169527592
MAM69        6475       5658081
MAM7         3          316699161
MAM70        1          716413629
MAM71        1          662751787
MAM72        1          611347268
MAM73        1          464895054
MAM74        1          288121652
MAM75        3          338107697
MAM76        1          223449203
MAM77        1          210645437
MAM78        1          201318998
MAM79        1          197708286
MAM8         5          343489620
MAM80        2          320231256
MAM81        2          293750401
MAM82        3          367535284
MAM83        4          351244600
MAM84        367        269065793
MAM85        1          203623556
MAM86        2          383513587
MAM87        4          383666147
MAM88        5          381503248
MAM89        263        390074346
MAM9         933        216317382
MAM90        2          265153725
MAM91        4          366992153
MAM92        5          369689861
MAM93        5          392803577
MAM94        6          298207437
MAM95        3          363734450
MAM96        1          118519168
MAM97        3          328935722
MAM98        4          359964523
MAM99        4          383777488
PAT1         420068     157359119
PAT10        304138     130867531
PAT100       352852     189327041
PAT101       310862     206556098
PAT102       261889     226571161
PAT103       130469     96637053
PAT104       304402     217824161
PAT105       276793     236021165
PAT106       255575     243191966
PAT107       219302     91982645
PAT108       185315     167850975
PAT109       193795     145642271
PAT11        235967     216994795
PAT110       99288      56237309
PAT111       244010     110313663
PAT112       143099     226367997
PAT113       78464      27203646
PAT114       88268      271848096
PAT115       224841     124890680
PAT116       225599     104792642
PAT117       1440       4524998
PAT118       247765     75673289
PAT119       230776     33741646
PAT12        83514      75768772
PAT120       94886      123403652
PAT121       98574      119749391
PAT122       81936      115812708
PAT123       203182     107726115
PAT124       26070      9050370
PAT125       203753     100524714
PAT126       183494     80758738
PAT127       117402     19496593
PAT128       249506     208801500
PAT129       384318     114594658
PAT13        242994     211781414
PAT130       54405      7593635
PAT131       283237     179646189
PAT132       123904     298039234
PAT133       110598     304038198
PAT134       393150     122350813
PAT135       289821     158264209
PAT136       13530      9111606
PAT137       287142     182658671
PAT138       409359     14027134
PAT139       496794     33315114
PAT14        328187     148438313
PAT140       525210     7878150
PAT141       153476     3896843
PAT142       377383     123749333
PAT143       245739     106353938
PAT144       259895     238802744
PAT145       4634       392128968
PAT146       190899     207809354
PAT147       308470     120437803
PAT148       140524     153724833
PAT149       6434       91722304
PAT15        63819      1595475
PAT150       177885     181303248
PAT151       71548      185117089
PAT152       75797      115786083
PAT153       75754      115775734
PAT154       46229      38674255
PAT155       245083     68541586
PAT156       202130     63182915
PAT157       264556     57807313
PAT158       309555     83973857
PAT159       458770     54678331
PAT16        197468     165310288
PAT160       227775     118065838
PAT161       359513     132219585
PAT162       288069     50679996
PAT163       154909     4647975
PAT164       228339     77240208
PAT165       228222     72940367
PAT166       281345     18592144
PAT167       65063      7149854
PAT168       153382     170224371
PAT169       73417      134982088
PAT17        217861     141780596
PAT170       74139      123430830
PAT171       137226     84276684
PAT172       175196     2627940
PAT173       233542     99258089
PAT174       198418     145045311
PAT175       229735     110452042
PAT176       105703     68109918
PAT177       80124      122466507
PAT178       260792     46024405
PAT179       294811     4422165
PAT18        217805     104604721
PAT180       7790       116850
PAT181       278538     10765362
PAT182       99587      135915370
PAT183       220910     105875978
PAT184       23920      35278651
PAT185       143999     206566501
PAT186       173285     186742155
PAT187       70129      243259642
PAT188       6542       8869371
PAT189       137168     133366031
PAT19        238917     105580979
PAT190       136590     204923443
PAT191       208573     98959913
PAT192       284100     31395225
PAT193       26290      42269624
PAT194       264589     66935450
PAT195       227269     82111943
PAT196       179588     5746816
PAT197       194343     81150933
PAT198       52350      9088688
PAT199       82690      146051882
PAT2         329678     203029882
PAT20        217488     131790732
PAT200       75930      116106222
PAT201       76058      115438165
PAT202       205771     85563217
PAT203       2801       56020
PAT204       342231     6844620
PAT205       341891     7168782
PAT206       341071     7503562
PAT207       331154     110021550
PAT208       268658     230373189
PAT209       282624     222310160
PAT21        295528     53380117
PAT210       192664     139614235
PAT211       276098     235021090
PAT212       188385     291326630
PAT213       137484     196232251
PAT214       247191     246690030
PAT215       11728      387687504
PAT216       313354     152356909
PAT217       244602     252477336
PAT218       160029     300870611
PAT219       215545     135077252
PAT22        146945     94866926
PAT220       172971     290885692
PAT221       266003     215700941
PAT222       351362     145812803
PAT223       304073     76036411
PAT224       317818     206630332
PAT225       43590      365712261
PAT226       151381     180550783
PAT227       338212     193787787
PAT228       332520     206353769
PAT229       155792     199233054
PAT23        196051     155681695
PAT230       249094     251157045
PAT231       209852     277995521
PAT232       184404     195925874
PAT233       326554     210405939
PAT234       203551     272092254
PAT235       99377      335866542
PAT236       99211      326443528
PAT237       75106      17675292
PAT238       223851     118359598
PAT239       221974     133879053
PAT24        279812     73243530
PAT240       283904     19912548
PAT241       283825     19293837
PAT242       107112     19066142
PAT243       281624     22162860
PAT244       286514     14630240
PAT245       287155     13479675
PAT246       96564      20012546
PAT247       263509     44902329
PAT248       293106     5569014
PAT249       293106     5569014
PAT25        228210     147402372
PAT250       255051     81314236
PAT251       94271      3521898
PAT26        209288     140273116
PAT27        62592      53905393
PAT28        304661     206972920
PAT29        321040     202872656
PAT3         50191      20261086
PAT30        69615      127457294
PAT31        217213     274043600
PAT32        399532     38379558
PAT33        255490     168750319
PAT34        232102     138107387
PAT35        62843      29376718
PAT36        159609     193120408
PAT37        187244     152013825
PAT38        211997     134510272
PAT39        97879      9820358
PAT4         329462     180384364
PAT40        349667     21562036
PAT41        269132     102155254
PAT42        166        390395449
PAT43        7285       386170321
PAT44        91553      5256860
PAT45        304606     19422510
PAT46        304621     19407682
PAT47        188134     183519684
PAT48        31161      33401760
PAT49        100016     274294600
PAT5         261705     200080700
PAT50        347910     22047307
PAT51        356635     6776065
PAT52        92440      1756360
PAT53        351473     15875984
PAT54        360979     6858601
PAT55        133566     2537754
PAT56        360626     6851894
PAT57        359974     6839506
PAT58        125418     2711844
PAT59        535700     100616524
PAT6         217918     164406812
PAT60        111356     330233433
PAT61        289774     158820679
PAT62        481491     50382930
PAT63        225647     89298195
PAT64        254437     194597072
PAT65        328323     204071951
PAT66        171894     140729008
PAT67        349862     190728733
PAT68        612603     75778089
PAT69        132887     40797313
PAT7         247410     122520140
PAT70        484033     127126269
PAT71        126354     109119371
PAT72        150168     307250321
PAT73        318626     211710240
PAT74        51881      214846609
PAT75        189165     289007376
PAT76        317843     207880789
PAT77        123868     129694058
PAT78        342751     192409991
PAT79        362616     180214431
PAT8         224231     103099239
PAT80        20467      17346132
PAT81        311143     212599739
PAT82        414691     138165335
PAT83        481148     57356648
PAT84        327470     49354827
PAT85        456874     82632471
PAT86        157580     115887156
PAT87        166942     185719348
PAT88        315027     151651287
PAT89        225017     179131402
PAT9         153377     78067233
PAT90        161486     40755961
PAT91        548289     10417491
PAT92        499577     9491963
PAT93        509421     32468072
PAT94        211222     45802544
PAT95        257665     203182252
PAT96        387961     140931228
PAT97        39822      44656290
PAT98        361773     186862184
PAT99        415062     154422395
PHG1         8835       216659423
PHG2         4774       223860050
PHG3         5304       216022871
PHG4         7731       237752352
PHG5         4191       223440994
PHG6         676        11727929
PLN1         135582     171495490
PLN10        18946      157439113
PLN100       1          136522531
PLN101       3          383186249
PLN102       2          268356222
PLN103       2          324123174
PLN104       3          363018427
PLN105       27         379124606
PLN106       19         134550855
PLN107       57         390189770
PLN108       11         373036233
PLN109       8          357693623
PLN11        29376      278343654
PLN110       6          351635285
PLN111       12         293471641
PLN112       78         341267500
PLN113       131        317758159
PLN114       130        348798505
PLN115       119        246756089
PLN116       196        355571810
PLN117       127        342881192
PLN118       84         336507251
PLN119       27         386585618
PLN12        2659       334303627
PLN120       23         224588881
PLN121       206        386882773
PLN122       104        391705279
PLN123       89         393080076
PLN124       60         185149855
PLN125       70         357336042
PLN126       146        345660153
PLN127       29         381623792
PLN128       336        344780502
PLN129       28         390546584
PLN13        37         329935405
PLN130       38         333272838
PLN131       5          339540716
PLN132       105        383651865
PLN133       28         73492153
PLN134       37         16871
PLN135       149        79314
PLN136       2469       93786416
PLN137       7181       18795412
PLN138       14346      29953091
PLN139       97566      209240478
PLN14        46         124218893
PLN140       129576     90172129
PLN141       158725     148009227
PLN142       162626     146377525
PLN143       58042      31861686
PLN144       181470     123907525
PLN145       49999      254195750
PLN146       41548      288337301
PLN147       72038      110578193
PLN148       98644      85504671
PLN149       49729      72847341
PLN15        9          366014477
PLN150       25061      110565816
PLN151       13561      89764040
PLN152       1          774434471
PLN153       8305       28494037
PLN154       1861       361385154
PLN155       5          372618381
PLN156       6          372447772
PLN157       6          368295254
PLN158       2          132503639
PLN159       497        311770903
PLN16        2395       340580897
PLN160       8          327823341
PLN161       6          343447962
PLN162       1          66465249
PLN163       1          474651383
PLN164       1          612216829
PLN165       1          571018318
PLN166       1          574020038
PLN167       1          538550714
PLN168       1          514282554
PLN169       1          575541767
PLN17        1949       233857567
PLN170       134        336045988
PLN171       13669      306991053
PLN172       174170     123934992
PLN173       24759      16085638
PLN174       148129     156034040
PLN175       149349     145705196
PLN176       87138      72054259
PLN177       154340     132540843
PLN178       163814     118450407
PLN179       25507      27673604
PLN18        3          330514248
PLN180       148020     133551024
PLN181       126061     157368177
PLN182       167140     121495021
PLN183       116186     120844038
PLN184       134499     149273533
PLN185       102258     121994995
PLN186       135617     149860274
PLN187       126465     162984149
PLN188       120376     166464323
PLN189       20736      18566465
PLN19        37         346663474
PLN190       124150     164031853
PLN191       112748     172543317
PLN192       86183      159125656
PLN193       118827     171973431
PLN194       116535     185658641
PLN195       27472      273791502
PLN196       18922      275056037
PLN197       19737      363518883
PLN198       10232      333664247
PLN199       302        288936846
PLN2         42557      277973111
PLN20        19735      84856634
PLN200       5          324373291
PLN201       1670       369972731
PLN202       1620       2256477
PLN203       1384       387002570
PLN204       8          179149947
PLN205       1282       232633870
PLN206       1          522466905
PLN207       1          675310294
PLN208       1          628753756
PLN209       1          624247919
PLN21        96586      101383894
PLN210       1          599018945
PLN211       1          573247234
PLN212       1          634667502
PLN213       8563       149646365
PLN214       1          727344967
PLN215       1          946003158
PLN216       1          965754312
PLN217       1          906459801
PLN218       1          876148008
PLN219       1          885153844
PLN22        113433     117621155
PLN220       1          899925126
PLN221       1          528437893
PLN222       4156       344360411
PLN223       10         362580157
PLN224       4          120184706
PLN225       129        363593727
PLN226       404        366581476
PLN227       9          335385998
PLN228       130        308977848
PLN229       2          317663561
PLN23        57311      72144580
PLN230       1          192140685
PLN231       1          279860179
PLN232       1          259520967
PLN233       2          294703259
PLN234       1          238633233
PLN235       1          162496318
PLN236       1          420743833
PLN237       206        92200731
