Release Notes For GenBank Release 255
GBREL.TXT Genetic Sequence Data Bank
April 15 2023
NCBI-GenBank Flat File Release 255.0
Distribution Release Notes
242554936 sequences, 1826746318813 bases, for traditional GenBank records
3239989818 sequences, 21609364043281 bases, for set-based (WGS/TSA/TLS) records
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 255.0
1.2 Cutoff Date
1.3 Important Changes in Release 255.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 255.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use Submission Portal or BankIt for
sending sequence data.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
Email: [email protected]
Updates and changes to existing GenBank records:
https://www.ncbi.nlm.nih.gov/genbank/update/
Email: [email protected]
URLs for GenBank's web-based submission tools:
Submission Portal https://submit.ncbi.nlm.nih.gov/
BankIt https://www.ncbi.nlm.nih.gov/WebSub/
See Section 1.5 for additional details about submitting data to GenBank.
*****************************************************************************
GenBank Release 255.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:
ftp://ftp.ncbi.nih.gov/genbank/wgs
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/tsa
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tls
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
See the README files in those areas for more information.
Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:
ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.
1.2 Cutoff Date
This full release, 255.0, incorporates data processed by the INSDC databases
as of Wednesday April 12 at 10:23PM EDT. For more recent data, users are
advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotide' database (see Section 6.4 of this document).
1.3 Important Changes in Release 255.0
1.3.1 Organizational changes
The total number of sequence data files increased by 301 with this release:
- the BCT division is now composed of 937 files (+30)
- the ENV division is now composed of 77 files (+1)
- the INV division is now composed of 1380 files (+136)
- the MAM division is now composed of 166 files (+16)
- the PAT division is now composed of 252 files (+1)
- the PLN division is now composed of 1114 files (+14)
- the ROD division is now composed of 300 files (+61)
- the VRL division is now composed of 886 files (+22)
- the VRT division is now composed of 357 files (+20)
1.4 Upcoming Changes
1.4.1 New allowed values for the /country and /collection_date qualifiers
The INSDC will begin to mandate inclusion of /country and /collection_date
for sequence submissions, in alignment with its goal of increasing the number
of sequences for which the origin of a sample can be precisely located in
time and space. This requirement is expected to take effect by the end of
December 2024, and further details can be found at:
https://www.insdc.org/news/insdc-spatiotemporal-metadata-minimum-standards-update-03-03-2023/
Because there are valid circumstances in which the country and/or the
collection date for a sequenced sample cannot be provided, the domain
of allowed values for these two source-feature qualifiers will be expanded
to include a variety of "null terms". They are:
missing
not applicable
not collected
not provided
restricted access
missing: control sample
missing: sample group
missing: synthetic construct
missing: lab stock
missing: third party data
missing: data agreement established pre-2023
missing: endangered species
missing: human-identifiable
The timing for introducing these new values is still uncertain, but the
earliest possible date for their appearance is June 15 2023.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank utilizing the tools summarized below.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. General
information for submitting to Genbank is available online:
https://www.ncbi.nlm.nih.gov/genbank/submit/
To assist researchers in entering their own sequence data, GenBank
provides Web-based submission tools: Submission Portal and Bankit.
Submission Portal https://submit.ncbi.nlm.nih.gov/
BankIt https://www.ncbi.nlm.nih.gov/WebSub/
Submission Portal provides an efficient submission pathway for high
frequency submission types (e.g., 16S rRNA, rRNA-ITS, metazoan COX1,
SARS-CoV-2, etc.).
BankIt is an easy-to-use program that enables authors to enter one
or more sequences, annotate, and submit to GenBank. BankIt provides
a simple forms-based approach for submitting your sequence and the
relevant associated metadata to GenBank.
Genbank also provides submission preparation tools which require uploading
via the Submission Portal or email to [email protected] when relevant:
table2asn: https://www.ncbi.nlm.nih.gov/genbank/table2asn/
table2asn is a command-line program that automates the creation of sequence
records for submission to GenBank. It is used primarily for submission of
complete genomes and large batches of sequences and is available by FTP
for use on MAC, PC and Unix platforms:
https://ftp.ncbi.nlm.nih.gov/asn1-converters/by_program/table2asn/
Genome Workbench offers a rich set of integrated tools for studying
and analyzing genetic data. The Submission Wizard allows you to prepare
submissions of single eukaryotic and prokaryotic genomes. You can also
use Genome Workbench to edit and visualize an ASN.1 file created by table2asn.
Genome Workbench: https://www.ncbi.nlm.nih.gov/tools/gbench/
Through the international collaboration of DNA sequence databases,
GenBank submissions are forwarded daily for inclusion in the European
Nucleotide Archive (ENA) and the DNA Databank of Japan (DDBJ).
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
SEQUIN. As of January 2021, Sequin sequence submissions are no longer
accepted by GenBank, and the Sequin application is no longer distributed
by NCBI. See: https://ncbiinsights.ncbi.nlm.nih.gov/tag/sequin/
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] .
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.
2.2 Files
This GenBank flat file release consists of 6877 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct395.seq - Bacterial sequence entries, part 395.
330. gbbct396.seq - Bacterial sequence entries, part 396.
331. gbbct397.seq - Bacterial sequence entries, part 397.
332. gbbct398.seq - Bacterial sequence entries, part 398.
333. gbbct399.seq - Bacterial sequence entries, part 399.
334. gbbct4.seq - Bacterial sequence entries, part 4.
335. gbbct40.seq - Bacterial sequence entries, part 40.
336. gbbct400.seq - Bacterial sequence entries, part 400.
337. gbbct401.seq - Bacterial sequence entries, part 401.
338. gbbct402.seq - Bacterial sequence entries, part 402.
339. gbbct403.seq - Bacterial sequence entries, part 403.
340. gbbct404.seq - Bacterial sequence entries, part 404.
341. gbbct405.seq - Bacterial sequence entries, part 405.
342. gbbct406.seq - Bacterial sequence entries, part 406.
343. gbbct407.seq - Bacterial sequence entries, part 407.
344. gbbct408.seq - Bacterial sequence entries, part 408.
345. gbbct409.seq - Bacterial sequence entries, part 409.
346. gbbct41.seq - Bacterial sequence entries, part 41.
347. gbbct410.seq - Bacterial sequence entries, part 410.
348. gbbct411.seq - Bacterial sequence entries, part 411.
349. gbbct412.seq - Bacterial sequence entries, part 412.
350. gbbct413.seq - Bacterial sequence entries, part 413.
351. gbbct414.seq - Bacterial sequence entries, part 414.
352. gbbct415.seq - Bacterial sequence entries, part 415.
353. gbbct416.seq - Bacterial sequence entries, part 416.
354. gbbct417.seq - Bacterial sequence entries, part 417.
355. gbbct418.seq - Bacterial sequence entries, part 418.
356. gbbct419.seq - Bacterial sequence entries, part 419.
357. gbbct42.seq - Bacterial sequence entries, part 42.
358. gbbct420.seq - Bacterial sequence entries, part 420.
359. gbbct421.seq - Bacterial sequence entries, part 421.
360. gbbct422.seq - Bacterial sequence entries, part 422.
361. gbbct423.seq - Bacterial sequence entries, part 423.
362. gbbct424.seq - Bacterial sequence entries, part 424.
363. gbbct425.seq - Bacterial sequence entries, part 425.
364. gbbct426.seq - Bacterial sequence entries, part 426.
365. gbbct427.seq - Bacterial sequence entries, part 427.
366. gbbct428.seq - Bacterial sequence entries, part 428.
367. gbbct429.seq - Bacterial sequence entries, part 429.
368. gbbct43.seq - Bacterial sequence entries, part 43.
369. gbbct430.seq - Bacterial sequence entries, part 430.
370. gbbct431.seq - Bacterial sequence entries, part 431.
371. gbbct432.seq - Bacterial sequence entries, part 432.
372. gbbct433.seq - Bacterial sequence entries, part 433.
373. gbbct434.seq - Bacterial sequence entries, part 434.
374. gbbct435.seq - Bacterial sequence entries, part 435.
375. gbbct436.seq - Bacterial sequence entries, part 436.
376. gbbct437.seq - Bacterial sequence entries, part 437.
377. gbbct438.seq - Bacterial sequence entries, part 438.
378. gbbct439.seq - Bacterial sequence entries, part 439.
379. gbbct44.seq - Bacterial sequence entries, part 44.
380. gbbct440.seq - Bacterial sequence entries, part 440.
381. gbbct441.seq - Bacterial sequence entries, part 441.
382. gbbct442.seq - Bacterial sequence entries, part 442.
383. gbbct443.seq - Bacterial sequence entries, part 443.
384. gbbct444.seq - Bacterial sequence entries, part 444.
385. gbbct445.seq - Bacterial sequence entries, part 445.
386. gbbct446.seq - Bacterial sequence entries, part 446.
387. gbbct447.seq - Bacterial sequence entries, part 447.
388. gbbct448.seq - Bacterial sequence entries, part 448.
389. gbbct449.seq - Bacterial sequence entries, part 449.
390. gbbct45.seq - Bacterial sequence entries, part 45.
391. gbbct450.seq - Bacterial sequence entries, part 450.
392. gbbct451.seq - Bacterial sequence entries, part 451.
393. gbbct452.seq - Bacterial sequence entries, part 452.
394. gbbct453.seq - Bacterial sequence entries, part 453.
395. gbbct454.seq - Bacterial sequence entries, part 454.
396. gbbct455.seq - Bacterial sequence entries, part 455.
397. gbbct456.seq - Bacterial sequence entries, part 456.
398. gbbct457.seq - Bacterial sequence entries, part 457.
399. gbbct458.seq - Bacterial sequence entries, part 458.
400. gbbct459.seq - Bacterial sequence entries, part 459.
401. gbbct46.seq - Bacterial sequence entries, part 46.
402. gbbct460.seq - Bacterial sequence entries, part 460.
403. gbbct461.seq - Bacterial sequence entries, part 461.
404. gbbct462.seq - Bacterial sequence entries, part 462.
405. gbbct463.seq - Bacterial sequence entries, part 463.
406. gbbct464.seq - Bacterial sequence entries, part 464.
407. gbbct465.seq - Bacterial sequence entries, part 465.
408. gbbct466.seq - Bacterial sequence entries, part 466.
409. gbbct467.seq - Bacterial sequence entries, part 467.
410. gbbct468.seq - Bacterial sequence entries, part 468.
411. gbbct469.seq - Bacterial sequence entries, part 469.
412. gbbct47.seq - Bacterial sequence entries, part 47.
413. gbbct470.seq - Bacterial sequence entries, part 470.
414. gbbct471.seq - Bacterial sequence entries, part 471.
415. gbbct472.seq - Bacterial sequence entries, part 472.
416. gbbct473.seq - Bacterial sequence entries, part 473.
417. gbbct474.seq - Bacterial sequence entries, part 474.
418. gbbct475.seq - Bacterial sequence entries, part 475.
419. gbbct476.seq - Bacterial sequence entries, part 476.
420. gbbct477.seq - Bacterial sequence entries, part 477.
421. gbbct478.seq - Bacterial sequence entries, part 478.
422. gbbct479.seq - Bacterial sequence entries, part 479.
423. gbbct48.seq - Bacterial sequence entries, part 48.
424. gbbct480.seq - Bacterial sequence entries, part 480.
425. gbbct481.seq - Bacterial sequence entries, part 481.
426. gbbct482.seq - Bacterial sequence entries, part 482.
427. gbbct483.seq - Bacterial sequence entries, part 483.
428. gbbct484.seq - Bacterial sequence entries, part 484.
429. gbbct485.seq - Bacterial sequence entries, part 485.
430. gbbct486.seq - Bacterial sequence entries, part 486.
431. gbbct487.seq - Bacterial sequence entries, part 487.
432. gbbct488.seq - Bacterial sequence entries, part 488.
433. gbbct489.seq - Bacterial sequence entries, part 489.
434. gbbct49.seq - Bacterial sequence entries, part 49.
435. gbbct490.seq - Bacterial sequence entries, part 490.
436. gbbct491.seq - Bacterial sequence entries, part 491.
437. gbbct492.seq - Bacterial sequence entries, part 492.
438. gbbct493.seq - Bacterial sequence entries, part 493.
439. gbbct494.seq - Bacterial sequence entries, part 494.
440. gbbct495.seq - Bacterial sequence entries, part 495.
441. gbbct496.seq - Bacterial sequence entries, part 496.
442. gbbct497.seq - Bacterial sequence entries, part 497.
443. gbbct498.seq - Bacterial sequence entries, part 498.
444. gbbct499.seq - Bacterial sequence entries, part 499.
445. gbbct5.seq - Bacterial sequence entries, part 5.
446. gbbct50.seq - Bacterial sequence entries, part 50.
447. gbbct500.seq - Bacterial sequence entries, part 500.
448. gbbct501.seq - Bacterial sequence entries, part 501.
449. gbbct502.seq - Bacterial sequence entries, part 502.
450. gbbct503.seq - Bacterial sequence entries, part 503.
451. gbbct504.seq - Bacterial sequence entries, part 504.
452. gbbct505.seq - Bacterial sequence entries, part 505.
453. gbbct506.seq - Bacterial sequence entries, part 506.
454. gbbct507.seq - Bacterial sequence entries, part 507.
455. gbbct508.seq - Bacterial sequence entries, part 508.
456. gbbct509.seq - Bacterial sequence entries, part 509.
457. gbbct51.seq - Bacterial sequence entries, part 51.
458. gbbct510.seq - Bacterial sequence entries, part 510.
459. gbbct511.seq - Bacterial sequence entries, part 511.
460. gbbct512.seq - Bacterial sequence entries, part 512.
461. gbbct513.seq - Bacterial sequence entries, part 513.
462. gbbct514.seq - Bacterial sequence entries, part 514.
463. gbbct515.seq - Bacterial sequence entries, part 515.
464. gbbct516.seq - Bacterial sequence entries, part 516.
465. gbbct517.seq - Bacterial sequence entries, part 517.
466. gbbct518.seq - Bacterial sequence entries, part 518.
467. gbbct519.seq - Bacterial sequence entries, part 519.
468. gbbct52.seq - Bacterial sequence entries, part 52.
469. gbbct520.seq - Bacterial sequence entries, part 520.
470. gbbct521.seq - Bacterial sequence entries, part 521.
471. gbbct522.seq - Bacterial sequence entries, part 522.
472. gbbct523.seq - Bacterial sequence entries, part 523.
473. gbbct524.seq - Bacterial sequence entries, part 524.
474. gbbct525.seq - Bacterial sequence entries, part 525.
475. gbbct526.seq - Bacterial sequence entries, part 526.
476. gbbct527.seq - Bacterial sequence entries, part 527.
477. gbbct528.seq - Bacterial sequence entries, part 528.
478. gbbct529.seq - Bacterial sequence entries, part 529.
479. gbbct53.seq - Bacterial sequence entries, part 53.
480. gbbct530.seq - Bacterial sequence entries, part 530.
481. gbbct531.seq - Bacterial sequence entries, part 531.
482. gbbct532.seq - Bacterial sequence entries, part 532.
483. gbbct533.seq - Bacterial sequence entries, part 533.
484. gbbct534.seq - Bacterial sequence entries, part 534.
485. gbbct535.seq - Bacterial sequence entries, part 535.
486. gbbct536.seq - Bacterial sequence entries, part 536.
487. gbbct537.seq - Bacterial sequence entries, part 537.
488. gbbct538.seq - Bacterial sequence entries, part 538.
489. gbbct539.seq - Bacterial sequence entries, part 539.
490. gbbct54.seq - Bacterial sequence entries, part 54.
491. gbbct540.seq - Bacterial sequence entries, part 540.
492. gbbct541.seq - Bacterial sequence entries, part 541.
493. gbbct542.seq - Bacterial sequence entries, part 542.
494. gbbct543.seq - Bacterial sequence entries, part 543.
495. gbbct544.seq - Bacterial sequence entries, part 544.
496. gbbct545.seq - Bacterial sequence entries, part 545.
497. gbbct546.seq - Bacterial sequence entries, part 546.
498. gbbct547.seq - Bacterial sequence entries, part 547.
499. gbbct548.seq - Bacterial sequence entries, part 548.
500. gbbct549.seq - Bacterial sequence entries, part 549.
501. gbbct55.seq - Bacterial sequence entries, part 55.
502. gbbct550.seq - Bacterial sequence entries, part 550.
503. gbbct551.seq - Bacterial sequence entries, part 551.
504. gbbct552.seq - Bacterial sequence entries, part 552.
505. gbbct553.seq - Bacterial sequence entries, part 553.
506. gbbct554.seq - Bacterial sequence entries, part 554.
507. gbbct555.seq - Bacterial sequence entries, part 555.
508. gbbct556.seq - Bacterial sequence entries, part 556.
509. gbbct557.seq - Bacterial sequence entries, part 557.
510. gbbct558.seq - Bacterial sequence entries, part 558.
511. gbbct559.seq - Bacterial sequence entries, part 559.
512. gbbct56.seq - Bacterial sequence entries, part 56.
513. gbbct560.seq - Bacterial sequence entries, part 560.
514. gbbct561.seq - Bacterial sequence entries, part 561.
515. gbbct562.seq - Bacterial sequence entries, part 562.
516. gbbct563.seq - Bacterial sequence entries, part 563.
517. gbbct564.seq - Bacterial sequence entries, part 564.
518. gbbct565.seq - Bacterial sequence entries, part 565.
519. gbbct566.seq - Bacterial sequence entries, part 566.
520. gbbct567.seq - Bacterial sequence entries, part 567.
521. gbbct568.seq - Bacterial sequence entries, part 568.
522. gbbct569.seq - Bacterial sequence entries, part 569.
523. gbbct57.seq - Bacterial sequence entries, part 57.
524. gbbct570.seq - Bacterial sequence entries, part 570.
525. gbbct571.seq - Bacterial sequence entries, part 571.
526. gbbct572.seq - Bacterial sequence entries, part 572.
527. gbbct573.seq - Bacterial sequence entries, part 573.
528. gbbct574.seq - Bacterial sequence entries, part 574.
529. gbbct575.seq - Bacterial sequence entries, part 575.
530. gbbct576.seq - Bacterial sequence entries, part 576.
531. gbbct577.seq - Bacterial sequence entries, part 577.
532. gbbct578.seq - Bacterial sequence entries, part 578.
533. gbbct579.seq - Bacterial sequence entries, part 579.
534. gbbct58.seq - Bacterial sequence entries, part 58.
535. gbbct580.seq - Bacterial sequence entries, part 580.
536. gbbct581.seq - Bacterial sequence entries, part 581.
537. gbbct582.seq - Bacterial sequence entries, part 582.
538. gbbct583.seq - Bacterial sequence entries, part 583.
539. gbbct584.seq - Bacterial sequence entries, part 584.
540. gbbct585.seq - Bacterial sequence entries, part 585.
541. gbbct586.seq - Bacterial sequence entries, part 586.
542. gbbct587.seq - Bacterial sequence entries, part 587.