PLN238       16         383095167
PLN239       47         120890229
PLN24        28689      28922869
PLN240       1          541700351
PLN241       1          696809892
PLN242       1          655542733
PLN243       1          648987779
PLN244       1          622068216
PLN245       1          583456046
PLN246       1          654005093
PLN247       130        298375
PLN248       1          522466905
PLN249       1          675310294
PLN25        2648       194594881
PLN250       1          628753756
PLN251       1          624247919
PLN252       1          599018945
PLN253       1          573247234
PLN254       1          634667502
PLN255       341        95021966
PLN256       1          521073757
PLN257       1          672273650
PLN258       1          634137895
PLN259       1          624121443
PLN26        344        254550430
PLN260       1          607506942
PLN261       1          564293627
PLN262       1          632401812
PLN263       1          520603772
PLN264       1          661076038
PLN265       1          626572591
PLN266       1          612852138
PLN267       1          598896166
PLN268       1          570629545
PLN269       1          623813090
PLN27        400        261235914
PLN270       1          513014082
PLN271       1          653624577
PLN272       1          616219606
PLN273       1          610044819
PLN274       1          583417444
PLN275       1          550735148
PLN276       1          620104558
PLN277       1          536602846
PLN278       1          671211297
PLN279       1          630677708
PLN28        198        168828441
PLN280       1          623428415
PLN281       1          604298040
PLN282       1          558526623
PLN283       1          628419988
PLN284       1          500012378
PLN285       1          648922534
PLN286       1          604770208
PLN287       1          597403059
PLN288       1          576456374
PLN289       1          556080982
PLN29        298        258873545
PLN290       1          603311816
PLN291       1          512023576
PLN292       1          652551272
PLN293       1          615767531
PLN294       1          605571303
PLN295       1          592249714
PLN296       1          549757368
PLN297       1          616509610
PLN298       1          550024188
PLN299       1          710194481
PLN3         3692       380163478
PLN30        339        265493888
PLN300       1          661081403
PLN301       1          659460550
PLN302       1          630572514
PLN303       1          598618390
PLN304       1          658974642
PLN305       1          559656399
PLN306       1          717517502
PLN307       1          672450454
PLN308       1          665297378
PLN309       1          636785599
PLN31        485        350911896
PLN310       1          599706080
PLN311       1          675658265
PLN312       1          523168208
PLN313       1          495661851
PLN314       1          640830439
PLN315       1          597781253
PLN316       1          600363860
PLN317       1          570178053
PLN318       1          534998810
PLN319       1          616598997
PLN32        112        80604200
PLN320       1          537457279
PLN321       1          685947972
PLN322       1          649921694
PLN323       1          641099225
PLN324       1          611845738
PLN325       1          581041262
PLN326       1          655783664
PLN327       1          521174834
PLN328       1          667717957
PLN329       1          631819663
PLN33        455        379563194
PLN330       1          624692602
PLN331       1          597351075
PLN332       1          561737938
PLN333       1          629651422
PLN334       1          524514255
PLN335       1          670202054
PLN336       1          631946783
PLN337       1          626743494
PLN338       1          600801835
PLN339       1          566971015
PLN34        127        379253996
PLN340       1          629827058
PLN341       1          522114480
PLN342       1          671530377
PLN343       1          631910401
PLN344       1          622474059
PLN345       1          598240357
PLN346       1          562137082
PLN347       1          633805855
PLN348       1          525723083
PLN349       1          684336246
PLN35        91         241350431
PLN350       1          636053469
PLN351       1          629969872
PLN352       1          604087610
PLN353       1          568600391
PLN354       1          640498578
PLN355       1          519546829
PLN356       1          665715246
PLN357       1          624683667
PLN358       1          621078253
PLN359       1          600910593
PLN36        108        325736871
PLN360       1          558953701
PLN361       1          626840912
PLN362       1          543344542
PLN363       1          697540743
PLN364       1          655862368
PLN365       1          646765634
PLN366       1          618540729
PLN367       1          587963859
PLN368       1          658085510
PLN369       446        378685619
PLN37        17         390428741
PLN370       15         312691008
PLN371       20         111531882
PLN372       1          596211899
PLN373       1          705338699
PLN374       1          493450010
PLN375       1          804285258
PLN376       1          810734643
PLN377       1          673981989
PLN378       1          754496630
PLN379       1          855759449
PLN38        246        346776993
PLN380       1          614042580
PLN381       1          743847818
PLN382       1          673340788
PLN383       1          515668560
PLN384       1          713320806
PLN385       1          703598484
PLN386       1          570159854
PLN387       1          625793224
PLN388       1          721110502
PLN389       1          459355444
PLN39        155        383508558
PLN390       1          745201001
PLN391       1          749284433
PLN392       1          643344672
PLN393       1          595297365
PLN394       1          688905267
PLN395       1          491807393
PLN396       1          769338634
PLN397       1          671568023
PLN398       1          635285330
PLN399       1          745618965
PLN4         3520       387673559
PLN40        85         329381794
PLN400       1          839470345
PLN401       1          646400022
PLN402       1          747589525
PLN403       1          665179885
PLN404       1          506585010
PLN405       1          703962928
PLN406       1          702438406
PLN407       1          568126671
PLN408       1          610851963
PLN409       1          707596419
PLN41        15         388403916
PLN410       1          465558328
PLN411       1          734536914
PLN412       1          738743901
PLN413       1          636778132
PLN414       1          602900890
PLN415       1          697493198
PLN416       1          490518203
PLN417       1          784661008
PLN418       1          810500911
PLN419       1          655314739
PLN42        22         360710420
PLN420       1          752710991
PLN421       1          890847171
PLN422       1          621781073
PLN423       1          743084022
PLN424       1          676741658
PLN425       1          509452426
PLN426       1          710124532
PLN427       1          480767623
PLN428       1          578021311
PLN429       1          620140791
PLN43        6          376299569
PLN430       1          716573881
PLN431       1          476726550
PLN432       1          756324664
PLN433       1          977471539
PLN434       1          642207261
PLN435       1          502612092
PLN436       1          646234737
PLN437       1          605172934
PLN438       1          593744788
PLN439       1          571972453
PLN44        1          65870126
PLN440       1          545472572
PLN441       1          607667504
PLN442       1          590561804
PLN443       1          685720839
PLN444       1          490910922
PLN445       1          782694893
PLN446       1          796420183
PLN447       1          650274702
PLN448       1          739889549
PLN449       1          848590828
PLN45        93         388494695
PLN450       1          610626473
PLN451       1          738023571
PLN452       1          667607564
PLN453       1          506274898
PLN454       1          701434008
PLN455       1          690770133
PLN456       1          567265955
PLN457       1          612987783
PLN458       1          704156067
PLN459       1          475327881
PLN46        15         373888800
PLN460       1          732118298
PLN461       1          733931846
PLN462       1          636796232
PLN463       1          599764323
PLN464       1          691313424
PLN465       1          493357854
PLN466       1          782685093
PLN467       1          786410271
PLN468       1          648139033
PLN469       1          744407562
PLN47        9          363551984
PLN470       1          835583350
PLN471       1          623221719
PLN472       1          741299132
PLN473       1          669032550
PLN474       1          517040482
PLN475       1          711661679
PLN476       1          708205786
PLN477       1          573398137
PLN478       1          583494258
PLN479       1          707105489
PLN48        60         374148929
PLN480       1          471251328
PLN481       1          737453356
PLN482       1          736349413
PLN483       1          639162162
PLN484       1          586755746
PLN485       1          704478343
PLN486       1          492109999
PLN487       1          791475352
PLN488       1          785940626
PLN489       1          661246824
PLN49        14         212654302
PLN490       1          756990402
PLN491       1          858776195
PLN492       1          621195942
PLN493       1          754256086
PLN494       1          670301833
PLN495       1          509263899
PLN496       1          708234589
PLN497       1          725120110
PLN498       1          575129590
PLN499       1          620883766
PLN5         97824      210832204
PLN50        74         124609184
PLN500       1          727285804
PLN501       1          479660269
PLN502       1          745978486
PLN503       1          750160716
PLN504       1          642428577
PLN505       1          591313643
PLN506       1          705330581
PLN507       1          495656580
PLN508       1          803232604
PLN509       1          790745243
PLN51        8          358353307
PLN510       1          657494025
PLN511       1          759305888
PLN512       1          856542542
PLN513       1          628321883
PLN514       1          754364263
PLN515       1          697113365
PLN516       1          504254270
PLN517       1          715354979
PLN518       1          713929667
PLN519       1          572943128
PLN52        3          347496433
PLN520       1          626959190
PLN521       1          715714221
PLN522       1          483823121
PLN523       1          742917797
PLN524       1          748536659
PLN525       1          643784981
PLN526       1          600654286
PLN527       1          685083685
PLN528       1          486317123
PLN529       1          794150360
PLN53        4          370651368
PLN530       1          799857935
PLN531       1          655329108
PLN532       1          749763888
PLN533       1          838116175
PLN534       1          610468321
PLN535       1          736551279
PLN536       1          666328382
PLN537       1          504826275
PLN538       1          702606209
PLN539       1          467876140
PLN54        2          271593360
PLN540       1          566465558
PLN541       1          614421429
PLN542       1          698878671
PLN543       1          480431564
PLN544       1          735408736
PLN545       1          969998116
PLN546       1          635024734
PLN547       10         3368
PLN548       1          595339094
PLN549       1          698605642
PLN55        1          150766190
PLN550       1          499102108
PLN551       1          791748890
PLN552       1          797311483
PLN553       1          656817438
PLN554       1          753360318
PLN555       1          845838138
PLN556       1          619661694
PLN557       1          752772853
PLN558       1          689709469
PLN559       1          509595892
PLN56        2          288204953
PLN560       1          712797596
PLN561       1          710493282
PLN562       1          570643040
PLN563       1          619886155
PLN564       1          705533140
PLN565       1          484551304
PLN566       1          740148362
PLN567       1          757233630
PLN568       1          642499559
PLN569       1          594006513
PLN57        2          286787940
PLN570       1          693261537
PLN571       1          492948387
PLN572       1          781462734
PLN573       1          802944975
PLN574       1          650275864
PLN575       1          756841830
PLN576       1          850623622
PLN577       1          614136911
PLN578       1          723255126
PLN579       1          669876730
PLN58        2          295931502
PLN580       1          507533340
PLN581       1          712168462
PLN582       1          712339524
PLN583       1          564869106
PLN584       1          619418949
PLN585       1          715454519
PLN586       1          478264344
PLN587       1          734693445
PLN588       1          749685439
PLN589       1          633598967
PLN59        50         360868274
PLN590       1          782818162
PLN591       1          971920087
PLN592       1          827198496
PLN593       1          867619200
PLN594       1          806566123
PLN595       1          1015700474
PLN596       1          742303966
PLN597       1          956173857
PLN598       1          916702776
PLN599       1          874517040
PLN6         111627     128050695
PLN60        8          373615720
PLN600       1          816294110
PLN601       1          750216944
PLN602       1          862608691
PLN603       20         4493
PLN604       1          445829560
PLN605       1          636117214
PLN606       1          520569408
PLN607       1          614738994
PLN608       1          536175046
PLN609       1          1015700474
PLN61        7          376229618
PLN610       175        140763171
PLN611       1          516505932
PLN612       1          665585731
PLN613       1          621516506
PLN614       1          610333535
PLN615       1          588218686
PLN616       1          561794515
PLN617       1          632540561
PLN618       118        87991
PLN619       1          313789095
PLN62        6          342806685
PLN620       1          248068439
PLN621       1          241454477
PLN622       1          251811976
PLN623       1          225452224
PLN624       1          173806927
PLN625       2          370152128
PLN626       158        374282142
PLN627       603        391598667
PLN628       10         362580157
PLN629       7          281547701
PLN63        6          347730275
PLN630       1          314258027
PLN631       1          394306295
PLN632       1          325599754
PLN633       1          288763641
PLN634       1          187311108