543. gbbct588.seq - Bacterial sequence entries, part 588.
544. gbbct589.seq - Bacterial sequence entries, part 589.
545. gbbct59.seq - Bacterial sequence entries, part 59.
546. gbbct590.seq - Bacterial sequence entries, part 590.
547. gbbct591.seq - Bacterial sequence entries, part 591.
548. gbbct592.seq - Bacterial sequence entries, part 592.
549. gbbct593.seq - Bacterial sequence entries, part 593.
550. gbbct594.seq - Bacterial sequence entries, part 594.
551. gbbct595.seq - Bacterial sequence entries, part 595.
552. gbbct596.seq - Bacterial sequence entries, part 596.
553. gbbct597.seq - Bacterial sequence entries, part 597.
554. gbbct598.seq - Bacterial sequence entries, part 598.
555. gbbct599.seq - Bacterial sequence entries, part 599.
556. gbbct6.seq - Bacterial sequence entries, part 6.
557. gbbct60.seq - Bacterial sequence entries, part 60.
558. gbbct600.seq - Bacterial sequence entries, part 600.
559. gbbct601.seq - Bacterial sequence entries, part 601.
560. gbbct602.seq - Bacterial sequence entries, part 602.
561. gbbct603.seq - Bacterial sequence entries, part 603.
562. gbbct604.seq - Bacterial sequence entries, part 604.
563. gbbct605.seq - Bacterial sequence entries, part 605.
564. gbbct606.seq - Bacterial sequence entries, part 606.
565. gbbct607.seq - Bacterial sequence entries, part 607.
566. gbbct608.seq - Bacterial sequence entries, part 608.
567. gbbct609.seq - Bacterial sequence entries, part 609.
568. gbbct61.seq - Bacterial sequence entries, part 61.
569. gbbct610.seq - Bacterial sequence entries, part 610.
570. gbbct611.seq - Bacterial sequence entries, part 611.
571. gbbct612.seq - Bacterial sequence entries, part 612.
572. gbbct613.seq - Bacterial sequence entries, part 613.
573. gbbct614.seq - Bacterial sequence entries, part 614.
574. gbbct615.seq - Bacterial sequence entries, part 615.
575. gbbct616.seq - Bacterial sequence entries, part 616.
576. gbbct617.seq - Bacterial sequence entries, part 617.
577. gbbct618.seq - Bacterial sequence entries, part 618.
578. gbbct619.seq - Bacterial sequence entries, part 619.
579. gbbct62.seq - Bacterial sequence entries, part 62.
580. gbbct620.seq - Bacterial sequence entries, part 620.
581. gbbct621.seq - Bacterial sequence entries, part 621.
582. gbbct622.seq - Bacterial sequence entries, part 622.
583. gbbct623.seq - Bacterial sequence entries, part 623.
584. gbbct624.seq - Bacterial sequence entries, part 624.
585. gbbct625.seq - Bacterial sequence entries, part 625.
586. gbbct626.seq - Bacterial sequence entries, part 626.
587. gbbct627.seq - Bacterial sequence entries, part 627.
588. gbbct628.seq - Bacterial sequence entries, part 628.
589. gbbct629.seq - Bacterial sequence entries, part 629.
590. gbbct63.seq - Bacterial sequence entries, part 63.
591. gbbct630.seq - Bacterial sequence entries, part 630.
592. gbbct631.seq - Bacterial sequence entries, part 631.
593. gbbct632.seq - Bacterial sequence entries, part 632.
594. gbbct633.seq - Bacterial sequence entries, part 633.
595. gbbct634.seq - Bacterial sequence entries, part 634.
596. gbbct635.seq - Bacterial sequence entries, part 635.
597. gbbct636.seq - Bacterial sequence entries, part 636.
598. gbbct637.seq - Bacterial sequence entries, part 637.
599. gbbct638.seq - Bacterial sequence entries, part 638.
600. gbbct639.seq - Bacterial sequence entries, part 639.
601. gbbct64.seq - Bacterial sequence entries, part 64.
602. gbbct640.seq - Bacterial sequence entries, part 640.
603. gbbct641.seq - Bacterial sequence entries, part 641.
604. gbbct642.seq - Bacterial sequence entries, part 642.
605. gbbct643.seq - Bacterial sequence entries, part 643.
606. gbbct644.seq - Bacterial sequence entries, part 644.
607. gbbct645.seq - Bacterial sequence entries, part 645.
608. gbbct646.seq - Bacterial sequence entries, part 646.
609. gbbct647.seq - Bacterial sequence entries, part 647.
610. gbbct648.seq - Bacterial sequence entries, part 648.
611. gbbct649.seq - Bacterial sequence entries, part 649.
612. gbbct65.seq - Bacterial sequence entries, part 65.
613. gbbct650.seq - Bacterial sequence entries, part 650.
614. gbbct651.seq - Bacterial sequence entries, part 651.
615. gbbct652.seq - Bacterial sequence entries, part 652.
616. gbbct653.seq - Bacterial sequence entries, part 653.
617. gbbct654.seq - Bacterial sequence entries, part 654.
618. gbbct655.seq - Bacterial sequence entries, part 655.
619. gbbct656.seq - Bacterial sequence entries, part 656.
620. gbbct657.seq - Bacterial sequence entries, part 657.
621. gbbct658.seq - Bacterial sequence entries, part 658.
622. gbbct659.seq - Bacterial sequence entries, part 659.
623. gbbct66.seq - Bacterial sequence entries, part 66.
624. gbbct660.seq - Bacterial sequence entries, part 660.
625. gbbct661.seq - Bacterial sequence entries, part 661.
626. gbbct662.seq - Bacterial sequence entries, part 662.
627. gbbct663.seq - Bacterial sequence entries, part 663.
628. gbbct664.seq - Bacterial sequence entries, part 664.
629. gbbct665.seq - Bacterial sequence entries, part 665.
630. gbbct666.seq - Bacterial sequence entries, part 666.
631. gbbct667.seq - Bacterial sequence entries, part 667.
632. gbbct668.seq - Bacterial sequence entries, part 668.
633. gbbct669.seq - Bacterial sequence entries, part 669.
634. gbbct67.seq - Bacterial sequence entries, part 67.
635. gbbct670.seq - Bacterial sequence entries, part 670.
636. gbbct671.seq - Bacterial sequence entries, part 671.
637. gbbct672.seq - Bacterial sequence entries, part 672.
638. gbbct673.seq - Bacterial sequence entries, part 673.
639. gbbct674.seq - Bacterial sequence entries, part 674.
640. gbbct675.seq - Bacterial sequence entries, part 675.
641. gbbct676.seq - Bacterial sequence entries, part 676.
642. gbbct677.seq - Bacterial sequence entries, part 677.
643. gbbct678.seq - Bacterial sequence entries, part 678.
644. gbbct679.seq - Bacterial sequence entries, part 679.
645. gbbct68.seq - Bacterial sequence entries, part 68.
646. gbbct680.seq - Bacterial sequence entries, part 680.
647. gbbct681.seq - Bacterial sequence entries, part 681.
648. gbbct682.seq - Bacterial sequence entries, part 682.
649. gbbct683.seq - Bacterial sequence entries, part 683.
650. gbbct684.seq - Bacterial sequence entries, part 684.
651. gbbct685.seq - Bacterial sequence entries, part 685.
652. gbbct686.seq - Bacterial sequence entries, part 686.
653. gbbct687.seq - Bacterial sequence entries, part 687.
654. gbbct688.seq - Bacterial sequence entries, part 688.
655. gbbct689.seq - Bacterial sequence entries, part 689.
656. gbbct69.seq - Bacterial sequence entries, part 69.
657. gbbct690.seq - Bacterial sequence entries, part 690.
658. gbbct691.seq - Bacterial sequence entries, part 691.
659. gbbct692.seq - Bacterial sequence entries, part 692.
660. gbbct693.seq - Bacterial sequence entries, part 693.
661. gbbct694.seq - Bacterial sequence entries, part 694.
662. gbbct695.seq - Bacterial sequence entries, part 695.
663. gbbct696.seq - Bacterial sequence entries, part 696.
664. gbbct697.seq - Bacterial sequence entries, part 697.
665. gbbct698.seq - Bacterial sequence entries, part 698.
666. gbbct699.seq - Bacterial sequence entries, part 699.
667. gbbct7.seq - Bacterial sequence entries, part 7.
668. gbbct70.seq - Bacterial sequence entries, part 70.
669. gbbct700.seq - Bacterial sequence entries, part 700.
670. gbbct701.seq - Bacterial sequence entries, part 701.
671. gbbct702.seq - Bacterial sequence entries, part 702.
672. gbbct703.seq - Bacterial sequence entries, part 703.
673. gbbct704.seq - Bacterial sequence entries, part 704.
674. gbbct705.seq - Bacterial sequence entries, part 705.
675. gbbct706.seq - Bacterial sequence entries, part 706.
676. gbbct707.seq - Bacterial sequence entries, part 707.
677. gbbct708.seq - Bacterial sequence entries, part 708.
678. gbbct709.seq - Bacterial sequence entries, part 709.
679. gbbct71.seq - Bacterial sequence entries, part 71.
680. gbbct710.seq - Bacterial sequence entries, part 710.
681. gbbct711.seq - Bacterial sequence entries, part 711.
682. gbbct712.seq - Bacterial sequence entries, part 712.
683. gbbct713.seq - Bacterial sequence entries, part 713.
684. gbbct714.seq - Bacterial sequence entries, part 714.
685. gbbct715.seq - Bacterial sequence entries, part 715.
686. gbbct716.seq - Bacterial sequence entries, part 716.
687. gbbct717.seq - Bacterial sequence entries, part 717.
688. gbbct718.seq - Bacterial sequence entries, part 718.
689. gbbct719.seq - Bacterial sequence entries, part 719.
690. gbbct72.seq - Bacterial sequence entries, part 72.
691. gbbct720.seq - Bacterial sequence entries, part 720.
692. gbbct721.seq - Bacterial sequence entries, part 721.
693. gbbct722.seq - Bacterial sequence entries, part 722.
694. gbbct723.seq - Bacterial sequence entries, part 723.
695. gbbct724.seq - Bacterial sequence entries, part 724.
696. gbbct725.seq - Bacterial sequence entries, part 725.
697. gbbct726.seq - Bacterial sequence entries, part 726.
698. gbbct727.seq - Bacterial sequence entries, part 727.
699. gbbct728.seq - Bacterial sequence entries, part 728.
700. gbbct729.seq - Bacterial sequence entries, part 729.
701. gbbct73.seq - Bacterial sequence entries, part 73.
702. gbbct730.seq - Bacterial sequence entries, part 730.
703. gbbct731.seq - Bacterial sequence entries, part 731.
704. gbbct732.seq - Bacterial sequence entries, part 732.
705. gbbct733.seq - Bacterial sequence entries, part 733.
706. gbbct734.seq - Bacterial sequence entries, part 734.
707. gbbct735.seq - Bacterial sequence entries, part 735.
708. gbbct736.seq - Bacterial sequence entries, part 736.
709. gbbct737.seq - Bacterial sequence entries, part 737.
710. gbbct738.seq - Bacterial sequence entries, part 738.
711. gbbct739.seq - Bacterial sequence entries, part 739.
712. gbbct74.seq - Bacterial sequence entries, part 74.
713. gbbct740.seq - Bacterial sequence entries, part 740.
714. gbbct741.seq - Bacterial sequence entries, part 741.
715. gbbct742.seq - Bacterial sequence entries, part 742.
716. gbbct743.seq - Bacterial sequence entries, part 743.
717. gbbct744.seq - Bacterial sequence entries, part 744.
718. gbbct745.seq - Bacterial sequence entries, part 745.
719. gbbct746.seq - Bacterial sequence entries, part 746.
720. gbbct747.seq - Bacterial sequence entries, part 747.
721. gbbct748.seq - Bacterial sequence entries, part 748.
722. gbbct749.seq - Bacterial sequence entries, part 749.
723. gbbct75.seq - Bacterial sequence entries, part 75.
724. gbbct750.seq - Bacterial sequence entries, part 750.
725. gbbct751.seq - Bacterial sequence entries, part 751.
726. gbbct752.seq - Bacterial sequence entries, part 752.
727. gbbct753.seq - Bacterial sequence entries, part 753.
728. gbbct754.seq - Bacterial sequence entries, part 754.
729. gbbct755.seq - Bacterial sequence entries, part 755.
730. gbbct756.seq - Bacterial sequence entries, part 756.
731. gbbct757.seq - Bacterial sequence entries, part 757.
732. gbbct758.seq - Bacterial sequence entries, part 758.
733. gbbct759.seq - Bacterial sequence entries, part 759.
734. gbbct76.seq - Bacterial sequence entries, part 76.
735. gbbct760.seq - Bacterial sequence entries, part 760.
736. gbbct761.seq - Bacterial sequence entries, part 761.
737. gbbct762.seq - Bacterial sequence entries, part 762.
738. gbbct763.seq - Bacterial sequence entries, part 763.
739. gbbct764.seq - Bacterial sequence entries, part 764.
740. gbbct765.seq - Bacterial sequence entries, part 765.
741. gbbct766.seq - Bacterial sequence entries, part 766.
742. gbbct767.seq - Bacterial sequence entries, part 767.
743. gbbct768.seq - Bacterial sequence entries, part 768.
744. gbbct769.seq - Bacterial sequence entries, part 769.
745. gbbct77.seq - Bacterial sequence entries, part 77.
746. gbbct770.seq - Bacterial sequence entries, part 770.
747. gbbct771.seq - Bacterial sequence entries, part 771.
748. gbbct772.seq - Bacterial sequence entries, part 772.
749. gbbct773.seq - Bacterial sequence entries, part 773.
750. gbbct774.seq - Bacterial sequence entries, part 774.
751. gbbct775.seq - Bacterial sequence entries, part 775.
752. gbbct776.seq - Bacterial sequence entries, part 776.
753. gbbct777.seq - Bacterial sequence entries, part 777.
754. gbbct778.seq - Bacterial sequence entries, part 778.
755. gbbct779.seq - Bacterial sequence entries, part 779.
756. gbbct78.seq - Bacterial sequence entries, part 78.
757. gbbct780.seq - Bacterial sequence entries, part 780.
758. gbbct781.seq - Bacterial sequence entries, part 781.
759. gbbct782.seq - Bacterial sequence entries, part 782.
760. gbbct783.seq - Bacterial sequence entries, part 783.
761. gbbct784.seq - Bacterial sequence entries, part 784.
762. gbbct785.seq - Bacterial sequence entries, part 785.
763. gbbct786.seq - Bacterial sequence entries, part 786.
764. gbbct787.seq - Bacterial sequence entries, part 787.
765. gbbct788.seq - Bacterial sequence entries, part 788.
766. gbbct789.seq - Bacterial sequence entries, part 789.
767. gbbct79.seq - Bacterial sequence entries, part 79.
768. gbbct790.seq - Bacterial sequence entries, part 790.
769. gbbct791.seq - Bacterial sequence entries, part 791.
770. gbbct792.seq - Bacterial sequence entries, part 792.
771. gbbct793.seq - Bacterial sequence entries, part 793.
772. gbbct794.seq - Bacterial sequence entries, part 794.
773. gbbct795.seq - Bacterial sequence entries, part 795.
774. gbbct796.seq - Bacterial sequence entries, part 796.
775. gbbct797.seq - Bacterial sequence entries, part 797.
776. gbbct798.seq - Bacterial sequence entries, part 798.
777. gbbct799.seq - Bacterial sequence entries, part 799.
778. gbbct8.seq - Bacterial sequence entries, part 8.
779. gbbct80.seq - Bacterial sequence entries, part 80.
780. gbbct800.seq - Bacterial sequence entries, part 800.
781. gbbct801.seq - Bacterial sequence entries, part 801.
782. gbbct802.seq - Bacterial sequence entries, part 802.
783. gbbct803.seq - Bacterial sequence entries, part 803.
784. gbbct804.seq - Bacterial sequence entries, part 804.
785. gbbct805.seq - Bacterial sequence entries, part 805.
786. gbbct806.seq - Bacterial sequence entries, part 806.
787. gbbct807.seq - Bacterial sequence entries, part 807.
788. gbbct808.seq - Bacterial sequence entries, part 808.
789. gbbct809.seq - Bacterial sequence entries, part 809.
790. gbbct81.seq - Bacterial sequence entries, part 81.
791. gbbct810.seq - Bacterial sequence entries, part 810.
792. gbbct811.seq - Bacterial sequence entries, part 811.
793. gbbct812.seq - Bacterial sequence entries, part 812.
794. gbbct813.seq - Bacterial sequence entries, part 813.
795. gbbct814.seq - Bacterial sequence entries, part 814.
796. gbbct815.seq - Bacterial sequence entries, part 815.
797. gbbct816.seq - Bacterial sequence entries, part 816.
798. gbbct817.seq - Bacterial sequence entries, part 817.
799. gbbct818.seq - Bacterial sequence entries, part 818.
800. gbbct819.seq - Bacterial sequence entries, part 819.
801. gbbct82.seq - Bacterial sequence entries, part 82.
802. gbbct820.seq - Bacterial sequence entries, part 820.
803. gbbct821.seq - Bacterial sequence entries, part 821.
804. gbbct822.seq - Bacterial sequence entries, part 822.
805. gbbct823.seq - Bacterial sequence entries, part 823.
806. gbbct824.seq - Bacterial sequence entries, part 824.
807. gbbct825.seq - Bacterial sequence entries, part 825.
808. gbbct826.seq - Bacterial sequence entries, part 826.
809. gbbct827.seq - Bacterial sequence entries, part 827.
810. gbbct828.seq - Bacterial sequence entries, part 828.
811. gbbct829.seq - Bacterial sequence entries, part 829.
812. gbbct83.seq - Bacterial sequence entries, part 83.
813. gbbct830.seq - Bacterial sequence entries, part 830.
814. gbbct831.seq - Bacterial sequence entries, part 831.
815. gbbct832.seq - Bacterial sequence entries, part 832.
816. gbbct833.seq - Bacterial sequence entries, part 833.
817. gbbct834.seq - Bacterial sequence entries, part 834.
818. gbbct835.seq - Bacterial sequence entries, part 835.
819. gbbct836.seq - Bacterial sequence entries, part 836.
820. gbbct837.seq - Bacterial sequence entries, part 837.
821. gbbct838.seq - Bacterial sequence entries, part 838.
822. gbbct839.seq - Bacterial sequence entries, part 839.
823. gbbct84.seq - Bacterial sequence entries, part 84.
824. gbbct840.seq - Bacterial sequence entries, part 840.
825. gbbct841.seq - Bacterial sequence entries, part 841.
826. gbbct842.seq - Bacterial sequence entries, part 842.
827. gbbct843.seq - Bacterial sequence entries, part 843.
828. gbbct844.seq - Bacterial sequence entries, part 844.
829. gbbct845.seq - Bacterial sequence entries, part 845.
830. gbbct846.seq - Bacterial sequence entries, part 846.