PLN635       1          277174932
PLN636       1          235078182
PLN637       15         332895745
PLN638       16436      36185494
PLN639       5636       1862075
PLN64        6          350661716
PLN640       5224       2478918
PLN641       1          563502314
PLN642       833        298337632
PLN643       1194       92707173
PLN644       1          594102056
PLN645       1          689851870
PLN646       1          495453186
PLN647       1          780798557
PLN648       1          801256715
PLN649       1          651852609
PLN65        43         144640005
PLN650       1          750843639
PLN651       1          830829764
PLN652       1          615552423
PLN653       1          744588157
PLN654       1          673617499
PLN655       1          509857067
PLN656       1          709773743
PLN657       1          713149757
PLN658       1          566080677
PLN659       1          618079260
PLN66        144        326417895
PLN660       1          720988478
PLN661       1          473592718
PLN662       1          736706236
PLN663       1          750620385
PLN664       1          638686055
PLN665       1          480980714
PLN666       6684       330577769
PLN667       3760       370633860
PLN668       10098      326491459
PLN669       1753       12315783
PLN67        7          298887356
PLN670       1          585266722
PLN671       1          681112512
PLN672       1          775448786
PLN673       1          790338525
PLN674       1          746673839
PLN675       1          836514780
PLN676       1          736872137
PLN677       1          676292951
PLN678       1          669155517
PLN679       1          701372996
PLN68        6          332369654
PLN680       1          615672275
PLN681       1          698614761
PLN682       1          728031845
PLN683       1          722970987
PLN684       12302      8480478
PLN685       94678      142079487
PLN686       109051     181616444
PLN687       87378      199428746
PLN688       84004      200885049
PLN689       98890      191059045
PLN69        50         340388796
PLN690       104026     187465134
PLN691       101360     189779385
PLN692       12342      28364774
PLN693       88702      206368579
PLN694       84103      208354693
PLN695       76466      219139335
PLN696       38306      122660126
PLN697       66263      234444963
PLN698       74388      213758374
PLN699       60594      242019644
PLN7         64216      184499719
PLN70        34         333743749
PLN700       66090      231484090
PLN701       60618      237916153
PLN702       42008      215317300
PLN703       61377      236411426
PLN704       53647      244932092
PLN705       52759      245892504
PLN706       47782      270293872
PLN707       22473      92633426
PLN708       59333      247720480
PLN709       85208      212117016
PLN71        1          48961553
PLN710       22280      316696083
PLN711       6          310674098
PLN712       1          528447123
PLN713       1          678170541
PLN714       1          639558213
PLN715       1          629672760
PLN716       1          608467472
PLN717       1          565695744
PLN718       1          634886329
PLN719       1          532083992
PLN72        195        309764478
PLN720       1          684376481
PLN721       1          642597466
PLN722       1          631979072
PLN723       1          607115911
PLN724       1          582960187
PLN725       1          640026769
PLN726       1          608979116
PLN727       1          720972993
PLN728       1          501257520
PLN729       1          804602427
PLN73        6          336790634
PLN730       1          808121247
PLN731       1          649118519
PLN732       1          758906661
PLN733       1          861141126
PLN734       1          642382296
PLN735       1          759893476
PLN736       1          689766370
PLN737       1          531462149
PLN738       1          714517032
PLN739       1          717288350
PLN74        5          336035871
PLN740       1          586345039
PLN741       1          626266972
PLN742       1          738085275
PLN743       1          505809789
PLN744       1          759124079
PLN745       1          751612808
PLN746       1          653055523
PLN747       7          358620060
PLN748       656        177263947
PLN749       1          478410592
PLN75        6          326965702
PLN750       1          530843944
PLN751       1          529541203
PLN752       1          616320322
PLN753       1          560314678
PLN754       1          552570299
PLN755       1          477706438
PLN756       1          464083788
PLN757       1          411577152
PLN758       1          461076154
PLN759       1          463363089
PLN76        5          304407451
PLN760       1          481348281
PLN761       1          411112127
PLN762       1          485809178
PLN763       1          525998845
PLN764       1          469027344
PLN765       1          409103995
PLN766       1          460274876
PLN767       1          476570508
PLN768       1          445971407
PLN769       1          490396672
PLN77        13         303962775
PLN770       1          426632976
PLN771       1          538887009
PLN772       1          574640544
PLN773       1          667652801
PLN774       1          573769737
PLN775       1          579564072
PLN776       1          506557729
PLN777       1          469999753
PLN778       1          516880681
PLN779       1          454437434
PLN78        5          284426683
PLN780       1          415133431
PLN781       1          489887590
PLN782       1          289026301
PLN783       1          490033736
PLN784       1          542991241
PLN785       1          484002173
PLN786       1          527161174
PLN787       1          513237590
PLN788       1          458108957
PLN789       1          448178421
PLN79        8          327303441
PLN790       1          577845554
PLN791       1          529955746
PLN792       1          534821622
PLN793       1          551069265
PLN794       1          588203704
PLN795       1          459891171
PLN796       1          555382095
PLN797       1          455803086
PLN798       1          509477500
PLN799       1          582703961
PLN8         21754      107220939
PLN80        61         76849044
PLN800       1          567151184
PLN801       1          459232789
PLN802       1          577255397
PLN803       1          441736736
PLN804       1          534335728
PLN805       19         2859863
PLN806       1          613662638
PLN807       1          794474755
PLN808       1          760111594
PLN809       1          769810128
PLN81        2          355063454
PLN810       1          715684684
PLN811       1          623890083
PLN812       1          755457679
PLN813       1          717109572
PLN814       1          817712742
PLN815       1          864624966
PLN816       1          701857263
PLN817       1          726425509
PLN818       1          738041677
PLN819       1          767912069
PLN82        1          333667882
PLN820       1          504659958
PLN821       1          662526948
PLN822       1          633282846
PLN823       1          534651777
PLN824       1          584285409
PLN825       1          507261758
PLN826       1          659687352
PLN827       1          224073253
PLN828       1          198628823
PLN829       1          322486422
PLN83        1          302574826
PLN830       1          260047251
PLN831       1          262402055
PLN832       1          330012911
PLN833       1          349800169
PLN834       1          354403191
PLN835       1          317988395
PLN836       1          376468909
PLN837       310        342162756
PLN838       5          315557653
PLN839       17         349824356
PLN84        1          296818136
PLN840       12         384118750
PLN841       59         253167446
PLN842       38         343074766
PLN843       5          325733636
PLN844       389        384262295
PLN845       10         375480087
PLN846       10         379071384
PLN847       9          351388705
PLN848       2          74237962
PLN849       1          472108912
PLN85        1          257455782
PLN850       1          611709054
PLN851       1          571129681
PLN852       1          563957086
PLN853       1          535211053
PLN854       1          496554540
PLN855       1          578502594
PLN856       127        369812239
PLN857       10         389503495
PLN858       10         374804231
PLN859       8          300501703
PLN86        1          252943167
PLN860       10         369372075
PLN861       945        198880512
PLN862       1          593930347
PLN863       1          702775664
PLN864       1          494594617
PLN865       1          792837209
PLN866       1          812232696
PLN867       1          661835603
PLN868       1          750337041
PLN869       1          854463248
PLN87        1          225803546
PLN870       1          623248023
PLN871       1          749950614
PLN872       1          673746810
PLN873       1          520815567
PLN874       1          712547961
PLN875       1          703299309
PLN876       1          569771178
PLN877       1          620176429
PLN878       1          717542863
PLN879       1          493761083
PLN88        1          219123305
PLN880       1          746502734
PLN881       1          752612656
PLN882       1          648661963
PLN883       527        38259571
PLN884       1          540897063
PLN885       1          449127287
PLN886       1          425675180
PLN887       1          463192880
PLN888       1          485323027
PLN889       1          448461343
PLN89        2          394302667
PLN890       1          493511962
PLN891       1          462796039
PLN892       1          589118817
PLN893       1          638425132
PLN894       1          716105986
PLN895       1          613160974
PLN896       1          626220839
PLN897       1          551718542
PLN898       1          484215583
PLN899       1          532103454
PLN9         35208      291130285
PLN90        55         43040327
PLN900       1          480949782
PLN901       1          455353809
PLN902       1          499214392
PLN903       1          298028472
PLN904       1          528225653
PLN905       218        367788603
PLN906       6          375232671
PLN907       66         384851557
PLN908       9          251431714
PLN909       114        156034051
PLN91        15         305289289
PLN910       1          593930347
PLN911       1          702775664
PLN912       1          494594617
PLN913       1          792837209
PLN914       1          812232696
PLN915       1          661835603
PLN916       1          750337041
PLN917       1          854463248
PLN918       1          623248023
PLN919       1          749950614
PLN92        2          286029496
PLN920       1          673746810
PLN921       1          520815567
PLN922       1          712547961
PLN923       1          703299309
PLN924       1          569771178
PLN925       1          620176429
PLN926       1          717542863
PLN927       1          493761083
PLN928       1          746502734
PLN929       1          752612656
PLN93        2          307738366
PLN930       1          648661963
PLN931       51         362271236
PLN932       36776      295872078
PLN94        2          269669619
PLN95        1          157681923
PLN96        40         376080648
PLN97        33         389701062
PLN98        106        384154506
PLN99        56         375854932
PRI1         23047      60053106
PRI10        2265       387936439
PRI11        4375       381717987
PRI12        2068       191950792
PRI13        2459       391017609
PRI14        17343      243216304
PRI15        27929      79132073
PRI16        96050      166265556
PRI17        11025      363947920
PRI18        3741       383223079
PRI19        15303      353911286
PRI2         23840      319341223
PRI20        2239       172855211
PRI21        1          250749103
PRI22        1          238414537
PRI23        2          387789264
PRI24        2          351926207
PRI25        2          301224727
PRI26        2          270924633
PRI27        3          376243325
PRI28        4          374251276
PRI29        5          290585290
PRI3         2613       370370379
PRI30        42298      314450675
PRI31        19023      23601165
PRI32        53141      193817517
PRI33        4          351860731
PRI34        5          337827736
PRI35        3          297245061
PRI36        3          382019003
PRI37        2          285375381
PRI38        2          306826759
PRI39        2          354172067
PRI4         2409       360399901
PRI40        2          394680893
PRI41        1          242696752
PRI42        1          248387328
PRI43        17505      351769399
PRI44        118185     177542819
PRI45        43970      90968403
PRI46        74330      199952244
PRI47        54419      215575485
PRI48        34648      144367010
PRI49        69722      214218466
PRI5         2593       353874487
PRI50        97377      191051772
PRI51        604        234983522
PRI52        1          190673448
PRI53        9368       358512524
PRI54        48774      211104168
PRI55        85269      189487998
PRI56        76971      245845233
PRI57        1141       13813664
PRI6         2112       282951291
PRI7         2729       356953890
PRI8         3181       362167571
PRI9         2423       385530941
ROD1         38455      309602182
ROD10        15052      352238107
ROD100       3          240341385
ROD101       2          368562428
ROD102       2          305746062
ROD103       2          295306346
ROD104       2          279190114
ROD105       1          126990816
ROD106       3          364697793
ROD107       3          342498328
ROD108       4          374582747
ROD109       3          249713888
ROD11        1337       2458540
ROD110       2          330770236
ROD111       2          292927924
ROD112       2          286762350
ROD113       3          381058419
ROD114       3          353678059
ROD115       3          326328631
ROD116       5          331474410
ROD117       2          318539651
ROD118       3          346986554
ROD119       2          195914539
ROD12        22213      347967024
ROD120       3          320471619
ROD121       2          303502892
ROD122       2          280790320
ROD123       3          392932004
ROD124       4          351698734
ROD125       2          379622902
ROD126       2          334811729
ROD127       2          307236712
ROD128       2          287806543
ROD129       3          391762678
ROD13        1002       157743814
ROD130       3          360814732
ROD131       3          314134467
ROD132       4          239932575
ROD133       2          373193903
ROD134       1          157584965
ROD135       2          299783671
ROD136       2          295158694
ROD137       3          388896513
ROD138       3          359745676
ROD139       3          334741362
ROD14        53466      238707384
ROD140       5          333237167