831. gbbct847.seq - Bacterial sequence entries, part 847.
832. gbbct848.seq - Bacterial sequence entries, part 848.
833. gbbct849.seq - Bacterial sequence entries, part 849.
834. gbbct85.seq - Bacterial sequence entries, part 85.
835. gbbct850.seq - Bacterial sequence entries, part 850.
836. gbbct851.seq - Bacterial sequence entries, part 851.
837. gbbct852.seq - Bacterial sequence entries, part 852.
838. gbbct853.seq - Bacterial sequence entries, part 853.
839. gbbct854.seq - Bacterial sequence entries, part 854.
840. gbbct855.seq - Bacterial sequence entries, part 855.
841. gbbct856.seq - Bacterial sequence entries, part 856.
842. gbbct857.seq - Bacterial sequence entries, part 857.
843. gbbct858.seq - Bacterial sequence entries, part 858.
844. gbbct859.seq - Bacterial sequence entries, part 859.
845. gbbct86.seq - Bacterial sequence entries, part 86.
846. gbbct860.seq - Bacterial sequence entries, part 860.
847. gbbct861.seq - Bacterial sequence entries, part 861.
848. gbbct862.seq - Bacterial sequence entries, part 862.
849. gbbct863.seq - Bacterial sequence entries, part 863.
850. gbbct864.seq - Bacterial sequence entries, part 864.
851. gbbct865.seq - Bacterial sequence entries, part 865.
852. gbbct866.seq - Bacterial sequence entries, part 866.
853. gbbct867.seq - Bacterial sequence entries, part 867.
854. gbbct868.seq - Bacterial sequence entries, part 868.
855. gbbct869.seq - Bacterial sequence entries, part 869.
856. gbbct87.seq - Bacterial sequence entries, part 87.
857. gbbct870.seq - Bacterial sequence entries, part 870.
858. gbbct871.seq - Bacterial sequence entries, part 871.
859. gbbct872.seq - Bacterial sequence entries, part 872.
860. gbbct873.seq - Bacterial sequence entries, part 873.
861. gbbct874.seq - Bacterial sequence entries, part 874.
862. gbbct875.seq - Bacterial sequence entries, part 875.
863. gbbct876.seq - Bacterial sequence entries, part 876.
864. gbbct877.seq - Bacterial sequence entries, part 877.
865. gbbct878.seq - Bacterial sequence entries, part 878.
866. gbbct879.seq - Bacterial sequence entries, part 879.
867. gbbct88.seq - Bacterial sequence entries, part 88.
868. gbbct880.seq - Bacterial sequence entries, part 880.
869. gbbct881.seq - Bacterial sequence entries, part 881.
870. gbbct882.seq - Bacterial sequence entries, part 882.
871. gbbct883.seq - Bacterial sequence entries, part 883.
872. gbbct884.seq - Bacterial sequence entries, part 884.
873. gbbct885.seq - Bacterial sequence entries, part 885.
874. gbbct886.seq - Bacterial sequence entries, part 886.
875. gbbct887.seq - Bacterial sequence entries, part 887.
876. gbbct888.seq - Bacterial sequence entries, part 888.
877. gbbct889.seq - Bacterial sequence entries, part 889.
878. gbbct89.seq - Bacterial sequence entries, part 89.
879. gbbct890.seq - Bacterial sequence entries, part 890.
880. gbbct891.seq - Bacterial sequence entries, part 891.
881. gbbct892.seq - Bacterial sequence entries, part 892.
882. gbbct893.seq - Bacterial sequence entries, part 893.
883. gbbct894.seq - Bacterial sequence entries, part 894.
884. gbbct895.seq - Bacterial sequence entries, part 895.
885. gbbct896.seq - Bacterial sequence entries, part 896.
886. gbbct897.seq - Bacterial sequence entries, part 897.
887. gbbct898.seq - Bacterial sequence entries, part 898.
888. gbbct899.seq - Bacterial sequence entries, part 899.
889. gbbct9.seq - Bacterial sequence entries, part 9.
890. gbbct90.seq - Bacterial sequence entries, part 90.
891. gbbct900.seq - Bacterial sequence entries, part 900.
892. gbbct901.seq - Bacterial sequence entries, part 901.
893. gbbct902.seq - Bacterial sequence entries, part 902.
894. gbbct903.seq - Bacterial sequence entries, part 903.
895. gbbct904.seq - Bacterial sequence entries, part 904.
896. gbbct905.seq - Bacterial sequence entries, part 905.
897. gbbct906.seq - Bacterial sequence entries, part 906.
898. gbbct907.seq - Bacterial sequence entries, part 907.
899. gbbct908.seq - Bacterial sequence entries, part 908.
900. gbbct909.seq - Bacterial sequence entries, part 909.
901. gbbct91.seq - Bacterial sequence entries, part 91.
902. gbbct910.seq - Bacterial sequence entries, part 910.
903. gbbct911.seq - Bacterial sequence entries, part 911.
904. gbbct912.seq - Bacterial sequence entries, part 912.
905. gbbct913.seq - Bacterial sequence entries, part 913.
906. gbbct914.seq - Bacterial sequence entries, part 914.
907. gbbct915.seq - Bacterial sequence entries, part 915.
908. gbbct916.seq - Bacterial sequence entries, part 916.
909. gbbct917.seq - Bacterial sequence entries, part 917.
910. gbbct918.seq - Bacterial sequence entries, part 918.
911. gbbct919.seq - Bacterial sequence entries, part 919.
912. gbbct92.seq - Bacterial sequence entries, part 92.
913. gbbct920.seq - Bacterial sequence entries, part 920.
914. gbbct921.seq - Bacterial sequence entries, part 921.
915. gbbct922.seq - Bacterial sequence entries, part 922.
916. gbbct923.seq - Bacterial sequence entries, part 923.
917. gbbct924.seq - Bacterial sequence entries, part 924.
918. gbbct925.seq - Bacterial sequence entries, part 925.
919. gbbct926.seq - Bacterial sequence entries, part 926.
920. gbbct927.seq - Bacterial sequence entries, part 927.
921. gbbct928.seq - Bacterial sequence entries, part 928.
922. gbbct929.seq - Bacterial sequence entries, part 929.
923. gbbct93.seq - Bacterial sequence entries, part 93.
924. gbbct930.seq - Bacterial sequence entries, part 930.
925. gbbct931.seq - Bacterial sequence entries, part 931.
926. gbbct932.seq - Bacterial sequence entries, part 932.
927. gbbct933.seq - Bacterial sequence entries, part 933.
928. gbbct934.seq - Bacterial sequence entries, part 934.
929. gbbct935.seq - Bacterial sequence entries, part 935.
930. gbbct936.seq - Bacterial sequence entries, part 936.
931. gbbct937.seq - Bacterial sequence entries, part 937.
932. gbbct94.seq - Bacterial sequence entries, part 94.
933. gbbct95.seq - Bacterial sequence entries, part 95.
934. gbbct96.seq - Bacterial sequence entries, part 96.
935. gbbct97.seq - Bacterial sequence entries, part 97.
936. gbbct98.seq - Bacterial sequence entries, part 98.
937. gbbct99.seq - Bacterial sequence entries, part 99.
938. gbchg.txt - Accession numbers of entries updated since the previous release.
939. gbcon1.seq - Constructed sequence entries, part 1.
940. gbcon10.seq - Constructed sequence entries, part 10.
941. gbcon100.seq - Constructed sequence entries, part 100.
942. gbcon101.seq - Constructed sequence entries, part 101.
943. gbcon102.seq - Constructed sequence entries, part 102.
944. gbcon103.seq - Constructed sequence entries, part 103.
945. gbcon104.seq - Constructed sequence entries, part 104.
946. gbcon105.seq - Constructed sequence entries, part 105.
947. gbcon106.seq - Constructed sequence entries, part 106.
948. gbcon107.seq - Constructed sequence entries, part 107.
949. gbcon108.seq - Constructed sequence entries, part 108.
950. gbcon109.seq - Constructed sequence entries, part 109.
951. gbcon11.seq - Constructed sequence entries, part 11.
952. gbcon110.seq - Constructed sequence entries, part 110.
953. gbcon111.seq - Constructed sequence entries, part 111.
954. gbcon112.seq - Constructed sequence entries, part 112.
955. gbcon113.seq - Constructed sequence entries, part 113.
956. gbcon114.seq - Constructed sequence entries, part 114.
957. gbcon115.seq - Constructed sequence entries, part 115.
958. gbcon116.seq - Constructed sequence entries, part 116.
959. gbcon117.seq - Constructed sequence entries, part 117.
960. gbcon118.seq - Constructed sequence entries, part 118.
961. gbcon119.seq - Constructed sequence entries, part 119.
962. gbcon12.seq - Constructed sequence entries, part 12.
963. gbcon120.seq - Constructed sequence entries, part 120.
964. gbcon121.seq - Constructed sequence entries, part 121.
965. gbcon122.seq - Constructed sequence entries, part 122.
966. gbcon123.seq - Constructed sequence entries, part 123.
967. gbcon124.seq - Constructed sequence entries, part 124.
968. gbcon125.seq - Constructed sequence entries, part 125.
969. gbcon126.seq - Constructed sequence entries, part 126.
970. gbcon127.seq - Constructed sequence entries, part 127.
971. gbcon128.seq - Constructed sequence entries, part 128.
972. gbcon129.seq - Constructed sequence entries, part 129.
973. gbcon13.seq - Constructed sequence entries, part 13.
974. gbcon130.seq - Constructed sequence entries, part 130.
975. gbcon131.seq - Constructed sequence entries, part 131.
976. gbcon132.seq - Constructed sequence entries, part 132.
977. gbcon133.seq - Constructed sequence entries, part 133.
978. gbcon134.seq - Constructed sequence entries, part 134.
979. gbcon135.seq - Constructed sequence entries, part 135.
980. gbcon136.seq - Constructed sequence entries, part 136.
981. gbcon137.seq - Constructed sequence entries, part 137.
982. gbcon138.seq - Constructed sequence entries, part 138.
983. gbcon139.seq - Constructed sequence entries, part 139.
984. gbcon14.seq - Constructed sequence entries, part 14.
985. gbcon140.seq - Constructed sequence entries, part 140.
986. gbcon141.seq - Constructed sequence entries, part 141.
987. gbcon142.seq - Constructed sequence entries, part 142.
988. gbcon143.seq - Constructed sequence entries, part 143.
989. gbcon144.seq - Constructed sequence entries, part 144.
990. gbcon145.seq - Constructed sequence entries, part 145.
991. gbcon146.seq - Constructed sequence entries, part 146.
992. gbcon147.seq - Constructed sequence entries, part 147.
993. gbcon148.seq - Constructed sequence entries, part 148.
994. gbcon149.seq - Constructed sequence entries, part 149.
995. gbcon15.seq - Constructed sequence entries, part 15.
996. gbcon150.seq - Constructed sequence entries, part 150.
997. gbcon151.seq - Constructed sequence entries, part 151.
998. gbcon152.seq - Constructed sequence entries, part 152.
999. gbcon153.seq - Constructed sequence entries, part 153.
1000. gbcon154.seq - Constructed sequence entries, part 154.
1001. gbcon155.seq - Constructed sequence entries, part 155.
1002. gbcon156.seq - Constructed sequence entries, part 156.
1003. gbcon157.seq - Constructed sequence entries, part 157.
1004. gbcon158.seq - Constructed sequence entries, part 158.
1005. gbcon159.seq - Constructed sequence entries, part 159.
1006. gbcon16.seq - Constructed sequence entries, part 16.
1007. gbcon160.seq - Constructed sequence entries, part 160.
1008. gbcon161.seq - Constructed sequence entries, part 161.
1009. gbcon162.seq - Constructed sequence entries, part 162.
1010. gbcon163.seq - Constructed sequence entries, part 163.
1011. gbcon164.seq - Constructed sequence entries, part 164.
1012. gbcon165.seq - Constructed sequence entries, part 165.
1013. gbcon166.seq - Constructed sequence entries, part 166.
1014. gbcon167.seq - Constructed sequence entries, part 167.
1015. gbcon168.seq - Constructed sequence entries, part 168.
1016. gbcon169.seq - Constructed sequence entries, part 169.
1017. gbcon17.seq - Constructed sequence entries, part 17.
1018. gbcon170.seq - Constructed sequence entries, part 170.
1019. gbcon171.seq - Constructed sequence entries, part 171.
1020. gbcon172.seq - Constructed sequence entries, part 172.
1021. gbcon173.seq - Constructed sequence entries, part 173.
1022. gbcon174.seq - Constructed sequence entries, part 174.
1023. gbcon175.seq - Constructed sequence entries, part 175.
1024. gbcon176.seq - Constructed sequence entries, part 176.
1025. gbcon177.seq - Constructed sequence entries, part 177.
1026. gbcon178.seq - Constructed sequence entries, part 178.
1027. gbcon179.seq - Constructed sequence entries, part 179.
1028. gbcon18.seq - Constructed sequence entries, part 18.
1029. gbcon180.seq - Constructed sequence entries, part 180.
1030. gbcon181.seq - Constructed sequence entries, part 181.
1031. gbcon182.seq - Constructed sequence entries, part 182.
1032. gbcon183.seq - Constructed sequence entries, part 183.
1033. gbcon184.seq - Constructed sequence entries, part 184.
1034. gbcon185.seq - Constructed sequence entries, part 185.
1035. gbcon186.seq - Constructed sequence entries, part 186.
1036. gbcon187.seq - Constructed sequence entries, part 187.
1037. gbcon188.seq - Constructed sequence entries, part 188.
1038. gbcon189.seq - Constructed sequence entries, part 189.
1039. gbcon19.seq - Constructed sequence entries, part 19.
1040. gbcon190.seq - Constructed sequence entries, part 190.
1041. gbcon191.seq - Constructed sequence entries, part 191.
1042. gbcon192.seq - Constructed sequence entries, part 192.
1043. gbcon193.seq - Constructed sequence entries, part 193.
1044. gbcon194.seq - Constructed sequence entries, part 194.
1045. gbcon195.seq - Constructed sequence entries, part 195.
1046. gbcon196.seq - Constructed sequence entries, part 196.
1047. gbcon197.seq - Constructed sequence entries, part 197.
1048. gbcon198.seq - Constructed sequence entries, part 198.
1049. gbcon199.seq - Constructed sequence entries, part 199.
1050. gbcon2.seq - Constructed sequence entries, part 2.
1051. gbcon20.seq - Constructed sequence entries, part 20.
1052. gbcon200.seq - Constructed sequence entries, part 200.
1053. gbcon201.seq - Constructed sequence entries, part 201.
1054. gbcon202.seq - Constructed sequence entries, part 202.
1055. gbcon203.seq - Constructed sequence entries, part 203.
1056. gbcon204.seq - Constructed sequence entries, part 204.
1057. gbcon205.seq - Constructed sequence entries, part 205.
1058. gbcon206.seq - Constructed sequence entries, part 206.
1059. gbcon207.seq - Constructed sequence entries, part 207.
1060. gbcon208.seq - Constructed sequence entries, part 208.
1061. gbcon209.seq - Constructed sequence entries, part 209.
1062. gbcon21.seq - Constructed sequence entries, part 21.
1063. gbcon210.seq - Constructed sequence entries, part 210.
1064. gbcon211.seq - Constructed sequence entries, part 211.
1065. gbcon212.seq - Constructed sequence entries, part 212.
1066. gbcon213.seq - Constructed sequence entries, part 213.
1067. gbcon214.seq - Constructed sequence entries, part 214.
1068. gbcon215.seq - Constructed sequence entries, part 215.
1069. gbcon216.seq - Constructed sequence entries, part 216.
1070. gbcon217.seq - Constructed sequence entries, part 217.
1071. gbcon218.seq - Constructed sequence entries, part 218.
1072. gbcon219.seq - Constructed sequence entries, part 219.
1073. gbcon22.seq - Constructed sequence entries, part 22.
1074. gbcon220.seq - Constructed sequence entries, part 220.
1075. gbcon221.seq - Constructed sequence entries, part 221.
1076. gbcon222.seq - Constructed sequence entries, part 222.
1077. gbcon223.seq - Constructed sequence entries, part 223.
1078. gbcon224.seq - Constructed sequence entries, part 224.
1079. gbcon225.seq - Constructed sequence entries, part 225.
1080. gbcon226.seq - Constructed sequence entries, part 226.
1081. gbcon227.seq - Constructed sequence entries, part 227.
1082. gbcon228.seq - Constructed sequence entries, part 228.
1083. gbcon229.seq - Constructed sequence entries, part 229.
1084. gbcon23.seq - Constructed sequence entries, part 23.
1085. gbcon230.seq - Constructed sequence entries, part 230.
1086. gbcon231.seq - Constructed sequence entries, part 231.
1087. gbcon232.seq - Constructed sequence entries, part 232.
1088. gbcon233.seq - Constructed sequence entries, part 233.
1089. gbcon234.seq - Constructed sequence entries, part 234.
1090. gbcon235.seq - Constructed sequence entries, part 235.
1091. gbcon24.seq - Constructed sequence entries, part 24.
1092. gbcon25.seq - Constructed sequence entries, part 25.
1093. gbcon26.seq - Constructed sequence entries, part 26.
1094. gbcon27.seq - Constructed sequence entries, part 27.
1095. gbcon28.seq - Constructed sequence entries, part 28.
1096. gbcon29.seq - Constructed sequence entries, part 29.
1097. gbcon3.seq - Constructed sequence entries, part 3.
1098. gbcon30.seq - Constructed sequence entries, part 30.
1099. gbcon31.seq - Constructed sequence entries, part 31.
1100. gbcon32.seq - Constructed sequence entries, part 32.
1101. gbcon33.seq - Constructed sequence entries, part 33.
1102. gbcon34.seq - Constructed sequence entries, part 34.
1103. gbcon35.seq - Constructed sequence entries, part 35.
1104. gbcon36.seq - Constructed sequence entries, part 36.
1105. gbcon37.seq - Constructed sequence entries, part 37.
1106. gbcon38.seq - Constructed sequence entries, part 38.
1107. gbcon39.seq - Constructed sequence entries, part 39.
1108. gbcon4.seq - Constructed sequence entries, part 4.
1109. gbcon40.seq - Constructed sequence entries, part 40.
1110. gbcon41.seq - Constructed sequence entries, part 41.
1111. gbcon42.seq - Constructed sequence entries, part 42.
1112. gbcon43.seq - Constructed sequence entries, part 43.
1113. gbcon44.seq - Constructed sequence entries, part 44.
1114. gbcon45.seq - Constructed sequence entries, part 45.
1115. gbcon46.seq - Constructed sequence entries, part 46.
1116. gbcon47.seq - Constructed sequence entries, part 47.
1117. gbcon48.seq - Constructed sequence entries, part 48.
1118. gbcon49.seq - Constructed sequence entries, part 49.
1119. gbcon5.seq - Constructed sequence entries, part 5.
1120. gbcon50.seq - Constructed sequence entries, part 50.
1121. gbcon51.seq - Constructed sequence entries, part 51.