ROD141       2          317726462
ROD142       1          118876157
ROD143       3          341713382
ROD144       4          374029993
ROD145       3          389445867
ROD146       2          291998396
ROD147       2          278095263
ROD148       4          390852856
ROD149       2          370533799
ROD15        21658      310382782
ROD150       2          304047488
ROD151       2          292691026
ROD152       2          276929041
ROD153       3          372795034
ROD154       3          347692711
ROD155       3          308420172
ROD156       4          236625227
ROD157       2          370341452
ROD158       2          307760277
ROD159       2          294424009
ROD16        228312     97108504
ROD160       2          281871870
ROD161       3          372472209
ROD162       3          349207861
ROD163       3          309389500
ROD164       4          238048133
ROD165       1          196977572
ROD166       2          340285783
ROD167       2          310111918
ROD168       2          296020819
ROD169       2          268302591
ROD17        97452      65692303
ROD170       3          367814812
ROD171       3          354083518
ROD172       4          377434897
ROD173       2          58596888
ROD174       2          316597187
ROD175       3          346141334
ROD176       3          309646819
ROD177       3          235883790
ROD178       2          332395505
ROD179       2          297647048
ROD18        39268      249506292
ROD180       2          282771228
ROD181       4          393253035
ROD182       2          311845466
ROD183       3          332317170
ROD184       4          331904146
ROD185       2          328442178
ROD186       2          293393805
ROD187       2          254500766
ROD188       2          275419893
ROD189       2          283469719
ROD19        2          383374219
ROD190       20446      140646180
ROD2         1810       346955540
ROD20        2          353017828
ROD21        2          317259772
ROD22        2          289653994
ROD23        1          140975125
ROD24        3          385591618
ROD25        4          335044383
ROD26        5          356599364
ROD27        2          394024503
ROD28        2          369416674
ROD29        2          335852806
ROD3         1885       351998373
ROD30        2          300392300
ROD31        2          283621167
ROD32        3          348161973
ROD33        5          386542915
ROD34        154        237877425
ROD35        1          193958709
ROD36        2          350925653
ROD37        2          319642044
ROD38        2          276360533
ROD39        3          382322699
ROD4         1944       361078959
ROD40        3          366447402
ROD41        84         245931526
ROD42        2          348668775
ROD43        2          314889876
ROD44        3          389462371
ROD45        3          321351180
ROD46        1          93020901
ROD47        5          385423505
ROD48        6          342729329
ROD49        3          325864489
ROD5         1990       363733749
ROD50        4          358685719
ROD51        4          302148481
ROD52        5          337904903
ROD53        6          385168143
ROD54        6          347801590
ROD55        6          283624907
ROD56        73902      206801652
ROD57        1          203594213
ROD58        2          307631349
ROD59        2          273205312
ROD6         306        57843793
ROD60        2          272523522
ROD61        3          367476852
ROD62        3          318205593
ROD63        5          305035074
ROD64        2          318173246
ROD65        2          308990189
ROD66        2          273361793
ROD67        3          387778067
ROD68        3          350884214
ROD69        4          388911322
ROD7         1975       368354297
ROD70        4          237246301
ROD71        2          368078907
ROD72        2          295232279
ROD73        2          276158786
ROD74        3          370764878
ROD75        3          367374895
ROD76        5          389069045
ROD77        100        129934266
ROD78        3          382537496
ROD79        3          358384401
ROD8         1990       369693686
ROD80        4          394457855
ROD81        4          335356542
ROD82        5          352769932
ROD83        7          374724932
ROD84        2          71105395
ROD85        237        368379137
ROD86        3          380509119
ROD87        3          334938561
ROD88        4          381480552
ROD89        4          322939829
ROD9         1959       368016559
ROD90        6          393612321
ROD91        8          347049583
ROD92        204        393253782
ROD93        3          358453051
ROD94        3          309165069
ROD95        3          235978841
ROD96        2          332670114
ROD97        2          278778348
ROD98        2          267696443
ROD99        2          294192228
STS1         170406     86844690
STS10        202283     61376861
STS11        166964     59441018
STS2         143557     63324415
STS3         8292       4867957
STS4         108725     63673512
STS5         110380     70041358
STS6         106165     81422843
STS7         122522     86626105
STS8         198952     60928403
STS9         8742       2375975
SYN1         54443      100625796
SYN10        2          382762979
SYN11        2          332214168
SYN12        4          386933112
SYN13        1          271050050
SYN14        2          294093621
SYN15        3          329883353
SYN16        4          353920981
SYN17        2          328712085
SYN18        4          357672913
SYN19        1          207870274
SYN2         1          271050050
SYN20        2          382762979
SYN21        2          332214168
SYN22        8          392789107
SYN23        65481      195989301
SYN24        895        34337802
SYN25        9183       352928592
SYN26        17218      334475810
SYN27        109286     160688680
SYN28        33062      98996391
SYN29        13111      253878256
SYN3         2          294093621
SYN4         3          329883353
SYN5         4          353920981
SYN6         1          64242768
SYN7         3          371658272
SYN8         2          250483958
SYN9         1          207870274
TSA1         233360     79647647
TSA10        168600     151858390
TSA100       63252      114802277
TSA101       79841      41351312
TSA102       82721      28609319
TSA103       67721      19747702
TSA104       84021      22863253
TSA105       84236      21912832
TSA106       84446      20981295
TSA107       134042     46621688
TSA108       155667     149676184
TSA109       183730     101083950
TSA11        157771     129836062
TSA110       47348      107503283
TSA111       136867     166252974
TSA112       166495     124901244
TSA113       97423      237859520
TSA114       99257      234633653
TSA115       12708      5978473
TSA116       134189     172362066
TSA117       127781     180160426
TSA118       129595     177105775
TSA119       121186     168272985
TSA12        97052      81339890
TSA120       161588     123667649
TSA121       122311     187541168
TSA122       147961     145186533
TSA123       94592      61300137
TSA124       136202     168455642
TSA125       159235     124954199
TSA126       156460     125810552
TSA127       123500     121448801
TSA13        143853     166186414
TSA14        181432     128521791
TSA15        66295      19907945
TSA16        206960     109167065
TSA17        187358     103732845
TSA18        49536      65564276
TSA19        154726     149575015
TSA2         222146     88664556
TSA20        216942     100225854
TSA21        205832     104153678
TSA22        22790      12573568
TSA23        157963     126705803
TSA24        173176     148502765
TSA25        214525     84394398
TSA26        107410     75720075
TSA27        170538     70805259
TSA28        220418     88915025
TSA29        30772      20942513
TSA3         74968      22652895
TSA30        203801     105213489
TSA31        180385     145699249
TSA32        69536      30839236
TSA33        188098     125939281
TSA34        147088     170906602
TSA35        162182     142830944
TSA36        151018     162390202
TSA37        167242     151938086
TSA38        140834     133825444
TSA39        169992     156589628
TSA4         197157     115804961
TSA40        69588      96746788
TSA41        171877     122235123
TSA42        189649     128251295
TSA43        179093     130001300
TSA44        75703      42972422
TSA45        179829     148956459
TSA46        157580     110411669
TSA47        134660     95403465
TSA48        183454     131877937
TSA49        208660     102956314
TSA5         214836     133894002
TSA50        80586      111968754
TSA51        191615     109275606
TSA52        179744     117175661
TSA53        113718     119372897
TSA54        154655     135706982
TSA55        161499     91796698
TSA56        130858     143914823
TSA57        137645     81544936
TSA58        155441     162401639
TSA59        162402     156498800
TSA6         19260      21470091
TSA60        193155     120620749
TSA61        58920      96756618
TSA62        173904     118336485
TSA63        151844     162145055
TSA64        61002      124261245
TSA65        201330     152320116
TSA66        185417     143496051
TSA67        162494     121036165
TSA68        181441     137352733
TSA69        171437     97550710
TSA7         193297     53192465
TSA70        41533      39009849
TSA71        119065     123313318
TSA72        131964     141438855
TSA73        151655     115933671
TSA74        830        251943
TSA75        153005     102368390
TSA76        156511     143520695
TSA77        40571      33632062
TSA78        176683     138455592
TSA79        161599     158562361
TSA8         156340     122132095
TSA80        11806      9816655
TSA81        185669     115791752
TSA82        143325     147682807
TSA83        177233     144649922
TSA84        158768     177318042
TSA85        18100      12626919
TSA86        168396     128972709
TSA87        156485     150537294
TSA88        194698     125055752
TSA89        32435      22848386
TSA9         101339     69198839
TSA90        196286     138439609
TSA91        112986     113189975
TSA92        98986      206634893
TSA93        87112      229168164
TSA94        77344      247719367
TSA95        30093      107285833
TSA96        141033     144555977
TSA97        106053     76615758
TSA98        74413      65471527
TSA99        33768      32853514
UNA1         713        4436341
VRL1         132485     138722365
VRL10        121315     144549123
VRL100       9648       222178410
VRL101       3076       82037559
VRL102       9353       222055241
VRL103       9841       220243817
VRL104       8848       222045043
VRL105       3578       102453919
VRL106       7672       222715680
VRL107       8710       222261087
VRL108       7550       222027193
VRL109       8140       195083938
VRL11        44160      308097382
VRL110       7469       222617997
VRL111       7903       221826109
VRL112       7741       222036714
VRL113       2133       63568961
VRL114       8175       221662048
VRL115       7696       221489771
VRL116       8476       222490988
VRL117       7663       220769716
VRL118       7753       219681719
VRL119       7369       218154740
VRL12        115637     146239941
VRL120       8126       222226164
VRL121       3826       113718817
VRL122       7552       221475547
VRL123       7476       222844210
VRL124       8324       222918038
VRL125       7424       219915371
VRL126       111        3288907
VRL127       7998       218661185
VRL128       8565       221686607
VRL129       7515       220772416
VRL13        22921      79869993
VRL130       7369       218152755
VRL131       5379       159942155
VRL132       12365      369630589
VRL133       12390      370296038
VRL134       12393      370567303
VRL135       12387      370375745
VRL136       12386      370331608
VRL137       5586       166998492
VRL138       12395      370498538
VRL139       12397      370509766
VRL14        114067     144976362
VRL140       12399      370543631
VRL141       7981       238501730
VRL142       12409      370814633
VRL143       12406      370727292
VRL144       12461      371963252
VRL145       5739       171697397
VRL146       7445       221929148
VRL147       8098       222371013
VRL148       7443       221836966
VRL149       2854       81862602
VRL15        112570     147975040
VRL150       7926       223083603
VRL151       7474       222068598
VRL152       7775       222074426
VRL153       8247       221516934
VRL154       3772       111820163
VRL155       7576       220668740
VRL156       7408       219834983
VRL157       7409       219748918
VRL158       3607       104000459
VRL159       7419       219162748
VRL16        26394      44265018
VRL160       7702       222446879
VRL161       7589       219880714
VRL162       7613       222992769
VRL163       4479       124940763
VRL164       7988       221595603
VRL165       7450       221519699
VRL166       7363       218046615
VRL167       8081       221275642
VRL168       3610       100841225
VRL169       7443       221912979
VRL17        91099      158471151
VRL170       7417       220600930
VRL171       7474       220825954
VRL172       5141       150745617
VRL173       7590       221921438
VRL174       7456       221885732
VRL175       7527       219488322
VRL176       2199       65055580
VRL177       7525       221999735
VRL178       7822       222010194
VRL179       7434       221022261
VRL18        96689      150191725
VRL180       2309       67616828
VRL181       7979       222801932
VRL182       7928       222967607
VRL183       7679       223244139
VRL184       7122       206617622
VRL185       7364       218005430
VRL186       7517       222137200
VRL187       7608       223084933
VRL188       7499       222719287
VRL189       4          119148
VRL19        61017      99771195
VRL190       7447       221890174
VRL191       7658       222226260
VRL192       7456       221343623
VRL193       2557       76263352
VRL194       7600       221963321
VRL195       7387       219036349
VRL196       7528       220390136
VRL197       7498       222863615
VRL198       4400       118487811
VRL199       7556       222786448
VRL2         126360     151555074
VRL20        92387      166034294
VRL200       7621       222147083
VRL201       7587       221961608
VRL202       7709       218274350
VRL203       3896       115442175
VRL204       8125       222364337
VRL205       7493       221703024
VRL206       7659       224375635
VRL207       7740       223122660
VRL208       4194       124843016
VRL209       7457       221711698
VRL21        91156      163933711
VRL210       7617       222842483
VRL211       7490       221796181
VRL212       7386       218502294
VRL213       3958       117903146
VRL214       7562       222084966
VRL215       7910       222159704
VRL216       8146       224314724
VRL217       7897       223360483
VRL218       4051       118039027
VRL219       7654       222035392
VRL22        53958      120920571
VRL220       7518       222596582
VRL221       7401       218081695
VRL222       7780       223097821
VRL223       4166       122053068
VRL224       7958       222550801
VRL225       9717       220006780
VRL226       8230       222458099
VRL227       7443       221608963
VRL228       4130       122342644
VRL229       7432       220668610
VRL23        83162      172791072
VRL230       7525       222545997
VRL231       7789       222727543
VRL232       7441       221791449
VRL233       4085       118638475
VRL234       7679       222800653
VRL235       7665       221964643
VRL236       7702       221975382
VRL237       7399       219983060
VRL238       3803       112886743
VRL239       7439       221699608
VRL24        86001      167270530
VRL240       7530       222221809
VRL241       8136       222778744
VRL242       7664       222807883
VRL243       3870       115121607
VRL244       7572       222990675
VRL245       8659       223131283
VRL246       7410       219931511
VRL247       7431       221513556
VRL248       3871       115393487
VRL249       7428       221230400
VRL25        69448      119013061
VRL250       8354       222650506
VRL251       7596       221440525
VRL252       7516       222186079
VRL253       3917       115476331
VRL254       7688       221167482
VRL255       7394       219525498
VRL256       7757       221575230
VRL257       8150       221675937
VRL258       8014       221516921
VRL259       8594       222127060
VRL26        82968      167639542
VRL260       3981       118569377
VRL261       7471       222005652
VRL262       7470       222505538
VRL263       7407       220280310
VRL264       7571       221805841
VRL265       8038       222110873
VRL266       7492       223066087
VRL267       3567       106308504
VRL268       7473       222123627
VRL269       7812       221230406
VRL27        83299      167287923
VRL270       7558       222699130
VRL271       7813       222506982
VRL272       3666       109302444
VRL273       7422       221795727
VRL274       7497       221157702
VRL275       7504       222677639
VRL276       7458       222126076
VRL277       4584       113772616
VRL278       7457       220488359
VRL279       7480       222072172
VRL28        50295      112134823
VRL280       7521       222701721
VRL281       7454       221808202
VRL282       6162       182671307
VRL283       7465       222365728
VRL284       7454       222179682
VRL285       7471       222279668
VRL286       2449       73009451
VRL287       7503       222467194
VRL288       7603       222614619
VRL289       7511       222974900
VRL29        87643      182924502
VRL290       3351       99894365
VRL291       7416       219085065
VRL292       7642       222040590
VRL293       7451       221663454
VRL294       4616       136360378
VRL295       7407       230879735
VRL296       7432       220654803
VRL297       7679       223107496
VRL298       3968       117552153
VRL299       7874       221797913
VRL3         92348      169356593
VRL30        44984      290672332
VRL300       7389       220132689
VRL301       7444       221791692
VRL302       5510       164098833
VRL303       7474       222088171
VRL304       8079       223310615
VRL305       7440       220453248
VRL306       5722       168946440
VRL307       7510       222610791
VRL308       7563       223474604
VRL309       7486       223092854
VRL31        76991      187344923
VRL310       7419       220617758
VRL311       307        9146007
VRL312       7824       220545213
VRL313       7493       220627405
VRL314       7487       222934268
VRL315       3996       116565387
VRL316       13085      228859909
VRL317       7413       219524326
VRL318       7559       222406688
VRL319       3662       108965596
VRL32        42304      110903711
VRL320       7739       222634754
VRL321       7510       221528610
VRL322       7440       221010145
VRL323       2387       71003500
VRL324       7601       221891346
VRL325       8067       222154829
VRL326       7647       221813271
VRL327       8606       220473868
VRL328       911        27138384
VRL329       7627       221039143
VRL33        67844      182329014
VRL330       7438       219979906
VRL331       7422       220589827
VRL332       6902       201878949
VRL333       20300      210934399
VRL334       7446       221210767
VRL335       8326       219728985
VRL336       7543       218619566
VRL337       7347       218645849
VRL338       7524       222180732
VRL339       7504       221320199
VRL34        77887      185684452
VRL340       8872       222146186
VRL341       1883       56087109
VRL342       8566       221657208
VRL343       7739       222735070
VRL344       7403       219656874
VRL345       2738       80678561
VRL346       7482       220945153
VRL347       7549       220112533
VRL348       7496       220851782
VRL349       6664       197593786
VRL35        66315      157515985
VRL350       7583       222039751
VRL351       7491       221961269
VRL352       7384       218845312
VRL353       3346       97401227
VRL354       7540       222609685
VRL355       7577       222188928
VRL356       7407       220549882
VRL357       5433       158189200
VRL358       7499       222411388
VRL359       7469       221405117
VRL36        75225      192226125
VRL360       7427       220117969
VRL361       8131       219838434
VRL362       2221       66152853
VRL363       8614       218310490
VRL364       7804       221143549
VRL365       7452       221464618
VRL366       7227       214956432
VRL367       7720       220876591
VRL368       7420       220343027
VRL369       7726       221288174
VRL37        83835      171177209
VRL370       7206       216545138
VRL371       9619       219173125
VRL372       7501       222624803
VRL373       7451       221622005
VRL374       4852       121703434
VRL375       7524       219979092
VRL376       7458       222424213
VRL377       7505       222065016
VRL378       3881       112528381
VRL379       7491       222191526
VRL38        71549      144545420
VRL380       7680       221081239
VRL381       7775       221732459
VRL382       3403       99982263
VRL383       7985       221356123
VRL384       8025       221047457
VRL385       7713       220331010
VRL386       4100       120928757
VRL387       7483       224277427
VRL388       7723       222690382
VRL389       7771       222787024
VRL39        78892      176798570
VRL390       3066       84017300
VRL391       8351       220824899
VRL392       7534       223078000
VRL393       7525       222833454
VRL394       2313       68647273
VRL395       8193       222192729
VRL396       7464       223185926
VRL397       7621       223304501
VRL398       3362       99755598
VRL399       7655       222428683
VRL4         11611      55756641
VRL40        69027      181052846
VRL400       7521       222849300
VRL401       7627       222754257
VRL402       2623       78031819
VRL403       8075       223610870
VRL404       7519       223275863
VRL405       7471       221781299
VRL406       5310       156121521
VRL407       7628       222620792
VRL408       7891       222612578
VRL409       7547       223766072
VRL41        45472      196389640
VRL410       2757       81886259
VRL411       7549       223796776
VRL412       8888       219811629
VRL413       7552       222413742
VRL414       3754       103797336
VRL415       7623       221006127
VRL416       7526       223937293
VRL417       7493       221355967
VRL418       3072       89948221
VRL419       11194      218123853
VRL42        18752      133884085
VRL420       7457       221339530
VRL421       7450       220879461
VRL422       5850       170965993
VRL423       8448       222425147
VRL424       7563       224077379
VRL425       7706       221318416
VRL426       4366       128938648
VRL427       7434       220230201
VRL428       7497       222740744
VRL429       7347       218955418
VRL43        24846      218197978
VRL430       5631       164435352
VRL431       7880       221062444
VRL432       7503       222604828
VRL433       7519       219693661
VRL434       7472       221216364
VRL435       1162       34390115
VRL436       7726       222742068
VRL437       7515       223536084
VRL438       7512       224432634
VRL439       2897       85644007
VRL44        15200      218989853
VRL440       7489       221953824
VRL441       7469       220513656
VRL442       7470       223051886
VRL443       7500       222309302
VRL444       1230       36451698
VRL445       8470       224145136
VRL446       9809       219569187
VRL447       7465       223110577
VRL448       6894       204404853
VRL449       7390       221091284
VRL45        34374      207132888
VRL450       7632       220482215
VRL451       7438       220876056
VRL452       7463       221445143
VRL453       6270       187139447
VRL454       12227      365134813
VRL455       12350      369060953
VRL456       6272       187335258
VRL457       1904       56895892
VRL458       12416      370999133
VRL459       12620      376679612
VRL46        9514       125510348
VRL460       12646      377334516
VRL461       6326       188551443
VRL462       12644      377150765
VRL463       12737      379563236
VRL464       12746      379824679
VRL465       6993       208588755
VRL466       12709      378807132
VRL467       12647      377290665
VRL468       12574      375102346
VRL469       4222       125961479
VRL47        18947      217937012
VRL470       12564      374661513
VRL471       12555      374648072
VRL472       12593      375607497
VRL473       3539       105741631
VRL474       12496      373026630
VRL475       12436      371564102
VRL476       12409      370809463
VRL477       6381       190618512
VRL478       12423      371012608
VRL479       12405      370740452
VRL48        25664      213999001
VRL480       12392      370374905
VRL481       3440       102817301
VRL482       12465      372209245
VRL483       12442      371607689
VRL484       12299      368810083
VRL485       2806       83861994
VRL486       3626       108345075
VRL487       12557      374750020
VRL488       12418      371047324
VRL489       12134      362654303
VRL49        16068      218440967
VRL490       3004       89783407
VRL491       12424      371227079
VRL492       12263      366510802
VRL493       12386      370106363
VRL494       11570      345802381
VRL495       12375      369587244
VRL496       12426      370070368
VRL497       12384      370151016
VRL498       3495       104468404
VRL499       12292      367439274
VRL5         94614      149040310
VRL50        10311      153737375
VRL500       12514      373153624
VRL501       12368      369295206
VRL502       8833       264003439
VRL503       12371      369579323
VRL504       12404      370568362
VRL505       12579      375437606
VRL506       12370      369707288
VRL507       6797       203036654
VRL508       12355      369205246
VRL509       12447      371794297
VRL51        13327      220593915
VRL510       12374      369837453
VRL511       12441      371574322
VRL512       1304       38939393
VRL513       12301      367635353
VRL514       12375      369821506
VRL515       12376      369854194
VRL516       9922       296540679
VRL517       12418      371109515
VRL518       12357      369316303
VRL519       12364      369502706
VRL52        10219      219575850
VRL520       8756       261662439
VRL521       12393      370339041
VRL522       12368      369650514
VRL523       12373      369795214
VRL524       6046       180698022
VRL525       12089      361310448
VRL526       11884      355177935
VRL527       12279      366995197
VRL528       7714       230555608
VRL529       12425      371181233
VRL53        10034      221136595
VRL530       12379      369967283
VRL531       12251      366159947
VRL532       7031       210137806
VRL533       12359      369372942
VRL534       12294      367118496
VRL535       12394      370393066
VRL536       7073       210990270
VRL537       12642      376819849
VRL538       12414      370878618
VRL539       12517      373639171
VRL54        5539       122683773
VRL540       7124       212800018
VRL541       12403      370589885
VRL542       12270      366536120
VRL543       12478      372449167
VRL544       7068       211235830
VRL545       12365      369496976
VRL546       12365      369553588
VRL547       12441      370717930
VRL548       6841       204455992
VRL549       12316      368095955
VRL55        8901       223322928
VRL550       12268      366636517
VRL551       12526      373957748
VRL552       12543      374130091
VRL553       2321       69369299
VRL554       12386      370181961
VRL555       12404      370699848
VRL556       12379      369973392
VRL557       12385      370123029
VRL558       1863       55652588
VRL559       12303      367442796
VRL56        9169       221011832
VRL560       12550      374275115
VRL561       12553      374457502
VRL562       12537      374049548
VRL563       2385       71143393
VRL564       12535      374034831
VRL565       12441      371636611
VRL566       12435      371431173
VRL567       2860       85477522
VRL568       12443      371725807
VRL569       12258      366176644
VRL57        8379       222407355
VRL570       12306      367525096
VRL571       3087       92187968
VRL572       12438      371489297
VRL573       12504      373092777
VRL574       12490      372697626
VRL575       3088       92210538
VRL576       12510      373265676
VRL577       12420      370827926
VRL578       12443      371506986
VRL579       12437      371357601
VRL58        9452       221980602
VRL580       3764       112247809
VRL581       12405      370311975
VRL582       12363      369369188
VRL583       12395      370180580
VRL584       6345       189542854
VRL585       12395      370229634
VRL586       12367      369365421
VRL587       12385      369958781
VRL588       12448      371548976
VRL589       7783       232264057
VRL59        3526       80955399
VRL590       12432      371098802
VRL591       12388      370010826
VRL592       12289      367173284
VRL593       9754       291431014
VRL594       12312      367829989
VRL595       12335      368427907
VRL596       12286      367061485
VRL597       12339      368511869
VRL598       12363      369115817
VRL599       12399      370113007
VRL6         87219      144400840
VRL60        9951       221466318
VRL600       3017       90008892
VRL601       12464      371661980
VRL602       12501      372901334
VRL603       12395      370014803
VRL604       12412      370520919
VRL605       12348      368859708
VRL606       11629      347387233
VRL607       12361      369254058
VRL608       12353      368972183
VRL609       12337      368529088
VRL61        13284      217960790
VRL610       12361      369236088
VRL611       9560       285570915
VRL612       12369      369455793
VRL613       12392      370173758