1122. gbcon52.seq - Constructed sequence entries, part 52.
1123. gbcon53.seq - Constructed sequence entries, part 53.
1124. gbcon54.seq - Constructed sequence entries, part 54.
1125. gbcon55.seq - Constructed sequence entries, part 55.
1126. gbcon56.seq - Constructed sequence entries, part 56.
1127. gbcon57.seq - Constructed sequence entries, part 57.
1128. gbcon58.seq - Constructed sequence entries, part 58.
1129. gbcon59.seq - Constructed sequence entries, part 59.
1130. gbcon6.seq - Constructed sequence entries, part 6.
1131. gbcon60.seq - Constructed sequence entries, part 60.
1132. gbcon61.seq - Constructed sequence entries, part 61.
1133. gbcon62.seq - Constructed sequence entries, part 62.
1134. gbcon63.seq - Constructed sequence entries, part 63.
1135. gbcon64.seq - Constructed sequence entries, part 64.
1136. gbcon65.seq - Constructed sequence entries, part 65.
1137. gbcon66.seq - Constructed sequence entries, part 66.
1138. gbcon67.seq - Constructed sequence entries, part 67.
1139. gbcon68.seq - Constructed sequence entries, part 68.
1140. gbcon69.seq - Constructed sequence entries, part 69.
1141. gbcon7.seq - Constructed sequence entries, part 7.
1142. gbcon70.seq - Constructed sequence entries, part 70.
1143. gbcon71.seq - Constructed sequence entries, part 71.
1144. gbcon72.seq - Constructed sequence entries, part 72.
1145. gbcon73.seq - Constructed sequence entries, part 73.
1146. gbcon74.seq - Constructed sequence entries, part 74.
1147. gbcon75.seq - Constructed sequence entries, part 75.
1148. gbcon76.seq - Constructed sequence entries, part 76.
1149. gbcon77.seq - Constructed sequence entries, part 77.
1150. gbcon78.seq - Constructed sequence entries, part 78.
1151. gbcon79.seq - Constructed sequence entries, part 79.
1152. gbcon8.seq - Constructed sequence entries, part 8.
1153. gbcon80.seq - Constructed sequence entries, part 80.
1154. gbcon81.seq - Constructed sequence entries, part 81.
1155. gbcon82.seq - Constructed sequence entries, part 82.
1156. gbcon83.seq - Constructed sequence entries, part 83.
1157. gbcon84.seq - Constructed sequence entries, part 84.
1158. gbcon85.seq - Constructed sequence entries, part 85.
1159. gbcon86.seq - Constructed sequence entries, part 86.
1160. gbcon87.seq - Constructed sequence entries, part 87.
1161. gbcon88.seq - Constructed sequence entries, part 88.
1162. gbcon89.seq - Constructed sequence entries, part 89.
1163. gbcon9.seq - Constructed sequence entries, part 9.
1164. gbcon90.seq - Constructed sequence entries, part 90.
1165. gbcon91.seq - Constructed sequence entries, part 91.
1166. gbcon92.seq - Constructed sequence entries, part 92.
1167. gbcon93.seq - Constructed sequence entries, part 93.
1168. gbcon94.seq - Constructed sequence entries, part 94.
1169. gbcon95.seq - Constructed sequence entries, part 95.
1170. gbcon96.seq - Constructed sequence entries, part 96.
1171. gbcon97.seq - Constructed sequence entries, part 97.
1172. gbcon98.seq - Constructed sequence entries, part 98.
1173. gbcon99.seq - Constructed sequence entries, part 99.
1174. gbdel.txt - Accession numbers of entries deleted since the previous release.
1175. gbenv1.seq - Environmental sampling sequence entries, part 1.
1176. gbenv10.seq - Environmental sampling sequence entries, part 10.
1177. gbenv11.seq - Environmental sampling sequence entries, part 11.
1178. gbenv12.seq - Environmental sampling sequence entries, part 12.
1179. gbenv13.seq - Environmental sampling sequence entries, part 13.
1180. gbenv14.seq - Environmental sampling sequence entries, part 14.
1181. gbenv15.seq - Environmental sampling sequence entries, part 15.
1182. gbenv16.seq - Environmental sampling sequence entries, part 16.
1183. gbenv17.seq - Environmental sampling sequence entries, part 17.
1184. gbenv18.seq - Environmental sampling sequence entries, part 18.
1185. gbenv19.seq - Environmental sampling sequence entries, part 19.
1186. gbenv2.seq - Environmental sampling sequence entries, part 2.
1187. gbenv20.seq - Environmental sampling sequence entries, part 20.
1188. gbenv21.seq - Environmental sampling sequence entries, part 21.
1189. gbenv22.seq - Environmental sampling sequence entries, part 22.
1190. gbenv23.seq - Environmental sampling sequence entries, part 23.
1191. gbenv24.seq - Environmental sampling sequence entries, part 24.
1192. gbenv25.seq - Environmental sampling sequence entries, part 25.
1193. gbenv26.seq - Environmental sampling sequence entries, part 26.
1194. gbenv27.seq - Environmental sampling sequence entries, part 27.
1195. gbenv28.seq - Environmental sampling sequence entries, part 28.
1196. gbenv29.seq - Environmental sampling sequence entries, part 29.
1197. gbenv3.seq - Environmental sampling sequence entries, part 3.
1198. gbenv30.seq - Environmental sampling sequence entries, part 30.
1199. gbenv31.seq - Environmental sampling sequence entries, part 31.
1200. gbenv32.seq - Environmental sampling sequence entries, part 32.
1201. gbenv33.seq - Environmental sampling sequence entries, part 33.
1202. gbenv34.seq - Environmental sampling sequence entries, part 34.
1203. gbenv35.seq - Environmental sampling sequence entries, part 35.
1204. gbenv36.seq - Environmental sampling sequence entries, part 36.
1205. gbenv37.seq - Environmental sampling sequence entries, part 37.
1206. gbenv38.seq - Environmental sampling sequence entries, part 38.
1207. gbenv39.seq - Environmental sampling sequence entries, part 39.
1208. gbenv4.seq - Environmental sampling sequence entries, part 4.
1209. gbenv40.seq - Environmental sampling sequence entries, part 40.
1210. gbenv41.seq - Environmental sampling sequence entries, part 41.
1211. gbenv42.seq - Environmental sampling sequence entries, part 42.
1212. gbenv43.seq - Environmental sampling sequence entries, part 43.
1213. gbenv44.seq - Environmental sampling sequence entries, part 44.
1214. gbenv45.seq - Environmental sampling sequence entries, part 45.
1215. gbenv46.seq - Environmental sampling sequence entries, part 46.
1216. gbenv47.seq - Environmental sampling sequence entries, part 47.
1217. gbenv48.seq - Environmental sampling sequence entries, part 48.
1218. gbenv49.seq - Environmental sampling sequence entries, part 49.
1219. gbenv5.seq - Environmental sampling sequence entries, part 5.
1220. gbenv50.seq - Environmental sampling sequence entries, part 50.
1221. gbenv51.seq - Environmental sampling sequence entries, part 51.
1222. gbenv52.seq - Environmental sampling sequence entries, part 52.
1223. gbenv53.seq - Environmental sampling sequence entries, part 53.
1224. gbenv54.seq - Environmental sampling sequence entries, part 54.
1225. gbenv55.seq - Environmental sampling sequence entries, part 55.
1226. gbenv56.seq - Environmental sampling sequence entries, part 56.
1227. gbenv57.seq - Environmental sampling sequence entries, part 57.
1228. gbenv58.seq - Environmental sampling sequence entries, part 58.
1229. gbenv59.seq - Environmental sampling sequence entries, part 59.
1230. gbenv6.seq - Environmental sampling sequence entries, part 6.
1231. gbenv60.seq - Environmental sampling sequence entries, part 60.
1232. gbenv61.seq - Environmental sampling sequence entries, part 61.
1233. gbenv62.seq - Environmental sampling sequence entries, part 62.
1234. gbenv63.seq - Environmental sampling sequence entries, part 63.
1235. gbenv64.seq - Environmental sampling sequence entries, part 64.
1236. gbenv65.seq - Environmental sampling sequence entries, part 65.
1237. gbenv66.seq - Environmental sampling sequence entries, part 66.
1238. gbenv67.seq - Environmental sampling sequence entries, part 67.
1239. gbenv68.seq - Environmental sampling sequence entries, part 68.
1240. gbenv69.seq - Environmental sampling sequence entries, part 69.
1241. gbenv7.seq - Environmental sampling sequence entries, part 7.
1242. gbenv70.seq - Environmental sampling sequence entries, part 70.
1243. gbenv71.seq - Environmental sampling sequence entries, part 71.
1244. gbenv72.seq - Environmental sampling sequence entries, part 72.
1245. gbenv73.seq - Environmental sampling sequence entries, part 73.
1246. gbenv74.seq - Environmental sampling sequence entries, part 74.
1247. gbenv75.seq - Environmental sampling sequence entries, part 75.
1248. gbenv76.seq - Environmental sampling sequence entries, part 76.
1249. gbenv77.seq - Environmental sampling sequence entries, part 77.
1250. gbenv8.seq - Environmental sampling sequence entries, part 8.
1251. gbenv9.seq - Environmental sampling sequence entries, part 9.
1252. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
1253. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
1254. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
1255. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
1256. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
1257. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
1258. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
1259. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
1260. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
1261. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
1262. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
1263. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
1264. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
1265. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
1266. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
1267. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
1268. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
1269. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
1270. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
1271. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
1272. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
1273. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
1274. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
1275. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
1276. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
1277. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
1278. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
1279. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
1280. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
1281. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
1282. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
1283. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
1284. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
1285. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
1286. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
1287. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
1288. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
1289. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
1290. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
1291. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
1292. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
1293. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
1294. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
1295. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
1296. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
1297. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
1298. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
1299. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
1300. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
1301. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
1302. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
1303. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
1304. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
1305. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
1306. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
1307. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
1308. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
1309. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
1310. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
1311. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
1312. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
1313. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
1314. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
1315. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
1316. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
1317. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
1318. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
1319. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
1320. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
1321. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
1322. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
1323. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
1324. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
1325. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
1326. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
1327. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
1328. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
1329. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
1330. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
1331. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
1332. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
1333. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
1334. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
1335. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
1336. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
1337. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
1338. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
1339. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
1340. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
1341. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
1342. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
1343. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
1344. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
1345. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
1346. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
1347. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
1348. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
1349. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
1350. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
1351. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
1352. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
1353. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
1354. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
1355. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
1356. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
1357. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
1358. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
1359. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
1360. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
1361. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
1362. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
1363. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
1364. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
1365. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
1366. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
1367. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
1368. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
1369. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
1370. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
1371. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
1372. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
1373. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
1374. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
1375. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
1376. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
1377. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
1378. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
1379. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
1380. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
1381. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
1382. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
1383. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
1384. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
1385. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
1386. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
1387. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
1388. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
1389. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
1390. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
1391. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
1392. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
1393. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
1394. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
1395. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
1396. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
1397. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
1398. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
1399. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
1400. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
1401. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
1402. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
1403. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
1404. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
1405. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
1406. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
1407. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
1408. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
1409. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
1410. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
1411. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
1412. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
1413. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
1414. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
1415. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
1416. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
1417. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
1418. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
1419. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
1420. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
1421. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
1422. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
1423. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
1424. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
1425. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
1426. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
1427. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
1428. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
1429. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
1430. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
1431. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
1432. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
1433. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
1434. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
1435. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
1436. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
1437. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
1438. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
1439. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
1440. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
1441. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
1442. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
1443. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
1444. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
1445. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
1446. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
1447. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
1448. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
1449. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
1450. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
1451. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
1452. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
1453. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
1454. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
1455. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
1456. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
1457. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
1458. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
1459. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
1460. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
1461. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
1462. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
1463. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
1464. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
1465. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
1466. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
1467. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
1468. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
1469. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
1470. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
1471. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
1472. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
1473. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
1474. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
1475. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
1476. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
1477. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
1478. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
1479. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1480. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1481. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1482. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1483. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1484. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1485. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1486. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1487. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1488. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1489. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1490. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1491. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1492. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1493. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1494. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1495. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1496. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1497. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1498. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1499. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1500. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1501. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1502. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1503. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1504. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1505. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1506. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1507. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1508. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1509. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1510. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1511. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1512. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1513. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1514. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1515. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1516. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1517. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1518. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1519. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1520. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1521. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1522. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1523. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1524. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1525. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1526. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1527. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1528. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1529. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1530. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1531. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1532. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1533. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1534. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1535. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1536. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1537. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1538. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1539. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1540. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1541. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1542. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1543. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1544. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1545. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1546. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1547. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1548. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1549. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1550. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1551. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1552. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1553. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1554. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1555. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1556. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1557. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1558. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1559. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1560. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1561. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1562. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1563. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1564. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1565. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1566. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1567. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1568. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1569. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1570. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1571. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1572. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1573. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1574. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1575. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1576. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1577. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1578. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1579. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1580. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1581. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1582. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1583. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1584. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1585. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1586. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1587. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1588. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1589. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1590. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1591. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1592. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1593. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1594. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1595. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1596. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1597. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1598. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1599. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1600. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1601. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1602. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1603. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1604. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1605. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1606. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1607. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1608. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1609. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1610. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1611. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1612. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1613. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1614. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1615. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1616. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1617. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1618. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1619. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1620. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1621. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1622. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1623. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1624. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1625. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1626. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1627. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1628. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1629. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1630. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1631. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1632. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1633. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1634. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1635. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1636. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1637. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1638. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1639. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1640. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1641. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1642. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1643. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1644. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1645. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1646. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1647. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1648. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1649. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1650. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1651. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1652. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1653. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1654. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1655. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1656. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1657. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1658. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1659. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1660. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1661. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1662. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1663. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1664. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1665. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1666. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1667. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1668. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1669. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1670. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1671. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1672. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1673. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1674. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1675. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1676. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1677. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1678. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1679. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
1680. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
1681. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
1682. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
1683. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
1684. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
1685. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1686. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
1687. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
1688. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
1689. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
1690. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
1691. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
1692. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
1693. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
1694. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
1695. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
1696. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1697. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1698. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
1699. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
1700. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
1701. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
1702. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
1703. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
1704. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
1705. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
1706. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
1707. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
1708. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1709. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
1710. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
1711. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
1712. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
1713. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
1714. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
1715. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
1716. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
1717. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
1718. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
1719. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1720. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
1721. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
1722. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
1723. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
1724. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
1725. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
1726. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
1727. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
1728. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
1729. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
1730. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1731. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
1732. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
1733. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
1734. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
1735. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
1736. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
1737. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
1738. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
1739. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
1740. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
1741. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1742. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
1743. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
1744. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
1745. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
1746. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
1747. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
1748. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
1749. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
1750. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
1751. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
1752. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1753. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
1754. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
1755. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
1756. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
1757. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
1758. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
1759. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
1760. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
1761. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
1762. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
1763. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1764. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
1765. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
1766. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
1767. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
1768. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
1769. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
1770. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
1771. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
1772. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
1773. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
1774. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1775. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
1776. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
1777. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
1778. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
1779. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
1780. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
1781. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
1782. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
1783. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
1784. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1785. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1786. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1787. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1788. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1789. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1790. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1791. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1792. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1793. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1794. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1795. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1796. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1797. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1798. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1799. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1800. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1801. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1802. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1803. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1804. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1805. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1806. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1807. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1808. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1809. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1810. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1811. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1812. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1813. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1814. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1815. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1816. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1817. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1818. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1819. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1820. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1821. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1822. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1823. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1824. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1825. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1826. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1827. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1828. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1829. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1830. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1831. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1832. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1833. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1834. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1835. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1836. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1837. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1838. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1839. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1840. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1841. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1842. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1843. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1844. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1845. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1846. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1847. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1848. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1849. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1850. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1851. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1852. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1853. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1854. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1855. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1856. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1857. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1858. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1859. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1860. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1861. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1862. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1863. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1864. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1865. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1866. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1867. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1868. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1869. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1870. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1871. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1872. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1873. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1874. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1875. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1876. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1877. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1878. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1879. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1880. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1881. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1882. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1883. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1884. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1885. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1886. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1887. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1888. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1889. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1890. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1891. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1892. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1893. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1894. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1895. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1896. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1897. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1898. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1899. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1900. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1901. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1902. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1903. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1904. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1905. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1906. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1907. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1908. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1909. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1910. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1911. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1912. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1913. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1914. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1915. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1916. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1917. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1918. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1919. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1920. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1921. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1922. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1923. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1924. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1925. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1926. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1927. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1928. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1929. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1930. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1931. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1932. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1933. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1934. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1935. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1936. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1937. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1938. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1939. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1940. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1941. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1942. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1943. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1944. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1945. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1946. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1947. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1948. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1949. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1950. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1951. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1952. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1953. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1954. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1955. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1956. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1957. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1958. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1959. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1960. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1961. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1962. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1963. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1964. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1965. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1966. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1967. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1968. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1969. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1970. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1971. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1972. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1973. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1974. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1975. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1976. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1977. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1978. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1979. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1980. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1981. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1982. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1983. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1984. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1985. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1986. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1987. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1988. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1989. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1990. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1991. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1992. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1993. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1994. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1995. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1996. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1997. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1998. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1999. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
2000. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
2001. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
2002. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
2003. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
2004. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
2005. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
2006. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
2007. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
2008. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
2009. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
2010. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
2011. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
2012. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
2013. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
2014. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
2015. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
2016. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
2017. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
2018. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
2019. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
2020. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
2021. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
2022. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
2023. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
2024. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
2025. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
2026. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
2027. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
2028. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
2029. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
2030. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
2031. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
2032. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
2033. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
2034. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
2035. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
2036. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
2037. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
2038. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
2039. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
2040. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
2041. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
2042. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
2043. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
2044. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
2045. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
2046. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
2047. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
2048. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
2049. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
2050. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
2051. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
2052. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
2053. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
2054. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
2055. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
2056. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
2057. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
2058. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
2059. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
2060. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
2061. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
2062. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
2063. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
2064. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
2065. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
2066. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
2067. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
2068. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
2069. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
2070. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
2071. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
2072. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
2073. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
2074. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
2075. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
2076. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
2077. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
2078. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
2079. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
2080. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
2081. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
2082. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
2083. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
2084. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
2085. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
2086. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
2087. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
2088. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
2089. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
2090. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
2091. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
2092. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
2093. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
2094. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
2095. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
2096. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
2097. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
2098. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
2099. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
2100. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
2101. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
2102. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
2103. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
2104. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
2105. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
2106. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
2107. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
2108. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
2109. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
2110. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
2111. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
2112. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
2113. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
2114. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
2115. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
2116. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
2117. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
2118. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
2119. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
2120. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
2121. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
2122. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
2123. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
2124. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
2125. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
2126. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
2127. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
2128. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
2129. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
2130. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
2131. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
2132. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
2133. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
2134. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
2135. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
2136. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
2137. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
2138. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
2139. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
2140. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
2141. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
2142. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
2143. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
2144. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
2145. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
2146. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
2147. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
2148. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
2149. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
2150. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
2151. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
2152. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
2153. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
2154. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
2155. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
2156. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
2157. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
2158. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
2159. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
2160. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
2161. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
2162. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
2163. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
2164. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
2165. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
2166. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
2167. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
2168. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
2169. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
2170. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
2171. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
2172. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
2173. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
2174. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
2175. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
2176. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
2177. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
2178. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
2179. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
2180. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
2181. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
2182. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
2183. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
2184. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
2185. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
2186. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
2187. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
2188. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
2189. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
2190. gbinv1.seq - Invertebrate sequence entries, part 1.
2191. gbinv10.seq - Invertebrate sequence entries, part 10.
2192. gbinv100.seq - Invertebrate sequence entries, part 100.
2193. gbinv1000.seq - Invertebrate sequence entries, part 1000.
2194. gbinv1001.seq - Invertebrate sequence entries, part 1001.
2195. gbinv1002.seq - Invertebrate sequence entries, part 1002.
2196. gbinv1003.seq - Invertebrate sequence entries, part 1003.
2197. gbinv1004.seq - Invertebrate sequence entries, part 1004.
2198. gbinv1005.seq - Invertebrate sequence entries, part 1005.
2199. gbinv1006.seq - Invertebrate sequence entries, part 1006.
2200. gbinv1007.seq - Invertebrate sequence entries, part 1007.
2201. gbinv1008.seq - Invertebrate sequence entries, part 1008.
2202. gbinv1009.seq - Invertebrate sequence entries, part 1009.
2203. gbinv101.seq - Invertebrate sequence entries, part 101.
2204. gbinv1010.seq - Invertebrate sequence entries, part 1010.
2205. gbinv1011.seq - Invertebrate sequence entries, part 1011.
2206. gbinv1012.seq - Invertebrate sequence entries, part 1012.
2207. gbinv1013.seq - Invertebrate sequence entries, part 1013.
2208. gbinv1014.seq - Invertebrate sequence entries, part 1014.
2209. gbinv1015.seq - Invertebrate sequence entries, part 1015.
2210. gbinv1016.seq - Invertebrate sequence entries, part 1016.
2211. gbinv1017.seq - Invertebrate sequence entries, part 1017.
2212. gbinv1018.seq - Invertebrate sequence entries, part 1018.
2213. gbinv1019.seq - Invertebrate sequence entries, part 1019.
2214. gbinv102.seq - Invertebrate sequence entries, part 102.
2215. gbinv1020.seq - Invertebrate sequence entries, part 1020.
2216. gbinv1021.seq - Invertebrate sequence entries, part 1021.
2217. gbinv1022.seq - Invertebrate sequence entries, part 1022.
2218. gbinv1023.seq - Invertebrate sequence entries, part 1023.
2219. gbinv1024.seq - Invertebrate sequence entries, part 1024.
2220. gbinv1025.seq - Invertebrate sequence entries, part 1025.
2221. gbinv1026.seq - Invertebrate sequence entries, part 1026.
2222. gbinv1027.seq - Invertebrate sequence entries, part 1027.
2223. gbinv1028.seq - Invertebrate sequence entries, part 1028.
2224. gbinv1029.seq - Invertebrate sequence entries, part 1029.
2225. gbinv103.seq - Invertebrate sequence entries, part 103.
2226. gbinv1030.seq - Invertebrate sequence entries, part 1030.
2227. gbinv1031.seq - Invertebrate sequence entries, part 1031.
2228. gbinv1032.seq - Invertebrate sequence entries, part 1032.
2229. gbinv1033.seq - Invertebrate sequence entries, part 1033.
2230. gbinv1034.seq - Invertebrate sequence entries, part 1034.
2231. gbinv1035.seq - Invertebrate sequence entries, part 1035.
2232. gbinv1036.seq - Invertebrate sequence entries, part 1036.
2233. gbinv1037.seq - Invertebrate sequence entries, part 1037.
2234. gbinv1038.seq - Invertebrate sequence entries, part 1038.
2235. gbinv1039.seq - Invertebrate sequence entries, part 1039.
2236. gbinv104.seq - Invertebrate sequence entries, part 104.
2237. gbinv1040.seq - Invertebrate sequence entries, part 1040.
2238. gbinv1041.seq - Invertebrate sequence entries, part 1041.
2239. gbinv1042.seq - Invertebrate sequence entries, part 1042.
2240. gbinv1043.seq - Invertebrate sequence entries, part 1043.
2241. gbinv1044.seq - Invertebrate sequence entries, part 1044.
2242. gbinv1045.seq - Invertebrate sequence entries, part 1045.
2243. gbinv1046.seq - Invertebrate sequence entries, part 1046.
2244. gbinv1047.seq - Invertebrate sequence entries, part 1047.
2245. gbinv1048.seq - Invertebrate sequence entries, part 1048.
2246. gbinv1049.seq - Invertebrate sequence entries, part 1049.
2247. gbinv105.seq - Invertebrate sequence entries, part 105.
2248. gbinv1050.seq - Invertebrate sequence entries, part 1050.
2249. gbinv1051.seq - Invertebrate sequence entries, part 1051.
2250. gbinv1052.seq - Invertebrate sequence entries, part 1052.
2251. gbinv1053.seq - Invertebrate sequence entries, part 1053.
2252. gbinv1054.seq - Invertebrate sequence entries, part 1054.
2253. gbinv1055.seq - Invertebrate sequence entries, part 1055.
2254. gbinv1056.seq - Invertebrate sequence entries, part 1056.
2255. gbinv1057.seq - Invertebrate sequence entries, part 1057.
2256. gbinv1058.seq - Invertebrate sequence entries, part 1058.
2257. gbinv1059.seq - Invertebrate sequence entries, part 1059.
2258. gbinv106.seq - Invertebrate sequence entries, part 106.
2259. gbinv1060.seq - Invertebrate sequence entries, part 1060.
2260. gbinv1061.seq - Invertebrate sequence entries, part 1061.
2261. gbinv1062.seq - Invertebrate sequence entries, part 1062.
2262. gbinv1063.seq - Invertebrate sequence entries, part 1063.
2263. gbinv1064.seq - Invertebrate sequence entries, part 1064.
2264. gbinv1065.seq - Invertebrate sequence entries, part 1065.
2265. gbinv1066.seq - Invertebrate sequence entries, part 1066.
2266. gbinv1067.seq - Invertebrate sequence entries, part 1067.
2267. gbinv1068.seq - Invertebrate sequence entries, part 1068.
2268. gbinv1069.seq - Invertebrate sequence entries, part 1069.
2269. gbinv107.seq - Invertebrate sequence entries, part 107.
2270. gbinv1070.seq - Invertebrate sequence entries, part 1070.
2271. gbinv1071.seq - Invertebrate sequence entries, part 1071.
2272. gbinv1072.seq - Invertebrate sequence entries, part 1072.
2273. gbinv1073.seq - Invertebrate sequence entries, part 1073.
2274. gbinv1074.seq - Invertebrate sequence entries, part 1074.
2275. gbinv1075.seq - Invertebrate sequence entries, part 1075.
2276. gbinv1076.seq - Invertebrate sequence entries, part 1076.
2277. gbinv1077.seq - Invertebrate sequence entries, part 1077.
2278. gbinv1078.seq - Invertebrate sequence entries, part 1078.
2279. gbinv1079.seq - Invertebrate sequence entries, part 1079.
2280. gbinv108.seq - Invertebrate sequence entries, part 108.
2281. gbinv1080.seq - Invertebrate sequence entries, part 1080.
2282. gbinv1081.seq - Invertebrate sequence entries, part 1081.
2283. gbinv1082.seq - Invertebrate sequence entries, part 1082.
2284. gbinv1083.seq - Invertebrate sequence entries, part 1083.
2285. gbinv1084.seq - Invertebrate sequence entries, part 1084.
2286. gbinv1085.seq - Invertebrate sequence entries, part 1085.
2287. gbinv1086.seq - Invertebrate sequence entries, part 1086.
2288. gbinv1087.seq - Invertebrate sequence entries, part 1087.
2289. gbinv1088.seq - Invertebrate sequence entries, part 1088.
2290. gbinv1089.seq - Invertebrate sequence entries, part 1089.
2291. gbinv109.seq - Invertebrate sequence entries, part 109.
2292. gbinv1090.seq - Invertebrate sequence entries, part 1090.
2293. gbinv1091.seq - Invertebrate sequence entries, part 1091.
2294. gbinv1092.seq - Invertebrate sequence entries, part 1092.
2295. gbinv1093.seq - Invertebrate sequence entries, part 1093.
2296. gbinv1094.seq - Invertebrate sequence entries, part 1094.
2297. gbinv1095.seq - Invertebrate sequence entries, part 1095.
2298. gbinv1096.seq - Invertebrate sequence entries, part 1096.
2299. gbinv1097.seq - Invertebrate sequence entries, part 1097.
2300. gbinv1098.seq - Invertebrate sequence entries, part 1098.
2301. gbinv1099.seq - Invertebrate sequence entries, part 1099.
2302. gbinv11.seq - Invertebrate sequence entries, part 11.
2303. gbinv110.seq - Invertebrate sequence entries, part 110.
2304. gbinv1100.seq - Invertebrate sequence entries, part 1100.
2305. gbinv1101.seq - Invertebrate sequence entries, part 1101.
2306. gbinv1102.seq - Invertebrate sequence entries, part 1102.
2307. gbinv1103.seq - Invertebrate sequence entries, part 1103.
2308. gbinv1104.seq - Invertebrate sequence entries, part 1104.
2309. gbinv1105.seq - Invertebrate sequence entries, part 1105.
2310. gbinv1106.seq - Invertebrate sequence entries, part 1106.
2311. gbinv1107.seq - Invertebrate sequence entries, part 1107.
2312. gbinv1108.seq - Invertebrate sequence entries, part 1108.
2313. gbinv1109.seq - Invertebrate sequence entries, part 1109.
2314. gbinv111.seq - Invertebrate sequence entries, part 111.
2315. gbinv1110.seq - Invertebrate sequence entries, part 1110.
2316. gbinv1111.seq - Invertebrate sequence entries, part 1111.
2317. gbinv1112.seq - Invertebrate sequence entries, part 1112.
2318. gbinv1113.seq - Invertebrate sequence entries, part 1113.
2319. gbinv1114.seq - Invertebrate sequence entries, part 1114.
2320. gbinv1115.seq - Invertebrate sequence entries, part 1115.
2321. gbinv1116.seq - Invertebrate sequence entries, part 1116.
2322. gbinv1117.seq - Invertebrate sequence entries, part 1117.
2323. gbinv1118.seq - Invertebrate sequence entries, part 1118.
2324. gbinv1119.seq - Invertebrate sequence entries, part 1119.
2325. gbinv112.seq - Invertebrate sequence entries, part 112.
2326. gbinv1120.seq - Invertebrate sequence entries, part 1120.
2327. gbinv1121.seq - Invertebrate sequence entries, part 1121.
2328. gbinv1122.seq - Invertebrate sequence entries, part 1122.
2329. gbinv1123.seq - Invertebrate sequence entries, part 1123.
2330. gbinv1124.seq - Invertebrate sequence entries, part 1124.
2331. gbinv1125.seq - Invertebrate sequence entries, part 1125.
2332. gbinv1126.seq - Invertebrate sequence entries, part 1126.
2333. gbinv1127.seq - Invertebrate sequence entries, part 1127.
2334. gbinv1128.seq - Invertebrate sequence entries, part 1128.
2335. gbinv1129.seq - Invertebrate sequence entries, part 1129.
2336. gbinv113.seq - Invertebrate sequence entries, part 113.
2337. gbinv1130.seq - Invertebrate sequence entries, part 1130.
2338. gbinv1131.seq - Invertebrate sequence entries, part 1131.
2339. gbinv1132.seq - Invertebrate sequence entries, part 1132.
2340. gbinv1133.seq - Invertebrate sequence entries, part 1133.
2341. gbinv1134.seq - Invertebrate sequence entries, part 1134.
2342. gbinv1135.seq - Invertebrate sequence entries, part 1135.
2343. gbinv1136.seq - Invertebrate sequence entries, part 1136.
2344. gbinv1137.seq - Invertebrate sequence entries, part 1137.
2345. gbinv1138.seq - Invertebrate sequence entries, part 1138.
2346. gbinv1139.seq - Invertebrate sequence entries, part 1139.
2347. gbinv114.seq - Invertebrate sequence entries, part 114.
2348. gbinv1140.seq - Invertebrate sequence entries, part 1140.
2349. gbinv1141.seq - Invertebrate sequence entries, part 1141.
2350. gbinv1142.seq - Invertebrate sequence entries, part 1142.
2351. gbinv1143.seq - Invertebrate sequence entries, part 1143.
2352. gbinv1144.seq - Invertebrate sequence entries, part 1144.
2353. gbinv1145.seq - Invertebrate sequence entries, part 1145.
2354. gbinv1146.seq - Invertebrate sequence entries, part 1146.
2355. gbinv1147.seq - Invertebrate sequence entries, part 1147.
2356. gbinv1148.seq - Invertebrate sequence entries, part 1148.
2357. gbinv1149.seq - Invertebrate sequence entries, part 1149.
2358. gbinv115.seq - Invertebrate sequence entries, part 115.
2359. gbinv1150.seq - Invertebrate sequence entries, part 1150.
2360. gbinv1151.seq - Invertebrate sequence entries, part 1151.
2361. gbinv1152.seq - Invertebrate sequence entries, part 1152.
2362. gbinv1153.seq - Invertebrate sequence entries, part 1153.
2363. gbinv1154.seq - Invertebrate sequence entries, part 1154.
2364. gbinv1155.seq - Invertebrate sequence entries, part 1155.
2365. gbinv1156.seq - Invertebrate sequence entries, part 1156.
2366. gbinv1157.seq - Invertebrate sequence entries, part 1157.
2367. gbinv1158.seq - Invertebrate sequence entries, part 1158.
2368. gbinv1159.seq - Invertebrate sequence entries, part 1159.
2369. gbinv116.seq - Invertebrate sequence entries, part 116.
2370. gbinv1160.seq - Invertebrate sequence entries, part 1160.
2371. gbinv1161.seq - Invertebrate sequence entries, part 1161.
2372. gbinv1162.seq - Invertebrate sequence entries, part 1162.
2373. gbinv1163.seq - Invertebrate sequence entries, part 1163.
2374. gbinv1164.seq - Invertebrate sequence entries, part 1164.
2375. gbinv1165.seq - Invertebrate sequence entries, part 1165.
2376. gbinv1166.seq - Invertebrate sequence entries, part 1166.
2377. gbinv1167.seq - Invertebrate sequence entries, part 1167.
2378. gbinv1168.seq - Invertebrate sequence entries, part 1168.
2379. gbinv1169.seq - Invertebrate sequence entries, part 1169.
2380. gbinv117.seq - Invertebrate sequence entries, part 117.
2381. gbinv1170.seq - Invertebrate sequence entries, part 1170.
2382. gbinv1171.seq - Invertebrate sequence entries, part 1171.
2383. gbinv1172.seq - Invertebrate sequence entries, part 1172.
2384. gbinv1173.seq - Invertebrate sequence entries, part 1173.
2385. gbinv1174.seq - Invertebrate sequence entries, part 1174.
2386. gbinv1175.seq - Invertebrate sequence entries, part 1175.
2387. gbinv1176.seq - Invertebrate sequence entries, part 1176.
2388. gbinv1177.seq - Invertebrate sequence entries, part 1177.
2389. gbinv1178.seq - Invertebrate sequence entries, part 1178.
2390. gbinv1179.seq - Invertebrate sequence entries, part 1179.
2391. gbinv118.seq - Invertebrate sequence entries, part 118.
2392. gbinv1180.seq - Invertebrate sequence entries, part 1180.
2393. gbinv1181.seq - Invertebrate sequence entries, part 1181.
2394. gbinv1182.seq - Invertebrate sequence entries, part 1182.
2395. gbinv1183.seq - Invertebrate sequence entries, part 1183.
2396. gbinv1184.seq - Invertebrate sequence entries, part 1184.
2397. gbinv1185.seq - Invertebrate sequence entries, part 1185.
2398. gbinv1186.seq - Invertebrate sequence entries, part 1186.
2399. gbinv1187.seq - Invertebrate sequence entries, part 1187.
2400. gbinv1188.seq - Invertebrate sequence entries, part 1188.
2401. gbinv1189.seq - Invertebrate sequence entries, part 1189.
2402. gbinv119.seq - Invertebrate sequence entries, part 119.
2403. gbinv1190.seq - Invertebrate sequence entries, part 1190.
2404. gbinv1191.seq - Invertebrate sequence entries, part 1191.
2405. gbinv1192.seq - Invertebrate sequence entries, part 1192.
2406. gbinv1193.seq - Invertebrate sequence entries, part 1193.
2407. gbinv1194.seq - Invertebrate sequence entries, part 1194.
2408. gbinv1195.seq - Invertebrate sequence entries, part 1195.
2409. gbinv1196.seq - Invertebrate sequence entries, part 1196.
2410. gbinv1197.seq - Invertebrate sequence entries, part 1197.
2411. gbinv1198.seq - Invertebrate sequence entries, part 1198.
2412. gbinv1199.seq - Invertebrate sequence entries, part 1199.
2413. gbinv12.seq - Invertebrate sequence entries, part 12.
2414. gbinv120.seq - Invertebrate sequence entries, part 120.
2415. gbinv1200.seq - Invertebrate sequence entries, part 1200.
2416. gbinv1201.seq - Invertebrate sequence entries, part 1201.
2417. gbinv1202.seq - Invertebrate sequence entries, part 1202.
2418. gbinv1203.seq - Invertebrate sequence entries, part 1203.
2419. gbinv1204.seq - Invertebrate sequence entries, part 1204.
2420. gbinv1205.seq - Invertebrate sequence entries, part 1205.
2421. gbinv1206.seq - Invertebrate sequence entries, part 1206.
2422. gbinv1207.seq - Invertebrate sequence entries, part 1207.
2423. gbinv1208.seq - Invertebrate sequence entries, part 1208.
2424. gbinv1209.seq - Invertebrate sequence entries, part 1209.
2425. gbinv121.seq - Invertebrate sequence entries, part 121.
2426. gbinv1210.seq - Invertebrate sequence entries, part 1210.
2427. gbinv1211.seq - Invertebrate sequence entries, part 1211.
2428. gbinv1212.seq - Invertebrate sequence entries, part 1212.
2429. gbinv1213.seq - Invertebrate sequence entries, part 1213.
2430. gbinv1214.seq - Invertebrate sequence entries, part 1214.
2431. gbinv1215.seq - Invertebrate sequence entries, part 1215.
2432. gbinv1216.seq - Invertebrate sequence entries, part 1216.
2433. gbinv1217.seq - Invertebrate sequence entries, part 1217.
2434. gbinv1218.seq - Invertebrate sequence entries, part 1218.