VRL614       12355      369052646
VRL615       12431      371386454
VRL616       1917       57271555
VRL617       12512      372148547
VRL618       12612      376883076
VRL619       12367      369403144
VRL62        8601       220987136
VRL620       12407      370593300
VRL621       12429      371284576
VRL622       7987       238622317
VRL623       12521      374136138
VRL624       12446      371812008
VRL625       12367      369381151
VRL626       12365      369308584
VRL627       8726       260622935
VRL628       12357      369035921
VRL629       12361      369173784
VRL63        10811      219742805
VRL630       12385      369869420
VRL631       12385      369871305
VRL632       505        15080661
VRL633       12406      370440268
VRL634       12395      370127080
VRL635       12404      370388067
VRL636       12390      369989503
VRL637       467        13946387
VRL638       12389      369931542
VRL639       12339      368481167
VRL64        2638       74435425
VRL640       11996      358391372
VRL641       12212      364776539
VRL642       1075       32100221
VRL643       12430      370989262
VRL644       12374      369441369
VRL645       12391      369946377
VRL646       12389      369851260
VRL647       186        5553188
VRL648       12388      369823940
VRL649       12388      369815717
VRL65        7489       220957043
VRL650       12382      369629833
VRL651       5940       177311385
VRL652       12399      370145627
VRL653       12390      369839784
VRL654       12422      370892322
VRL655       12433      371225770
VRL656       1197       35731174
VRL657       12389      369813705
VRL658       12391      369866387
VRL659       12485      372178425
VRL66        7858       222179189
VRL660       12632      376115406
VRL661       1418       42260565
VRL662       12527      373620532
VRL663       12569      375568814
VRL664       12471      372405408
VRL665       4689       140040944
VRL666       12447      371652719
VRL667       12507      373594590
VRL668       12514      373788744
VRL669       4620       138027781
VRL67        9098       219447235
VRL670       12350      368720137
VRL671       12381      369680118
VRL672       12462      372203546
VRL673       4814       143878265
VRL674       12483      372737318
VRL675       12092      360910743
VRL676       11961      356952037
VRL677       5282       157631921
VRL678       12332      368111087
VRL679       12127      361982908
VRL68        18432      213002949
VRL680       11937      355924465
VRL681       5455       161899283
VRL682       12562      372616071
VRL683       12615      376150578
VRL684       12585      375356501
VRL685       4807       142738962
VRL686       12664      377456636
VRL687       12681      377330988
VRL688       12578      375138139
VRL689       4868       145280539
VRL69        2371       66310296
VRL690       12565      374719080
VRL691       12679      376987173
VRL692       12670      377157860
VRL693       12671      376637722
VRL694       12610      375761269
VRL695       5171       154029274
VRL696       12575      374391466
VRL697       12656      376712451
VRL698       12693      377049011
VRL699       9331       278108905
VRL7         93299      144780982
VRL70        7794       220580419
VRL700       12611      375700195
VRL701       12648      377038761
VRL702       12637      376569502
VRL703       2912       86671014
VRL704       12688      377654081
VRL705       12480      372030712
VRL706       12389      369676795
VRL707       7657       228186766
VRL708       12711      377697134
VRL709       12717      378060655
VRL71        7527       221227722
VRL710       12585      375697508
VRL711       34248      166047468
VRL72        8145       220611816
VRL73        6520       180557510
VRL74        7847       221557089
VRL75        8245       220496791
VRL76        8348       219228537
VRL77        6007       158545527
VRL78        12510      218868464
VRL79        7772       219843246
VRL8         130395     141296726
VRL80        8331       221622908
VRL81        4998       142788659
VRL82        7435       220831923
VRL83        7640       222390285
VRL84        7707       222832818
VRL85        733        18781809
VRL86        8386       221949621
VRL87        7745       222155961
VRL88        7421       220931332
VRL89        3105       82761101
VRL9         70182      88351478
VRL90        7745       222259930
VRL91        8815       221941320
VRL92        7730       220789333
VRL93        3130       81544580
VRL94        9239       219107348
VRL95        8107       222032796
VRL96        8291       223112474
VRL97        3919       98460534
VRL98        9661       222623502
VRL99        8979       223164823
VRT1         70048      272421843
VRT10        37396      74041240
VRT100       1          839681426
VRT101       1          825560060
VRT102       1          595904407
VRT103       1          486875112
VRT104       1          387033265
VRT105       1          371528181
VRT106       1          313513962
VRT107       1          277530821
VRT108       1          268302114
VRT109       3          319484498
VRT11        18698      27611025
VRT110       5          386368861
VRT111       7          393936069
VRT112       7          384166854
VRT113       1          46063367
VRT114       7          344525641
VRT115       6          384186008
VRT116       8          388949147
VRT117       332        334400544
VRT118       1          222115097
VRT119       3          377547369
VRT12        5986       380511905
VRT120       10         383496928
VRT121       33         389650655
VRT122       6          59236435
VRT123       1          772932187
VRT124       1          662004353
VRT125       1          535506559
VRT126       1          376147139
VRT127       1          364230008
VRT128       1          346409914
VRT129       1          311292523
VRT13        3363       217068541
VRT130       1          247732340
VRT131       1          228143320
VRT132       1          221182781
VRT133       2          321892640
VRT134       490        332426844
VRT135       12         378048109
VRT136       9          378909870
VRT137       6          345737823
VRT138       2          137693511
VRT139       7          385107928
VRT14        4685       4674270
VRT140       8          360581972
VRT141       10         364952837
VRT142       4          133261911
VRT143       8          359905961
VRT144       5          370674748
VRT145       9          378247816
VRT146       6          166907986
VRT147       14         379842153
VRT148       15         375595384
VRT149       41         289507176
VRT15        1171       26255719
VRT150       11         366984719
VRT151       14         374291772
VRT152       10         185283047
VRT153       1          550518975
VRT154       1          529596002
VRT155       1          413748038
VRT156       1          326378286
VRT157       1          272612222
VRT158       1          260396842
VRT159       1          197956435
VRT16        293        13983146
VRT160       2          384149701
VRT161       2          288058306
VRT162       4          353983664
VRT163       461        371881983
VRT164       2          310725315
VRT165       2          280326572
VRT166       3          371471404
VRT167       3          354148189
VRT168       3          303679844
VRT169       4          341249946
VRT17        37         392789976
VRT170       382        371460784
VRT171       13         392880011
VRT172       13         164097178
VRT173       1          313568160
VRT174       1          289498315
VRT175       1          277254249
VRT176       1          244324502
VRT177       1          233859027
VRT178       1          225974235
VRT179       1          211674833
VRT18        13         392458500
VRT180       1          199962141
VRT181       2          390673241
VRT182       2          334991523
VRT183       2          324316137
VRT184       2          292002398
VRT185       1          133841611
VRT186       3          336899598
VRT187       28         389500106
VRT188       6          332993899
VRT189       6          378599539
VRT19        12         379958897
VRT190       1          47256133
VRT191       6          330076811
VRT192       7          362796652
VRT193       8          365387335
VRT194       20         273534543
VRT195       9          378695651
VRT196       11         392251032
VRT197       205        341394663
VRT198       7          347210350
VRT199       7          370650631
VRT2         72835      271708215
VRT20        11         316368323
VRT200       8          391548385
VRT201       6          385659507
VRT202       7          341110862
VRT203       1          55350661
VRT204       8          387616857
VRT205       3          259325358
VRT206       5          392602723
VRT207       41         394037361
VRT208       3          148003845
VRT209       7          387415360
VRT21        13         385338369
VRT210       7          365756282
VRT211       6          352657526
VRT212       5          346047628
VRT213       2          134650353
VRT214       5          356250620
VRT215       6          374573269
VRT216       6          364137996
VRT217       7          343458516
VRT218       2          121348818
VRT219       7          358240592
VRT22        14         372163844
VRT220       8          383435354
VRT221       8          365970383
VRT222       6          357597984
VRT223       7          355728138
VRT224       8          362648569
VRT225       7          390172982
VRT226       8          391413434
VRT227       8          377681388
VRT228       1          42933508
VRT229       100        376541917
VRT23        14         352781625
VRT230       20         391000381
VRT231       13         383659375
VRT232       58         386123281
VRT233       11         394338841
VRT234       11         274288418
VRT235       1          843366180
VRT236       1          842558404
VRT237       1          707956555
VRT238       1          635713434
VRT239       1          567300182
VRT24        19         384683297
VRT240       1          439630435
VRT241       1          236595445
VRT242       1          231667822
VRT243       2          382351630
VRT244       2          103223822
VRT245       1          690654357
VRT246       1          541439571
VRT247       1          495417988
VRT248       1          481763206
VRT249       1          429350720
VRT25        16         379729070
VRT250       1          224823088
VRT251       1          212589178
VRT252       2          374746477
VRT253       2          318111367
VRT254       32         270969991
VRT255       2          352563619
VRT256       7          386835620
VRT257       4317       352826229
VRT258       19         370712563
VRT259       15984      152794710
VRT26        16         381718727
VRT260       139166     132534060
VRT261       144451     125729568
VRT262       137246     133149836
VRT263       305        1506528
VRT264       131186     138690438
VRT265       51915      213821627
VRT266       4          391475264
VRT267       7          386243041
VRT268       57         363875014
VRT269       3          108352876
VRT27        2          51507477
VRT270       14         376657571
VRT271       16         394062851
VRT272       16         377073984
VRT273       8          278699154
VRT274       13         345916081
VRT275       3          386677656
VRT276       5          363840571
VRT277       25         336198071
VRT278       10         365551181
VRT279       392        383359217
VRT28        6          344600068
VRT280       3          345650541
VRT281       4          347682430
VRT282       8          375481157
VRT283       12         376742698
VRT284       33         366827136
VRT285       11         349043615
VRT286       35         386781479
VRT287       3          345588977
VRT288       4          349532575
VRT289       6          304738240
VRT29        7          384846875
VRT290       7          374752607
VRT291       9          383055365
VRT292       13         380263163
VRT293       17         345428698
VRT294       9          382470915
VRT295       10         392600820
VRT296       9          279911807
VRT297       9          254611438
VRT298       10         239068952
VRT299       14         353408674
VRT3         9030       334822536
VRT30        7          359521465
VRT300       9          362327333
VRT301       12         386562662
VRT302       571        393889072
VRT303       12387      11836391
VRT31        33         269170512
VRT32        147        10842596
VRT33        586        15797052
VRT34        2343       67436863
VRT35        19198      357652178
VRT36        54117      304769938
VRT37        158573     137217609
VRT38        18268      13436272
VRT39        117629     200713630
VRT4         3          141387178
VRT40        84194      68231834
VRT41        2          307292672
VRT42        6          393746332
VRT43        28         308068011
VRT44        156413     129472263
VRT45        39754      26634195
VRT46        185378     123414703
VRT47        149957     106578061
VRT48        168306     113416309
VRT49        8485       7276074
VRT5         8          354279535
VRT50        133023     105741590
VRT51        156291     117907445
VRT52        142139     87371189
VRT53        188438     120029711
VRT54        103319     61435964
VRT55        157393     119300508
VRT56        160057     124818320
VRT57        922        384124704
VRT58        350        387645775
VRT59        1714       380142254
VRT6         11         387350249
VRT60        93605      262107503
VRT61        145106     21008965
VRT62        75789      25336814
VRT63        13375      365641119
VRT64        20         379347618
VRT65        269        392772876
VRT66        3056       391160250
VRT67        3483       231235844
VRT68        6925       378855996
VRT69        16         388667304
VRT7         11         393947221
VRT70        16         378559418
VRT71        12         379509384
VRT72        7          285874095
VRT73        12         387522266
VRT74        18         375242791
VRT75        16         386329687
VRT76        229        277860126
VRT77        17         367327734
VRT78        15         385834222
VRT79        7          149460915
VRT8         30744      333424138
VRT80        1          356776219
VRT81        1          350268637
VRT82        1          316334699
VRT83        1          337490635
VRT84        1          252032905
VRT85        1          217689105
VRT86        1          199443007
VRT87        1          198537509
VRT88        2          368166310
VRT89        2          330550494
VRT9         74952      70629182
VRT90        1          146904662
VRT91        3          319096504
VRT92        7          379783228
VRT93        11         374771935
VRT94        13         379441801
VRT95        3          70710155
VRT96        16         344076996
VRT97        10         385210617
VRT98        15         392781064
VRT99        22         370094349