2435. gbinv1219.seq - Invertebrate sequence entries, part 1219.
2436. gbinv122.seq - Invertebrate sequence entries, part 122.
2437. gbinv1220.seq - Invertebrate sequence entries, part 1220.
2438. gbinv1221.seq - Invertebrate sequence entries, part 1221.
2439. gbinv1222.seq - Invertebrate sequence entries, part 1222.
2440. gbinv1223.seq - Invertebrate sequence entries, part 1223.
2441. gbinv1224.seq - Invertebrate sequence entries, part 1224.
2442. gbinv1225.seq - Invertebrate sequence entries, part 1225.
2443. gbinv1226.seq - Invertebrate sequence entries, part 1226.
2444. gbinv1227.seq - Invertebrate sequence entries, part 1227.
2445. gbinv1228.seq - Invertebrate sequence entries, part 1228.
2446. gbinv1229.seq - Invertebrate sequence entries, part 1229.
2447. gbinv123.seq - Invertebrate sequence entries, part 123.
2448. gbinv1230.seq - Invertebrate sequence entries, part 1230.
2449. gbinv1231.seq - Invertebrate sequence entries, part 1231.
2450. gbinv1232.seq - Invertebrate sequence entries, part 1232.
2451. gbinv1233.seq - Invertebrate sequence entries, part 1233.
2452. gbinv1234.seq - Invertebrate sequence entries, part 1234.
2453. gbinv1235.seq - Invertebrate sequence entries, part 1235.
2454. gbinv1236.seq - Invertebrate sequence entries, part 1236.
2455. gbinv1237.seq - Invertebrate sequence entries, part 1237.
2456. gbinv1238.seq - Invertebrate sequence entries, part 1238.
2457. gbinv1239.seq - Invertebrate sequence entries, part 1239.
2458. gbinv124.seq - Invertebrate sequence entries, part 124.
2459. gbinv1240.seq - Invertebrate sequence entries, part 1240.
2460. gbinv1241.seq - Invertebrate sequence entries, part 1241.
2461. gbinv1242.seq - Invertebrate sequence entries, part 1242.
2462. gbinv1243.seq - Invertebrate sequence entries, part 1243.
2463. gbinv1244.seq - Invertebrate sequence entries, part 1244.
2464. gbinv1245.seq - Invertebrate sequence entries, part 1245.
2465. gbinv1246.seq - Invertebrate sequence entries, part 1246.
2466. gbinv1247.seq - Invertebrate sequence entries, part 1247.
2467. gbinv1248.seq - Invertebrate sequence entries, part 1248.
2468. gbinv1249.seq - Invertebrate sequence entries, part 1249.
2469. gbinv125.seq - Invertebrate sequence entries, part 125.
2470. gbinv1250.seq - Invertebrate sequence entries, part 1250.
2471. gbinv1251.seq - Invertebrate sequence entries, part 1251.
2472. gbinv1252.seq - Invertebrate sequence entries, part 1252.
2473. gbinv1253.seq - Invertebrate sequence entries, part 1253.
2474. gbinv1254.seq - Invertebrate sequence entries, part 1254.
2475. gbinv1255.seq - Invertebrate sequence entries, part 1255.
2476. gbinv1256.seq - Invertebrate sequence entries, part 1256.
2477. gbinv1257.seq - Invertebrate sequence entries, part 1257.
2478. gbinv1258.seq - Invertebrate sequence entries, part 1258.
2479. gbinv1259.seq - Invertebrate sequence entries, part 1259.
2480. gbinv126.seq - Invertebrate sequence entries, part 126.
2481. gbinv1260.seq - Invertebrate sequence entries, part 1260.
2482. gbinv1261.seq - Invertebrate sequence entries, part 1261.
2483. gbinv1262.seq - Invertebrate sequence entries, part 1262.
2484. gbinv1263.seq - Invertebrate sequence entries, part 1263.
2485. gbinv1264.seq - Invertebrate sequence entries, part 1264.
2486. gbinv1265.seq - Invertebrate sequence entries, part 1265.
2487. gbinv1266.seq - Invertebrate sequence entries, part 1266.
2488. gbinv1267.seq - Invertebrate sequence entries, part 1267.
2489. gbinv1268.seq - Invertebrate sequence entries, part 1268.
2490. gbinv1269.seq - Invertebrate sequence entries, part 1269.
2491. gbinv127.seq - Invertebrate sequence entries, part 127.
2492. gbinv1270.seq - Invertebrate sequence entries, part 1270.
2493. gbinv1271.seq - Invertebrate sequence entries, part 1271.
2494. gbinv1272.seq - Invertebrate sequence entries, part 1272.
2495. gbinv1273.seq - Invertebrate sequence entries, part 1273.
2496. gbinv1274.seq - Invertebrate sequence entries, part 1274.
2497. gbinv1275.seq - Invertebrate sequence entries, part 1275.
2498. gbinv1276.seq - Invertebrate sequence entries, part 1276.
2499. gbinv1277.seq - Invertebrate sequence entries, part 1277.
2500. gbinv1278.seq - Invertebrate sequence entries, part 1278.
2501. gbinv1279.seq - Invertebrate sequence entries, part 1279.
2502. gbinv128.seq - Invertebrate sequence entries, part 128.
2503. gbinv1280.seq - Invertebrate sequence entries, part 1280.
2504. gbinv1281.seq - Invertebrate sequence entries, part 1281.
2505. gbinv1282.seq - Invertebrate sequence entries, part 1282.
2506. gbinv1283.seq - Invertebrate sequence entries, part 1283.
2507. gbinv1284.seq - Invertebrate sequence entries, part 1284.
2508. gbinv1285.seq - Invertebrate sequence entries, part 1285.
2509. gbinv1286.seq - Invertebrate sequence entries, part 1286.
2510. gbinv1287.seq - Invertebrate sequence entries, part 1287.
2511. gbinv1288.seq - Invertebrate sequence entries, part 1288.
2512. gbinv1289.seq - Invertebrate sequence entries, part 1289.
2513. gbinv129.seq - Invertebrate sequence entries, part 129.
2514. gbinv1290.seq - Invertebrate sequence entries, part 1290.
2515. gbinv1291.seq - Invertebrate sequence entries, part 1291.
2516. gbinv1292.seq - Invertebrate sequence entries, part 1292.
2517. gbinv1293.seq - Invertebrate sequence entries, part 1293.
2518. gbinv1294.seq - Invertebrate sequence entries, part 1294.
2519. gbinv1295.seq - Invertebrate sequence entries, part 1295.
2520. gbinv1296.seq - Invertebrate sequence entries, part 1296.
2521. gbinv1297.seq - Invertebrate sequence entries, part 1297.
2522. gbinv1298.seq - Invertebrate sequence entries, part 1298.
2523. gbinv1299.seq - Invertebrate sequence entries, part 1299.
2524. gbinv13.seq - Invertebrate sequence entries, part 13.
2525. gbinv130.seq - Invertebrate sequence entries, part 130.
2526. gbinv1300.seq - Invertebrate sequence entries, part 1300.
2527. gbinv1301.seq - Invertebrate sequence entries, part 1301.
2528. gbinv1302.seq - Invertebrate sequence entries, part 1302.
2529. gbinv1303.seq - Invertebrate sequence entries, part 1303.
2530. gbinv1304.seq - Invertebrate sequence entries, part 1304.
2531. gbinv1305.seq - Invertebrate sequence entries, part 1305.
2532. gbinv1306.seq - Invertebrate sequence entries, part 1306.
2533. gbinv1307.seq - Invertebrate sequence entries, part 1307.
2534. gbinv1308.seq - Invertebrate sequence entries, part 1308.
2535. gbinv1309.seq - Invertebrate sequence entries, part 1309.
2536. gbinv131.seq - Invertebrate sequence entries, part 131.
2537. gbinv1310.seq - Invertebrate sequence entries, part 1310.
2538. gbinv1311.seq - Invertebrate sequence entries, part 1311.
2539. gbinv1312.seq - Invertebrate sequence entries, part 1312.
2540. gbinv1313.seq - Invertebrate sequence entries, part 1313.
2541. gbinv1314.seq - Invertebrate sequence entries, part 1314.
2542. gbinv1315.seq - Invertebrate sequence entries, part 1315.
2543. gbinv1316.seq - Invertebrate sequence entries, part 1316.
2544. gbinv1317.seq - Invertebrate sequence entries, part 1317.
2545. gbinv1318.seq - Invertebrate sequence entries, part 1318.
2546. gbinv1319.seq - Invertebrate sequence entries, part 1319.
2547. gbinv132.seq - Invertebrate sequence entries, part 132.
2548. gbinv1320.seq - Invertebrate sequence entries, part 1320.
2549. gbinv1321.seq - Invertebrate sequence entries, part 1321.
2550. gbinv1322.seq - Invertebrate sequence entries, part 1322.
2551. gbinv1323.seq - Invertebrate sequence entries, part 1323.
2552. gbinv1324.seq - Invertebrate sequence entries, part 1324.
2553. gbinv1325.seq - Invertebrate sequence entries, part 1325.
2554. gbinv1326.seq - Invertebrate sequence entries, part 1326.
2555. gbinv1327.seq - Invertebrate sequence entries, part 1327.
2556. gbinv1328.seq - Invertebrate sequence entries, part 1328.
2557. gbinv1329.seq - Invertebrate sequence entries, part 1329.
2558. gbinv133.seq - Invertebrate sequence entries, part 133.
2559. gbinv1330.seq - Invertebrate sequence entries, part 1330.
2560. gbinv1331.seq - Invertebrate sequence entries, part 1331.
2561. gbinv1332.seq - Invertebrate sequence entries, part 1332.
2562. gbinv1333.seq - Invertebrate sequence entries, part 1333.
2563. gbinv1334.seq - Invertebrate sequence entries, part 1334.
2564. gbinv1335.seq - Invertebrate sequence entries, part 1335.
2565. gbinv1336.seq - Invertebrate sequence entries, part 1336.
2566. gbinv1337.seq - Invertebrate sequence entries, part 1337.
2567. gbinv1338.seq - Invertebrate sequence entries, part 1338.
2568. gbinv1339.seq - Invertebrate sequence entries, part 1339.
2569. gbinv134.seq - Invertebrate sequence entries, part 134.
2570. gbinv1340.seq - Invertebrate sequence entries, part 1340.
2571. gbinv1341.seq - Invertebrate sequence entries, part 1341.
2572. gbinv1342.seq - Invertebrate sequence entries, part 1342.
2573. gbinv1343.seq - Invertebrate sequence entries, part 1343.
2574. gbinv1344.seq - Invertebrate sequence entries, part 1344.
2575. gbinv1345.seq - Invertebrate sequence entries, part 1345.
2576. gbinv1346.seq - Invertebrate sequence entries, part 1346.
2577. gbinv1347.seq - Invertebrate sequence entries, part 1347.
2578. gbinv1348.seq - Invertebrate sequence entries, part 1348.
2579. gbinv1349.seq - Invertebrate sequence entries, part 1349.
2580. gbinv135.seq - Invertebrate sequence entries, part 135.
2581. gbinv1350.seq - Invertebrate sequence entries, part 1350.
2582. gbinv1351.seq - Invertebrate sequence entries, part 1351.
2583. gbinv1352.seq - Invertebrate sequence entries, part 1352.
2584. gbinv1353.seq - Invertebrate sequence entries, part 1353.
2585. gbinv1354.seq - Invertebrate sequence entries, part 1354.
2586. gbinv1355.seq - Invertebrate sequence entries, part 1355.
2587. gbinv1356.seq - Invertebrate sequence entries, part 1356.
2588. gbinv1357.seq - Invertebrate sequence entries, part 1357.
2589. gbinv1358.seq - Invertebrate sequence entries, part 1358.
2590. gbinv1359.seq - Invertebrate sequence entries, part 1359.
2591. gbinv136.seq - Invertebrate sequence entries, part 136.
2592. gbinv1360.seq - Invertebrate sequence entries, part 1360.
2593. gbinv1361.seq - Invertebrate sequence entries, part 1361.
2594. gbinv1362.seq - Invertebrate sequence entries, part 1362.
2595. gbinv1363.seq - Invertebrate sequence entries, part 1363.
2596. gbinv1364.seq - Invertebrate sequence entries, part 1364.
2597. gbinv1365.seq - Invertebrate sequence entries, part 1365.
2598. gbinv1366.seq - Invertebrate sequence entries, part 1366.
2599. gbinv1367.seq - Invertebrate sequence entries, part 1367.
2600. gbinv1368.seq - Invertebrate sequence entries, part 1368.
2601. gbinv1369.seq - Invertebrate sequence entries, part 1369.
2602. gbinv137.seq - Invertebrate sequence entries, part 137.
2603. gbinv1370.seq - Invertebrate sequence entries, part 1370.
2604. gbinv1371.seq - Invertebrate sequence entries, part 1371.
2605. gbinv1372.seq - Invertebrate sequence entries, part 1372.
2606. gbinv1373.seq - Invertebrate sequence entries, part 1373.
2607. gbinv1374.seq - Invertebrate sequence entries, part 1374.
2608. gbinv1375.seq - Invertebrate sequence entries, part 1375.
2609. gbinv1376.seq - Invertebrate sequence entries, part 1376.
2610. gbinv1377.seq - Invertebrate sequence entries, part 1377.
2611. gbinv1378.seq - Invertebrate sequence entries, part 1378.
2612. gbinv1379.seq - Invertebrate sequence entries, part 1379.
2613. gbinv138.seq - Invertebrate sequence entries, part 138.
2614. gbinv1380.seq - Invertebrate sequence entries, part 1380.
2615. gbinv139.seq - Invertebrate sequence entries, part 139.
2616. gbinv14.seq - Invertebrate sequence entries, part 14.
2617. gbinv140.seq - Invertebrate sequence entries, part 140.
2618. gbinv141.seq - Invertebrate sequence entries, part 141.
2619. gbinv142.seq - Invertebrate sequence entries, part 142.
2620. gbinv143.seq - Invertebrate sequence entries, part 143.
2621. gbinv144.seq - Invertebrate sequence entries, part 144.
2622. gbinv145.seq - Invertebrate sequence entries, part 145.
2623. gbinv146.seq - Invertebrate sequence entries, part 146.
2624. gbinv147.seq - Invertebrate sequence entries, part 147.
2625. gbinv148.seq - Invertebrate sequence entries, part 148.
2626. gbinv149.seq - Invertebrate sequence entries, part 149.
2627. gbinv15.seq - Invertebrate sequence entries, part 15.
2628. gbinv150.seq - Invertebrate sequence entries, part 150.
2629. gbinv151.seq - Invertebrate sequence entries, part 151.
2630. gbinv152.seq - Invertebrate sequence entries, part 152.
2631. gbinv153.seq - Invertebrate sequence entries, part 153.
2632. gbinv154.seq - Invertebrate sequence entries, part 154.
2633. gbinv155.seq - Invertebrate sequence entries, part 155.
2634. gbinv156.seq - Invertebrate sequence entries, part 156.
2635. gbinv157.seq - Invertebrate sequence entries, part 157.
2636. gbinv158.seq - Invertebrate sequence entries, part 158.
2637. gbinv159.seq - Invertebrate sequence entries, part 159.
2638. gbinv16.seq - Invertebrate sequence entries, part 16.
2639. gbinv160.seq - Invertebrate sequence entries, part 160.
2640. gbinv161.seq - Invertebrate sequence entries, part 161.
2641. gbinv162.seq - Invertebrate sequence entries, part 162.
2642. gbinv163.seq - Invertebrate sequence entries, part 163.
2643. gbinv164.seq - Invertebrate sequence entries, part 164.
2644. gbinv165.seq - Invertebrate sequence entries, part 165.
2645. gbinv166.seq - Invertebrate sequence entries, part 166.
2646. gbinv167.seq - Invertebrate sequence entries, part 167.
2647. gbinv168.seq - Invertebrate sequence entries, part 168.
2648. gbinv169.seq - Invertebrate sequence entries, part 169.
2649. gbinv17.seq - Invertebrate sequence entries, part 17.
2650. gbinv170.seq - Invertebrate sequence entries, part 170.
2651. gbinv171.seq - Invertebrate sequence entries, part 171.
2652. gbinv172.seq - Invertebrate sequence entries, part 172.
2653. gbinv173.seq - Invertebrate sequence entries, part 173.
2654. gbinv174.seq - Invertebrate sequence entries, part 174.
2655. gbinv175.seq - Invertebrate sequence entries, part 175.
2656. gbinv176.seq - Invertebrate sequence entries, part 176.
2657. gbinv177.seq - Invertebrate sequence entries, part 177.
2658. gbinv178.seq - Invertebrate sequence entries, part 178.
2659. gbinv179.seq - Invertebrate sequence entries, part 179.
2660. gbinv18.seq - Invertebrate sequence entries, part 18.
2661. gbinv180.seq - Invertebrate sequence entries, part 180.
2662. gbinv181.seq - Invertebrate sequence entries, part 181.
2663. gbinv182.seq - Invertebrate sequence entries, part 182.
2664. gbinv183.seq - Invertebrate sequence entries, part 183.
2665. gbinv184.seq - Invertebrate sequence entries, part 184.
2666. gbinv185.seq - Invertebrate sequence entries, part 185.
2667. gbinv186.seq - Invertebrate sequence entries, part 186.
2668. gbinv187.seq - Invertebrate sequence entries, part 187.
2669. gbinv188.seq - Invertebrate sequence entries, part 188.
2670. gbinv189.seq - Invertebrate sequence entries, part 189.
2671. gbinv19.seq - Invertebrate sequence entries, part 19.
2672. gbinv190.seq - Invertebrate sequence entries, part 190.
2673. gbinv191.seq - Invertebrate sequence entries, part 191.
2674. gbinv192.seq - Invertebrate sequence entries, part 192.
2675. gbinv193.seq - Invertebrate sequence entries, part 193.
2676. gbinv194.seq - Invertebrate sequence entries, part 194.
2677. gbinv195.seq - Invertebrate sequence entries, part 195.
2678. gbinv196.seq - Invertebrate sequence entries, part 196.
2679. gbinv197.seq - Invertebrate sequence entries, part 197.
2680. gbinv198.seq - Invertebrate sequence entries, part 198.
2681. gbinv199.seq - Invertebrate sequence entries, part 199.
2682. gbinv2.seq - Invertebrate sequence entries, part 2.
2683. gbinv20.seq - Invertebrate sequence entries, part 20.
2684. gbinv200.seq - Invertebrate sequence entries, part 200.
2685. gbinv201.seq - Invertebrate sequence entries, part 201.
2686. gbinv202.seq - Invertebrate sequence entries, part 202.
2687. gbinv203.seq - Invertebrate sequence entries, part 203.
2688. gbinv204.seq - Invertebrate sequence entries, part 204.
2689. gbinv205.seq - Invertebrate sequence entries, part 205.
2690. gbinv206.seq - Invertebrate sequence entries, part 206.
2691. gbinv207.seq - Invertebrate sequence entries, part 207.
2692. gbinv208.seq - Invertebrate sequence entries, part 208.
2693. gbinv209.seq - Invertebrate sequence entries, part 209.
2694. gbinv21.seq - Invertebrate sequence entries, part 21.
2695. gbinv210.seq - Invertebrate sequence entries, part 210.
2696. gbinv211.seq - Invertebrate sequence entries, part 211.
2697. gbinv212.seq - Invertebrate sequence entries, part 212.
2698. gbinv213.seq - Invertebrate sequence entries, part 213.
2699. gbinv214.seq - Invertebrate sequence entries, part 214.
2700. gbinv215.seq - Invertebrate sequence entries, part 215.
2701. gbinv216.seq - Invertebrate sequence entries, part 216.
2702. gbinv217.seq - Invertebrate sequence entries, part 217.
2703. gbinv218.seq - Invertebrate sequence entries, part 218.
2704. gbinv219.seq - Invertebrate sequence entries, part 219.
2705. gbinv22.seq - Invertebrate sequence entries, part 22.
2706. gbinv220.seq - Invertebrate sequence entries, part 220.
2707. gbinv221.seq - Invertebrate sequence entries, part 221.
2708. gbinv222.seq - Invertebrate sequence entries, part 222.
2709. gbinv223.seq - Invertebrate sequence entries, part 223.
2710. gbinv224.seq - Invertebrate sequence entries, part 224.
2711. gbinv225.seq - Invertebrate sequence entries, part 225.
2712. gbinv226.seq - Invertebrate sequence entries, part 226.
2713. gbinv227.seq - Invertebrate sequence entries, part 227.
2714. gbinv228.seq - Invertebrate sequence entries, part 228.
2715. gbinv229.seq - Invertebrate sequence entries, part 229.
2716. gbinv23.seq - Invertebrate sequence entries, part 23.
2717. gbinv230.seq - Invertebrate sequence entries, part 230.
2718. gbinv231.seq - Invertebrate sequence entries, part 231.
2719. gbinv232.seq - Invertebrate sequence entries, part 232.
2720. gbinv233.seq - Invertebrate sequence entries, part 233.
2721. gbinv234.seq - Invertebrate sequence entries, part 234.
2722. gbinv235.seq - Invertebrate sequence entries, part 235.
2723. gbinv236.seq - Invertebrate sequence entries, part 236.
2724. gbinv237.seq - Invertebrate sequence entries, part 237.
2725. gbinv238.seq - Invertebrate sequence entries, part 238.
2726. gbinv239.seq - Invertebrate sequence entries, part 239.
2727. gbinv24.seq - Invertebrate sequence entries, part 24.
2728. gbinv240.seq - Invertebrate sequence entries, part 240.
2729. gbinv241.seq - Invertebrate sequence entries, part 241.
2730. gbinv242.seq - Invertebrate sequence entries, part 242.
2731. gbinv243.seq - Invertebrate sequence entries, part 243.
2732. gbinv244.seq - Invertebrate sequence entries, part 244.
2733. gbinv245.seq - Invertebrate sequence entries, part 245.
2734. gbinv246.seq - Invertebrate sequence entries, part 246.
2735. gbinv247.seq - Invertebrate sequence entries, part 247.
2736. gbinv248.seq - Invertebrate sequence entries, part 248.
2737. gbinv249.seq - Invertebrate sequence entries, part 249.
2738. gbinv25.seq - Invertebrate sequence entries, part 25.
2739. gbinv250.seq - Invertebrate sequence entries, part 250.
2740. gbinv251.seq - Invertebrate sequence entries, part 251.
2741. gbinv252.seq - Invertebrate sequence entries, part 252.
2742. gbinv253.seq - Invertebrate sequence entries, part 253.
2743. gbinv254.seq - Invertebrate sequence entries, part 254.
2744. gbinv255.seq - Invertebrate sequence entries, part 255.
2745. gbinv256.seq - Invertebrate sequence entries, part 256.
2746. gbinv257.seq - Invertebrate sequence entries, part 257.
2747. gbinv258.seq - Invertebrate sequence entries, part 258.
2748. gbinv259.seq - Invertebrate sequence entries, part 259.
2749. gbinv26.seq - Invertebrate sequence entries, part 26.
2750. gbinv260.seq - Invertebrate sequence entries, part 260.
2751. gbinv261.seq - Invertebrate sequence entries, part 261.
2752. gbinv262.seq - Invertebrate sequence entries, part 262.
2753. gbinv263.seq - Invertebrate sequence entries, part 263.
2754. gbinv264.seq - Invertebrate sequence entries, part 264.
2755. gbinv265.seq - Invertebrate sequence entries, part 265.
2756. gbinv266.seq - Invertebrate sequence entries, part 266.
2757. gbinv267.seq - Invertebrate sequence entries, part 267.
2758. gbinv268.seq - Invertebrate sequence entries, part 268.
2759. gbinv269.seq - Invertebrate sequence entries, part 269.
2760. gbinv27.seq - Invertebrate sequence entries, part 27.
2761. gbinv270.seq - Invertebrate sequence entries, part 270.
2762. gbinv271.seq - Invertebrate sequence entries, part 271.
2763. gbinv272.seq - Invertebrate sequence entries, part 272.
2764. gbinv273.seq - Invertebrate sequence entries, part 273.
2765. gbinv274.seq - Invertebrate sequence entries, part 274.
2766. gbinv275.seq - Invertebrate sequence entries, part 275.
2767. gbinv276.seq - Invertebrate sequence entries, part 276.
2768. gbinv277.seq - Invertebrate sequence entries, part 277.
2769. gbinv278.seq - Invertebrate sequence entries, part 278.
2770. gbinv279.seq - Invertebrate sequence entries, part 279.
2771. gbinv28.seq - Invertebrate sequence entries, part 28.
2772. gbinv280.seq - Invertebrate sequence entries, part 280.
2773. gbinv281.seq - Invertebrate sequence entries, part 281.
2774. gbinv282.seq - Invertebrate sequence entries, part 282.
2775. gbinv283.seq - Invertebrate sequence entries, part 283.
2776. gbinv284.seq - Invertebrate sequence entries, part 284.
2777. gbinv285.seq - Invertebrate sequence entries, part 285.
2778. gbinv286.seq - Invertebrate sequence entries, part 286.
2779. gbinv287.seq - Invertebrate sequence entries, part 287.
2780. gbinv288.seq - Invertebrate sequence entries, part 288.
2781. gbinv289.seq - Invertebrate sequence entries, part 289.
2782. gbinv29.seq - Invertebrate sequence entries, part 29.
2783. gbinv290.seq - Invertebrate sequence entries, part 290.
2784. gbinv291.seq - Invertebrate sequence entries, part 291.
2785. gbinv292.seq - Invertebrate sequence entries, part 292.
2786. gbinv293.seq - Invertebrate sequence entries, part 293.
2787. gbinv294.seq - Invertebrate sequence entries, part 294.
2788. gbinv295.seq - Invertebrate sequence entries, part 295.
2789. gbinv296.seq - Invertebrate sequence entries, part 296.
2790. gbinv297.seq - Invertebrate sequence entries, part 297.
2791. gbinv298.seq - Invertebrate sequence entries, part 298.
2792. gbinv299.seq - Invertebrate sequence entries, part 299.
2793. gbinv3.seq - Invertebrate sequence entries, part 3.
2794. gbinv30.seq - Invertebrate sequence entries, part 30.
2795. gbinv300.seq - Invertebrate sequence entries, part 300.
2796. gbinv301.seq - Invertebrate sequence entries, part 301.
2797. gbinv302.seq - Invertebrate sequence entries, part 302.
2798. gbinv303.seq - Invertebrate sequence entries, part 303.
2799. gbinv304.seq - Invertebrate sequence entries, part 304.
2800. gbinv305.seq - Invertebrate sequence entries, part 305.
2801. gbinv306.seq - Invertebrate sequence entries, part 306.
2802. gbinv307.seq - Invertebrate sequence entries, part 307.
2803. gbinv308.seq - Invertebrate sequence entries, part 308.
2804. gbinv309.seq - Invertebrate sequence entries, part 309.
2805. gbinv31.seq - Invertebrate sequence entries, part 31.
2806. gbinv310.seq - Invertebrate sequence entries, part 310.
2807. gbinv311.seq - Invertebrate sequence entries, part 311.
2808. gbinv312.seq - Invertebrate sequence entries, part 312.
2809. gbinv313.seq - Invertebrate sequence entries, part 313.
2810. gbinv314.seq - Invertebrate sequence entries, part 314.
2811. gbinv315.seq - Invertebrate sequence entries, part 315.
2812. gbinv316.seq - Invertebrate sequence entries, part 316.
2813. gbinv317.seq - Invertebrate sequence entries, part 317.
2814. gbinv318.seq - Invertebrate sequence entries, part 318.
2815. gbinv319.seq - Invertebrate sequence entries, part 319.
2816. gbinv32.seq - Invertebrate sequence entries, part 32.
2817. gbinv320.seq - Invertebrate sequence entries, part 320.
2818. gbinv321.seq - Invertebrate sequence entries, part 321.
2819. gbinv322.seq - Invertebrate sequence entries, part 322.
2820. gbinv323.seq - Invertebrate sequence entries, part 323.
2821. gbinv324.seq - Invertebrate sequence entries, part 324.
2822. gbinv325.seq - Invertebrate sequence entries, part 325.
2823. gbinv326.seq - Invertebrate sequence entries, part 326.
2824. gbinv327.seq - Invertebrate sequence entries, part 327.
2825. gbinv328.seq - Invertebrate sequence entries, part 328.
2826. gbinv329.seq - Invertebrate sequence entries, part 329.
2827. gbinv33.seq - Invertebrate sequence entries, part 33.
2828. gbinv330.seq - Invertebrate sequence entries, part 330.
2829. gbinv331.seq - Invertebrate sequence entries, part 331.
2830. gbinv332.seq - Invertebrate sequence entries, part 332.
2831. gbinv333.seq - Invertebrate sequence entries, part 333.
2832. gbinv334.seq - Invertebrate sequence entries, part 334.
2833. gbinv335.seq - Invertebrate sequence entries, part 335.
2834. gbinv336.seq - Invertebrate sequence entries, part 336.
2835. gbinv337.seq - Invertebrate sequence entries, part 337.
2836. gbinv338.seq - Invertebrate sequence entries, part 338.
2837. gbinv339.seq - Invertebrate sequence entries, part 339.
2838. gbinv34.seq - Invertebrate sequence entries, part 34.
2839. gbinv340.seq - Invertebrate sequence entries, part 340.
2840. gbinv341.seq - Invertebrate sequence entries, part 341.
2841. gbinv342.seq - Invertebrate sequence entries, part 342.
2842. gbinv343.seq - Invertebrate sequence entries, part 343.
2843. gbinv344.seq - Invertebrate sequence entries, part 344.
2844. gbinv345.seq - Invertebrate sequence entries, part 345.
2845. gbinv346.seq - Invertebrate sequence entries, part 346.
2846. gbinv347.seq - Invertebrate sequence entries, part 347.
2847. gbinv348.seq - Invertebrate sequence entries, part 348.
2848. gbinv349.seq - Invertebrate sequence entries, part 349.
2849. gbinv35.seq - Invertebrate sequence entries, part 35.
2850. gbinv350.seq - Invertebrate sequence entries, part 350.
2851. gbinv351.seq - Invertebrate sequence entries, part 351.
2852. gbinv352.seq - Invertebrate sequence entries, part 352.
2853. gbinv353.seq - Invertebrate sequence entries, part 353.
2854. gbinv354.seq - Invertebrate sequence entries, part 354.
2855. gbinv355.seq - Invertebrate sequence entries, part 355.
2856. gbinv356.seq - Invertebrate sequence entries, part 356.
2857. gbinv357.seq - Invertebrate sequence entries, part 357.
2858. gbinv358.seq - Invertebrate sequence entries, part 358.
2859. gbinv359.seq - Invertebrate sequence entries, part 359.
2860. gbinv36.seq - Invertebrate sequence entries, part 36.
2861. gbinv360.seq - Invertebrate sequence entries, part 360.
2862. gbinv361.seq - Invertebrate sequence entries, part 361.
2863. gbinv362.seq - Invertebrate sequence entries, part 362.
2864. gbinv363.seq - Invertebrate sequence entries, part 363.
2865. gbinv364.seq - Invertebrate sequence entries, part 364.
2866. gbinv365.seq - Invertebrate sequence entries, part 365.
2867. gbinv366.seq - Invertebrate sequence entries, part 366.
2868. gbinv367.seq - Invertebrate sequence entries, part 367.
2869. gbinv368.seq - Invertebrate sequence entries, part 368.
2870. gbinv369.seq - Invertebrate sequence entries, part 369.
2871. gbinv37.seq - Invertebrate sequence entries, part 37.
2872. gbinv370.seq - Invertebrate sequence entries, part 370.
2873. gbinv371.seq - Invertebrate sequence entries, part 371.
2874. gbinv372.seq - Invertebrate sequence entries, part 372.
2875. gbinv373.seq - Invertebrate sequence entries, part 373.
2876. gbinv374.seq - Invertebrate sequence entries, part 374.
2877. gbinv375.seq - Invertebrate sequence entries, part 375.
2878. gbinv376.seq - Invertebrate sequence entries, part 376.
2879. gbinv377.seq - Invertebrate sequence entries, part 377.
2880. gbinv378.seq - Invertebrate sequence entries, part 378.
2881. gbinv379.seq - Invertebrate sequence entries, part 379.
2882. gbinv38.seq - Invertebrate sequence entries, part 38.
2883. gbinv380.seq - Invertebrate sequence entries, part 380.
2884. gbinv381.seq - Invertebrate sequence entries, part 381.
2885. gbinv382.seq - Invertebrate sequence entries, part 382.
2886. gbinv383.seq - Invertebrate sequence entries, part 383.
2887. gbinv384.seq - Invertebrate sequence entries, part 384.
2888. gbinv385.seq - Invertebrate sequence entries, part 385.
2889. gbinv386.seq - Invertebrate sequence entries, part 386.
2890. gbinv387.seq - Invertebrate sequence entries, part 387.
2891. gbinv388.seq - Invertebrate sequence entries, part 388.
2892. gbinv389.seq - Invertebrate sequence entries, part 389.
2893. gbinv39.seq - Invertebrate sequence entries, part 39.
2894. gbinv390.seq - Invertebrate sequence entries, part 390.
2895. gbinv391.seq - Invertebrate sequence entries, part 391.
2896. gbinv392.seq - Invertebrate sequence entries, part 392.
2897. gbinv393.seq - Invertebrate sequence entries, part 393.
2898. gbinv394.seq - Invertebrate sequence entries, part 394.
2899. gbinv395.seq - Invertebrate sequence entries, part 395.
2900. gbinv396.seq - Invertebrate sequence entries, part 396.
2901. gbinv397.seq - Invertebrate sequence entries, part 397.
2902. gbinv398.seq - Invertebrate sequence entries, part 398.
2903. gbinv399.seq - Invertebrate sequence entries, part 399.
2904. gbinv4.seq - Invertebrate sequence entries, part 4.
2905. gbinv40.seq - Invertebrate sequence entries, part 40.
2906. gbinv400.seq - Invertebrate sequence entries, part 400.
2907. gbinv401.seq - Invertebrate sequence entries, part 401.
2908. gbinv402.seq - Invertebrate sequence entries, part 402.
2909. gbinv403.seq - Invertebrate sequence entries, part 403.
2910. gbinv404.seq - Invertebrate sequence entries, part 404.
2911. gbinv405.seq - Invertebrate sequence entries, part 405.
2912. gbinv406.seq - Invertebrate sequence entries, part 406.
2913. gbinv407.seq - Invertebrate sequence entries, part 407.
2914. gbinv408.seq - Invertebrate sequence entries, part 408.
2915. gbinv409.seq - Invertebrate sequence entries, part 409.
2916. gbinv41.seq - Invertebrate sequence entries, part 41.
2917. gbinv410.seq - Invertebrate sequence entries, part 410.
2918. gbinv411.seq - Invertebrate sequence entries, part 411.
2919. gbinv412.seq - Invertebrate sequence entries, part 412.
2920. gbinv413.seq - Invertebrate sequence entries, part 413.
2921. gbinv414.seq - Invertebrate sequence entries, part 414.
2922. gbinv415.seq - Invertebrate sequence entries, part 415.
2923. gbinv416.seq - Invertebrate sequence entries, part 416.
2924. gbinv417.seq - Invertebrate sequence entries, part 417.
2925. gbinv418.seq - Invertebrate sequence entries, part 418.
2926. gbinv419.seq - Invertebrate sequence entries, part 419.
2927. gbinv42.seq - Invertebrate sequence entries, part 42.
2928. gbinv420.seq - Invertebrate sequence entries, part 420.
2929. gbinv421.seq - Invertebrate sequence entries, part 421.
2930. gbinv422.seq - Invertebrate sequence entries, part 422.
2931. gbinv423.seq - Invertebrate sequence entries, part 423.
2932. gbinv424.seq - Invertebrate sequence entries, part 424.
2933. gbinv425.seq - Invertebrate sequence entries, part 425.
2934. gbinv426.seq - Invertebrate sequence entries, part 426.
2935. gbinv427.seq - Invertebrate sequence entries, part 427.
2936. gbinv428.seq - Invertebrate sequence entries, part 428.
2937. gbinv429.seq - Invertebrate sequence entries, part 429.
2938. gbinv43.seq - Invertebrate sequence entries, part 43.
2939. gbinv430.seq - Invertebrate sequence entries, part 430.
2940. gbinv431.seq - Invertebrate sequence entries, part 431.
2941. gbinv432.seq - Invertebrate sequence entries, part 432.
2942. gbinv433.seq - Invertebrate sequence entries, part 433.
2943. gbinv434.seq - Invertebrate sequence entries, part 434.
2944. gbinv435.seq - Invertebrate sequence entries, part 435.
2945. gbinv436.seq - Invertebrate sequence entries, part 436.
2946. gbinv437.seq - Invertebrate sequence entries, part 437.
2947. gbinv438.seq - Invertebrate sequence entries, part 438.
2948. gbinv439.seq - Invertebrate sequence entries, part 439.
2949. gbinv44.seq - Invertebrate sequence entries, part 44.
2950. gbinv440.seq - Invertebrate sequence entries, part 440.
2951. gbinv441.seq - Invertebrate sequence entries, part 441.
2952. gbinv442.seq - Invertebrate sequence entries, part 442.
2953. gbinv443.seq - Invertebrate sequence entries, part 443.
2954. gbinv444.seq - Invertebrate sequence entries, part 444.
2955. gbinv445.seq - Invertebrate sequence entries, part 445.
2956. gbinv446.seq - Invertebrate sequence entries, part 446.
2957. gbinv447.seq - Invertebrate sequence entries, part 447.
2958. gbinv448.seq - Invertebrate sequence entries, part 448.
2959. gbinv449.seq - Invertebrate sequence entries, part 449.
2960. gbinv45.seq - Invertebrate sequence entries, part 45.