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 250.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:

Entries        Bases   Species

1942813 215443744183   Triticum aestivum
5570397 165771825746   Severe acute respiratory syndrome coronavirus 2
1347440 101344340096   Hordeum vulgare subsp. vulgare
10034696 30614386913   Mus musculus
27634167 27834633853   Homo sapiens
29682    21127939362   Avena sativa
159413   15517830491   Escherichia coli
25540    11144687122   Klebsiella pneumoniae
1730293  10890148966   Danio rerio
2241841  10650671156   Bos taurus
23098     9981529154   Triticum turgidum subsp. durum
4220011   7412263902   Zea mays
125       6924307246   Avena insularis
21531     6749247504   Secale cereale
2202577   6548854408   Rattus norvegicus
457       5920483689   Aegilops longissima
1471479   5776499164   Canis lupus familiaris
270       5272476906   Aegilops sharonensis
3309630   5179074907   Sus scrofa
54        5178626132   Rhinatrema bivittatum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting. Also note that this table is limited
to 'traditional', non-set-based (WGS/TSA/TLS) GenBank records.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691
   217   Dec 2016   224973060433   198565475
   218   Feb 2017   228719437638   199341377
   219   Apr 2017   231824951552   200877884
   220   Jun 2017   234997362623   201663568
   221   Aug 2017   240343378258   203180606
   222   Oct 2017   244914705468   203953682
   223   Dec 2017   249722163594   206293625
   224   Feb 2018   253630708098   207040555
   225   Apr 2018   260189141631   208452303
   226   Jun 2018   263957884539   209775348
   227   Aug 2018   260806936411   208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
   228   Oct 2018   279668290132   209656636
   229   Dec 2018   285688542186   211281415
   230   Feb 2019   303709510632   212260377
   231   Apr 2019   321680566570   212775414
   232   Jun 2019   329835282370   213383758
   233   Aug 2019   366733917629   213865349
   234   Oct 2019   386197018538   216763706
   235   Dec 2019   388417258009   215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
   236   Feb 2020   399376854872   216214215
   237   Apr 2020   415770027949   216531829
   238   Jun 2020   427823258901   217122233
   239   Aug 2020   654057069549   218642238
   240   Oct 2020   698688094046   219055207
   241   Dec 2020   723003822007   221467827
   242   Feb 2021   776291211106   226241476
   243   Apr 2021   832400799511   227123201
   244   Jun 2021   866009790959   227888889
   245   Aug 2021   940513260726   231982592
   246   Oct 2021  1014763752113   233642893
   247   Dec 2021  1053275115030   234557297
   248   Feb 2022  1173984081721   236338284
   249   Apr 2022  1266154890918   237520318
   250   Jun 2022  1395628631187   239017893
   
  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315
  217    Dec 2016  1817189565845   395301176
  218    Feb 2017  1892966308635   409490397
  219    Apr 2017  2035032639807   451840147
  220    Jun 2017  2164683993369   487891767
  221    Aug 2017  2242294609510   499965722
  222    Oct 2017  2318156361999   508825331
  223    Dec 2017  2466098053327   551063065
  224    Feb 2018  2608532210351   564286852
  225    Apr 2018  2784740996536   621379029
  226    Jun 2018  2944617324086   639804105
  227    Aug 2018  3204855013281   665309765
  228    Oct 2018  3444172142207   722438528
  229    Dec 2018  3656719423096   773773190
  230    Feb 2019  4164513961679   945019312
  231    Apr 2019  4421986382065   993732214
  232    Jun 2019  4847677297950  1022913321
  233    Aug 2019  5585922333160  1075272215
  234    Oct 2019  5985250251028  1097629174
  235    Dec 2019  6277551200690  1127023870
  236    Feb 2020  6968991265752  1206720688
  237    Apr 2020  7788133221338  1267547429
  238    Jun 2020  8114046262158  1302852615
  239    Aug 2020  8841649410652  1408122887
  240    Oct 2020  9215815569509  1432874252
  241    Dec 2020 11830842428018  1517995689
  242    Feb 2021 12270717209612  1563938043
  243    Apr 2021 12732048052023  1590670459
  244    Jun 2021 13442974346437  1632796606
  245    Aug 2021 13888187863722  1653427055
  246    Oct 2021 14599101574547  1721064101
  247    Dec 2021 14922033922302  1734664952
  248    Feb 2022 15428122140820  1750505007
  249    Apr 2022 16071520702170  1781374217
  250    Jun 2022 16710373006600  1796349114

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597
  217    Dec 2016   125328824508   142094337
  218    Feb 2017   133517212104   151431485
  219    Apr 2017   149038907599   165068542
  220    Jun 2017   158112969073   176812130
  221    Aug 2017   167045663417   186777106
  222    Oct 2017   172909268535   192754804
  223    Dec 2017   181394660188   201559502
  224    Feb 2018   193940551226   214324264
  225    Apr 2018   205232396043   227364990
  226    Jun 2018   216556686631   238788334
  227    Aug 2018   225520004678   249295386
  228    Oct 2018   235875573598   259927414
  229    Dec 2018   248592892188   274845473
  230    Feb 2019   263936885705   294772430
  231    Apr 2019   277118019688   311247136
  232    Jun 2019   285390240861   319927264
  233    Aug 2019   294727165179   331347807
  234    Oct 2019   305371891408   342811151
  235    Dec 2019   325433016129   367193844
  236    Feb 2020   340994289065   386644871
  237    Apr 2020   349692751528   396392280
  238    Jun 2020   359947709062   409725050
  239    Aug 2020   366968951160   417524567
  240    Oct 2020   382996662270   435968379
  241    Dec 2020   392206975386   446397378
  242    Feb 2021   407605409948   463151000
  243    Apr 2021   425076483459   481154920
  244    Jun 2021   436594941165   494641358
  245    Aug 2021   440578422611   498305045
  246    Oct 2021   449891016597   508319391
  247    Dec 2021   455870853358   514158576
  248    Feb 2022   465013156502   524464601
  249    Apr 2022   474421076448   534770586
  250    Jun 2022   485056129761   546991572

  The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.

  Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
	  ftp://ftp.ncbi.nih.gov/genbank/tls

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  217    Dec 2016      584697919     1268690
  218    Feb 2017      636923295     1438349
  219    Apr 2017      636923295     1438349  (unchanged)
  220    Jun 2017      824191338     1628475
  221    Aug 2017      824191338     1628475  (unchanged)
  222    Oct 2017     2993818315     9479460
  223    Dec 2017     4458042616    12695198
  224    Feb 2018     4531966831    12819978
  225    Apr 2018     5612769448    14782654
  226    Jun 2018     5896511468    15393041
  227    Aug 2018     6077824493    15822538
  228    Oct 2018     8435112913    20752288
  229    Dec 2018     8511829281    20924588
  230    Feb 2019     9146836085    23259929
  231    Apr 2019     9623321565    24240761
  232    Jun 2019    10182427815    25530139
  233    Aug 2019    10531800829    26363945
  234    Oct 2019    10848455369    27460978
  235    Dec 2019    11280596614    28227180
  236    Feb 2020    13669678196    34037371
  237    Apr 2020    24615270313    65521132
  238    Jun 2020    27500635128    75063181
  239    Aug 2020    27825059498    75682157
  240    Oct 2020    28814798868    78177358
  241    Dec 2020    33036509446    88039152
  242    Feb 2021    33634122995    90130561
  243    Apr 2021    37998534461   102395753
  244    Jun 2021    38198113354   102662929
  245    Aug 2021    39930167315   106995218
  246    Oct 2021    40168874815   107569935
  247    Dec 2021    41143480750   109379021
  248    Feb 2022    41321107981   109809966
  249    Apr 2022    41324192343   109820387
  250    Jun 2022    41999358847   111142107

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          June 15 2022

                NCBI-GenBank Flat File Release 250.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

  NOTE : Presentation of GI sequence identifiers in the GenBank
  flatfile format was discontinued as of March 2017.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, possibly 'LINEAGE'. But because changes like this can be
   very disruptive for customers, implementation has not yet been scheduled.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

3.4.4.1 : Important notice about parsing the LOCUS line

  Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.

  Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.

  Consider this LOCUS line for a typical complete bacterial genome:

LOCUS       CP032762             5868661 bp    DNA     circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:

LOCUS       AZZZAA02123456789 9999999999 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:

LOCUS       AZZZAA0212345678910000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:

LOCUS       AZZZAA02123456789 10000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.

3.4.4.2 : Data elements of the LOCUS line

  The data elements of the LOCUS line format and their typical/historical
column positions are as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus Name (usually identical to the Accession Number)
29-29      space
30-40      Sequence Length, right-justified
41-41      space
42-43      'bp'
44-44      space
45-47      Strandedness : spaces (if not known), ss- (single-stranded),
           ds- (double-stranded), or ms- (mixed-stranded)
48-53      Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      Molecule Topology : 'linear' followed by two spaces,
           or 'circular'
64-64      space
65-67      Division Code
68-68      space
69-79      Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.

  The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :

LOCUS       HUMPDNRC                 273 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S125 polymorphic dinucleotide repeat.
ACCESSION   L10620

LOCUS       HUMPDNRG                 169 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S114 polymorphic dinucleotide repeat.
ACCESSION   L10624

  But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:

LOCUS       AF035771                1357 bp    mRNA    linear   PRI 30-JUN-1998
DEFINITION  Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
            complete cds.
ACCESSION   AF035771
	    
  The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1
            ^^^^^^^^^^
            Compound  
            Accession.Version
            Number

  A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.

  GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://www.ncbi.nlm.nih.gov/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://www.ncbi.nlm.nih.gov/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://www.ncbi.nlm.nih.gov/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://www.ncbi.nlm.nih.gov/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:

	http://www.insdc.org/documents/feature-table

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.2

3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

  The list of valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.3

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, as of June 2022 the `/exception' qualifier has only four
allowed values: 'RNA editing', 'reasons given in citation', 'rearrangement
required for product', and 'annotated by transcript or proteomic data'.
These are known as controlled vocabulary qualifier values. Controlled
qualifier values are case sensitive.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       KZ271580              141308 bp    DNA     linear   CON 17-AUG-2017
DEFINITION  Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
            O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION   KZ271580 LQNL01000000
VERSION     KZ271580.1
DBLINK      BioProject: PRJNA230512
            BioSample: SAMN04226856
KEYWORDS    WGS; HIGH_QUALITY_DRAFT.
...
     mRNA            complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /product="hypothetical protein"
     CDS             complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="OZC04795.1"
                     /db_xref="GI:1233056989"
                     /translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
                     SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
                     ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
                     TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
                     LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
                     HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
                     LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
                     IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
                     YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
                     AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
                     IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG      join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
            gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Scaffold/CON-division join() sequence


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              [email protected]

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.

  The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address: [email protected] .

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

   Sayers E, Cavanaugh M, Clark K, Ostell J, Pruitt K,
   Karsch-Mizrachi I, "GenBank", Nucleic Acids Research,
   Volume 47, Issue D1, January 2019, pp. D94-D99

   PMID:  30365038
   PMCID: PMC6323954
   DOI:   10.1093/nar/gky989

  The following statement is an example of how one might cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'

  (1) Sayers, E. et al, Nucleic Acids Res. 47(D1):D94-D99 (2019)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: Simply direct your web browser of choice to:

	 http://www.ncbi.nlm.nih.gov/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] .

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Genome Workbench can be used to submit revisions to
previous submissions.  In addition, suggestions and corrections can
be sent by electronic mail to:  [email protected].  Please be
certain to indicate the primary accession number of the entry to which
your comments apply; it is helpful if you also give the entry name and
the current contents of any data field for which you are recommending
a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Andreina Castillo Siri, Larry Chlumsky, Karen Clark,
	Scott Durkin, Francescopaolo di Cello, Michel Eschenbrenner,
	Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston,
	Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Augustus Tilley,
	Beverly Underwood, Simone Walker and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
	Sergiy Gotvyanskyy, Eugene Gribov, Sergei Kalashnikov, Jonathan Kans,
	Leonid Khotomliansky, Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh,
	Alex Kotliarov, Frank Ludwig, Vasuki Palanigobu, Anton Perkov,
	Andriy Petrow, Sergey Petrunin, Wenyao Shi, Denis Sinyakov,
	Thomas Smith, Vladimir Soussov, Vitaly Stakhovsky, Elena Starchenko,
	Hanzhen Sun, Andrei Vereshchagin, Jewen Xiao, Eugene Yaschenko, Liwei Zhou

Database Administration
	Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
	Benjamin Slade, Constantin Vasilyev

Customer Support
	David Brodsky, Hanguan Liu, Cooper Park, Monica Romiti, Eric Sayers,
	Majda Valjavec-Gratian

Project Direction
	Steve Sherry : Acting Director, NCBI
	Kim Pruitt   : Branch Chief, NCBI/IEB

Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894