2961. gbinv450.seq - Invertebrate sequence entries, part 450.
2962. gbinv451.seq - Invertebrate sequence entries, part 451.
2963. gbinv452.seq - Invertebrate sequence entries, part 452.
2964. gbinv453.seq - Invertebrate sequence entries, part 453.
2965. gbinv454.seq - Invertebrate sequence entries, part 454.
2966. gbinv455.seq - Invertebrate sequence entries, part 455.
2967. gbinv456.seq - Invertebrate sequence entries, part 456.
2968. gbinv457.seq - Invertebrate sequence entries, part 457.
2969. gbinv458.seq - Invertebrate sequence entries, part 458.
2970. gbinv459.seq - Invertebrate sequence entries, part 459.
2971. gbinv46.seq - Invertebrate sequence entries, part 46.
2972. gbinv460.seq - Invertebrate sequence entries, part 460.
2973. gbinv461.seq - Invertebrate sequence entries, part 461.
2974. gbinv462.seq - Invertebrate sequence entries, part 462.
2975. gbinv463.seq - Invertebrate sequence entries, part 463.
2976. gbinv464.seq - Invertebrate sequence entries, part 464.
2977. gbinv465.seq - Invertebrate sequence entries, part 465.
2978. gbinv466.seq - Invertebrate sequence entries, part 466.
2979. gbinv467.seq - Invertebrate sequence entries, part 467.
2980. gbinv468.seq - Invertebrate sequence entries, part 468.
2981. gbinv469.seq - Invertebrate sequence entries, part 469.
2982. gbinv47.seq - Invertebrate sequence entries, part 47.
2983. gbinv470.seq - Invertebrate sequence entries, part 470.
2984. gbinv471.seq - Invertebrate sequence entries, part 471.
2985. gbinv472.seq - Invertebrate sequence entries, part 472.
2986. gbinv473.seq - Invertebrate sequence entries, part 473.
2987. gbinv474.seq - Invertebrate sequence entries, part 474.
2988. gbinv475.seq - Invertebrate sequence entries, part 475.
2989. gbinv476.seq - Invertebrate sequence entries, part 476.
2990. gbinv477.seq - Invertebrate sequence entries, part 477.
2991. gbinv478.seq - Invertebrate sequence entries, part 478.
2992. gbinv479.seq - Invertebrate sequence entries, part 479.
2993. gbinv48.seq - Invertebrate sequence entries, part 48.
2994. gbinv480.seq - Invertebrate sequence entries, part 480.
2995. gbinv481.seq - Invertebrate sequence entries, part 481.
2996. gbinv482.seq - Invertebrate sequence entries, part 482.
2997. gbinv483.seq - Invertebrate sequence entries, part 483.
2998. gbinv484.seq - Invertebrate sequence entries, part 484.
2999. gbinv485.seq - Invertebrate sequence entries, part 485.
3000. gbinv486.seq - Invertebrate sequence entries, part 486.
3001. gbinv487.seq - Invertebrate sequence entries, part 487.
3002. gbinv488.seq - Invertebrate sequence entries, part 488.
3003. gbinv489.seq - Invertebrate sequence entries, part 489.
3004. gbinv49.seq - Invertebrate sequence entries, part 49.
3005. gbinv490.seq - Invertebrate sequence entries, part 490.
3006. gbinv491.seq - Invertebrate sequence entries, part 491.
3007. gbinv492.seq - Invertebrate sequence entries, part 492.
3008. gbinv493.seq - Invertebrate sequence entries, part 493.
3009. gbinv494.seq - Invertebrate sequence entries, part 494.
3010. gbinv495.seq - Invertebrate sequence entries, part 495.
3011. gbinv496.seq - Invertebrate sequence entries, part 496.
3012. gbinv497.seq - Invertebrate sequence entries, part 497.
3013. gbinv498.seq - Invertebrate sequence entries, part 498.
3014. gbinv499.seq - Invertebrate sequence entries, part 499.
3015. gbinv5.seq - Invertebrate sequence entries, part 5.
3016. gbinv50.seq - Invertebrate sequence entries, part 50.
3017. gbinv500.seq - Invertebrate sequence entries, part 500.
3018. gbinv501.seq - Invertebrate sequence entries, part 501.
3019. gbinv502.seq - Invertebrate sequence entries, part 502.
3020. gbinv503.seq - Invertebrate sequence entries, part 503.
3021. gbinv504.seq - Invertebrate sequence entries, part 504.
3022. gbinv505.seq - Invertebrate sequence entries, part 505.
3023. gbinv506.seq - Invertebrate sequence entries, part 506.
3024. gbinv507.seq - Invertebrate sequence entries, part 507.
3025. gbinv508.seq - Invertebrate sequence entries, part 508.
3026. gbinv509.seq - Invertebrate sequence entries, part 509.
3027. gbinv51.seq - Invertebrate sequence entries, part 51.
3028. gbinv510.seq - Invertebrate sequence entries, part 510.
3029. gbinv511.seq - Invertebrate sequence entries, part 511.
3030. gbinv512.seq - Invertebrate sequence entries, part 512.
3031. gbinv513.seq - Invertebrate sequence entries, part 513.
3032. gbinv514.seq - Invertebrate sequence entries, part 514.
3033. gbinv515.seq - Invertebrate sequence entries, part 515.
3034. gbinv516.seq - Invertebrate sequence entries, part 516.
3035. gbinv517.seq - Invertebrate sequence entries, part 517.
3036. gbinv518.seq - Invertebrate sequence entries, part 518.
3037. gbinv519.seq - Invertebrate sequence entries, part 519.
3038. gbinv52.seq - Invertebrate sequence entries, part 52.
3039. gbinv520.seq - Invertebrate sequence entries, part 520.
3040. gbinv521.seq - Invertebrate sequence entries, part 521.
3041. gbinv522.seq - Invertebrate sequence entries, part 522.
3042. gbinv523.seq - Invertebrate sequence entries, part 523.
3043. gbinv524.seq - Invertebrate sequence entries, part 524.
3044. gbinv525.seq - Invertebrate sequence entries, part 525.
3045. gbinv526.seq - Invertebrate sequence entries, part 526.
3046. gbinv527.seq - Invertebrate sequence entries, part 527.
3047. gbinv528.seq - Invertebrate sequence entries, part 528.
3048. gbinv529.seq - Invertebrate sequence entries, part 529.
3049. gbinv53.seq - Invertebrate sequence entries, part 53.
3050. gbinv530.seq - Invertebrate sequence entries, part 530.
3051. gbinv531.seq - Invertebrate sequence entries, part 531.
3052. gbinv532.seq - Invertebrate sequence entries, part 532.
3053. gbinv533.seq - Invertebrate sequence entries, part 533.
3054. gbinv534.seq - Invertebrate sequence entries, part 534.
3055. gbinv535.seq - Invertebrate sequence entries, part 535.
3056. gbinv536.seq - Invertebrate sequence entries, part 536.
3057. gbinv537.seq - Invertebrate sequence entries, part 537.
3058. gbinv538.seq - Invertebrate sequence entries, part 538.
3059. gbinv539.seq - Invertebrate sequence entries, part 539.
3060. gbinv54.seq - Invertebrate sequence entries, part 54.
3061. gbinv540.seq - Invertebrate sequence entries, part 540.
3062. gbinv541.seq - Invertebrate sequence entries, part 541.
3063. gbinv542.seq - Invertebrate sequence entries, part 542.
3064. gbinv543.seq - Invertebrate sequence entries, part 543.
3065. gbinv544.seq - Invertebrate sequence entries, part 544.
3066. gbinv545.seq - Invertebrate sequence entries, part 545.
3067. gbinv546.seq - Invertebrate sequence entries, part 546.
3068. gbinv547.seq - Invertebrate sequence entries, part 547.
3069. gbinv548.seq - Invertebrate sequence entries, part 548.
3070. gbinv549.seq - Invertebrate sequence entries, part 549.
3071. gbinv55.seq - Invertebrate sequence entries, part 55.
3072. gbinv550.seq - Invertebrate sequence entries, part 550.
3073. gbinv551.seq - Invertebrate sequence entries, part 551.
3074. gbinv552.seq - Invertebrate sequence entries, part 552.
3075. gbinv553.seq - Invertebrate sequence entries, part 553.
3076. gbinv554.seq - Invertebrate sequence entries, part 554.
3077. gbinv555.seq - Invertebrate sequence entries, part 555.
3078. gbinv556.seq - Invertebrate sequence entries, part 556.
3079. gbinv557.seq - Invertebrate sequence entries, part 557.
3080. gbinv558.seq - Invertebrate sequence entries, part 558.
3081. gbinv559.seq - Invertebrate sequence entries, part 559.
3082. gbinv56.seq - Invertebrate sequence entries, part 56.
3083. gbinv560.seq - Invertebrate sequence entries, part 560.
3084. gbinv561.seq - Invertebrate sequence entries, part 561.
3085. gbinv562.seq - Invertebrate sequence entries, part 562.
3086. gbinv563.seq - Invertebrate sequence entries, part 563.
3087. gbinv564.seq - Invertebrate sequence entries, part 564.
3088. gbinv565.seq - Invertebrate sequence entries, part 565.
3089. gbinv566.seq - Invertebrate sequence entries, part 566.
3090. gbinv567.seq - Invertebrate sequence entries, part 567.
3091. gbinv568.seq - Invertebrate sequence entries, part 568.
3092. gbinv569.seq - Invertebrate sequence entries, part 569.
3093. gbinv57.seq - Invertebrate sequence entries, part 57.
3094. gbinv570.seq - Invertebrate sequence entries, part 570.
3095. gbinv571.seq - Invertebrate sequence entries, part 571.
3096. gbinv572.seq - Invertebrate sequence entries, part 572.
3097. gbinv573.seq - Invertebrate sequence entries, part 573.
3098. gbinv574.seq - Invertebrate sequence entries, part 574.
3099. gbinv575.seq - Invertebrate sequence entries, part 575.
3100. gbinv576.seq - Invertebrate sequence entries, part 576.
3101. gbinv577.seq - Invertebrate sequence entries, part 577.
3102. gbinv578.seq - Invertebrate sequence entries, part 578.
3103. gbinv579.seq - Invertebrate sequence entries, part 579.
3104. gbinv58.seq - Invertebrate sequence entries, part 58.
3105. gbinv580.seq - Invertebrate sequence entries, part 580.
3106. gbinv581.seq - Invertebrate sequence entries, part 581.
3107. gbinv582.seq - Invertebrate sequence entries, part 582.
3108. gbinv583.seq - Invertebrate sequence entries, part 583.
3109. gbinv584.seq - Invertebrate sequence entries, part 584.
3110. gbinv585.seq - Invertebrate sequence entries, part 585.
3111. gbinv586.seq - Invertebrate sequence entries, part 586.
3112. gbinv587.seq - Invertebrate sequence entries, part 587.
3113. gbinv588.seq - Invertebrate sequence entries, part 588.
3114. gbinv589.seq - Invertebrate sequence entries, part 589.
3115. gbinv59.seq - Invertebrate sequence entries, part 59.
3116. gbinv590.seq - Invertebrate sequence entries, part 590.
3117. gbinv591.seq - Invertebrate sequence entries, part 591.
3118. gbinv592.seq - Invertebrate sequence entries, part 592.
3119. gbinv593.seq - Invertebrate sequence entries, part 593.
3120. gbinv594.seq - Invertebrate sequence entries, part 594.
3121. gbinv595.seq - Invertebrate sequence entries, part 595.
3122. gbinv596.seq - Invertebrate sequence entries, part 596.
3123. gbinv597.seq - Invertebrate sequence entries, part 597.
3124. gbinv598.seq - Invertebrate sequence entries, part 598.
3125. gbinv599.seq - Invertebrate sequence entries, part 599.
3126. gbinv6.seq - Invertebrate sequence entries, part 6.
3127. gbinv60.seq - Invertebrate sequence entries, part 60.
3128. gbinv600.seq - Invertebrate sequence entries, part 600.
3129. gbinv601.seq - Invertebrate sequence entries, part 601.
3130. gbinv602.seq - Invertebrate sequence entries, part 602.
3131. gbinv603.seq - Invertebrate sequence entries, part 603.
3132. gbinv604.seq - Invertebrate sequence entries, part 604.
3133. gbinv605.seq - Invertebrate sequence entries, part 605.
3134. gbinv606.seq - Invertebrate sequence entries, part 606.
3135. gbinv607.seq - Invertebrate sequence entries, part 607.
3136. gbinv608.seq - Invertebrate sequence entries, part 608.
3137. gbinv609.seq - Invertebrate sequence entries, part 609.
3138. gbinv61.seq - Invertebrate sequence entries, part 61.
3139. gbinv610.seq - Invertebrate sequence entries, part 610.
3140. gbinv611.seq - Invertebrate sequence entries, part 611.
3141. gbinv612.seq - Invertebrate sequence entries, part 612.
3142. gbinv613.seq - Invertebrate sequence entries, part 613.
3143. gbinv614.seq - Invertebrate sequence entries, part 614.
3144. gbinv615.seq - Invertebrate sequence entries, part 615.
3145. gbinv616.seq - Invertebrate sequence entries, part 616.
3146. gbinv617.seq - Invertebrate sequence entries, part 617.
3147. gbinv618.seq - Invertebrate sequence entries, part 618.
3148. gbinv619.seq - Invertebrate sequence entries, part 619.
3149. gbinv62.seq - Invertebrate sequence entries, part 62.
3150. gbinv620.seq - Invertebrate sequence entries, part 620.
3151. gbinv621.seq - Invertebrate sequence entries, part 621.
3152. gbinv622.seq - Invertebrate sequence entries, part 622.
3153. gbinv623.seq - Invertebrate sequence entries, part 623.
3154. gbinv624.seq - Invertebrate sequence entries, part 624.
3155. gbinv625.seq - Invertebrate sequence entries, part 625.
3156. gbinv626.seq - Invertebrate sequence entries, part 626.
3157. gbinv627.seq - Invertebrate sequence entries, part 627.
3158. gbinv628.seq - Invertebrate sequence entries, part 628.
3159. gbinv629.seq - Invertebrate sequence entries, part 629.
3160. gbinv63.seq - Invertebrate sequence entries, part 63.
3161. gbinv630.seq - Invertebrate sequence entries, part 630.
3162. gbinv631.seq - Invertebrate sequence entries, part 631.
3163. gbinv632.seq - Invertebrate sequence entries, part 632.
3164. gbinv633.seq - Invertebrate sequence entries, part 633.
3165. gbinv634.seq - Invertebrate sequence entries, part 634.
3166. gbinv635.seq - Invertebrate sequence entries, part 635.
3167. gbinv636.seq - Invertebrate sequence entries, part 636.
3168. gbinv637.seq - Invertebrate sequence entries, part 637.
3169. gbinv638.seq - Invertebrate sequence entries, part 638.
3170. gbinv639.seq - Invertebrate sequence entries, part 639.
3171. gbinv64.seq - Invertebrate sequence entries, part 64.
3172. gbinv640.seq - Invertebrate sequence entries, part 640.
3173. gbinv641.seq - Invertebrate sequence entries, part 641.
3174. gbinv642.seq - Invertebrate sequence entries, part 642.
3175. gbinv643.seq - Invertebrate sequence entries, part 643.
3176. gbinv644.seq - Invertebrate sequence entries, part 644.
3177. gbinv645.seq - Invertebrate sequence entries, part 645.
3178. gbinv646.seq - Invertebrate sequence entries, part 646.
3179. gbinv647.seq - Invertebrate sequence entries, part 647.
3180. gbinv648.seq - Invertebrate sequence entries, part 648.
3181. gbinv649.seq - Invertebrate sequence entries, part 649.
3182. gbinv65.seq - Invertebrate sequence entries, part 65.
3183. gbinv650.seq - Invertebrate sequence entries, part 650.
3184. gbinv651.seq - Invertebrate sequence entries, part 651.
3185. gbinv652.seq - Invertebrate sequence entries, part 652.
3186. gbinv653.seq - Invertebrate sequence entries, part 653.
3187. gbinv654.seq - Invertebrate sequence entries, part 654.
3188. gbinv655.seq - Invertebrate sequence entries, part 655.
3189. gbinv656.seq - Invertebrate sequence entries, part 656.
3190. gbinv657.seq - Invertebrate sequence entries, part 657.
3191. gbinv658.seq - Invertebrate sequence entries, part 658.
3192. gbinv659.seq - Invertebrate sequence entries, part 659.
3193. gbinv66.seq - Invertebrate sequence entries, part 66.
3194. gbinv660.seq - Invertebrate sequence entries, part 660.
3195. gbinv661.seq - Invertebrate sequence entries, part 661.
3196. gbinv662.seq - Invertebrate sequence entries, part 662.
3197. gbinv663.seq - Invertebrate sequence entries, part 663.
3198. gbinv664.seq - Invertebrate sequence entries, part 664.
3199. gbinv665.seq - Invertebrate sequence entries, part 665.
3200. gbinv666.seq - Invertebrate sequence entries, part 666.
3201. gbinv667.seq - Invertebrate sequence entries, part 667.
3202. gbinv668.seq - Invertebrate sequence entries, part 668.
3203. gbinv669.seq - Invertebrate sequence entries, part 669.
3204. gbinv67.seq - Invertebrate sequence entries, part 67.
3205. gbinv670.seq - Invertebrate sequence entries, part 670.
3206. gbinv671.seq - Invertebrate sequence entries, part 671.
3207. gbinv672.seq - Invertebrate sequence entries, part 672.
3208. gbinv673.seq - Invertebrate sequence entries, part 673.
3209. gbinv674.seq - Invertebrate sequence entries, part 674.
3210. gbinv675.seq - Invertebrate sequence entries, part 675.
3211. gbinv676.seq - Invertebrate sequence entries, part 676.
3212. gbinv677.seq - Invertebrate sequence entries, part 677.
3213. gbinv678.seq - Invertebrate sequence entries, part 678.
3214. gbinv679.seq - Invertebrate sequence entries, part 679.
3215. gbinv68.seq - Invertebrate sequence entries, part 68.
3216. gbinv680.seq - Invertebrate sequence entries, part 680.
3217. gbinv681.seq - Invertebrate sequence entries, part 681.
3218. gbinv682.seq - Invertebrate sequence entries, part 682.
3219. gbinv683.seq - Invertebrate sequence entries, part 683.
3220. gbinv684.seq - Invertebrate sequence entries, part 684.
3221. gbinv685.seq - Invertebrate sequence entries, part 685.
3222. gbinv686.seq - Invertebrate sequence entries, part 686.
3223. gbinv687.seq - Invertebrate sequence entries, part 687.
3224. gbinv688.seq - Invertebrate sequence entries, part 688.
3225. gbinv689.seq - Invertebrate sequence entries, part 689.
3226. gbinv69.seq - Invertebrate sequence entries, part 69.
3227. gbinv690.seq - Invertebrate sequence entries, part 690.
3228. gbinv691.seq - Invertebrate sequence entries, part 691.
3229. gbinv692.seq - Invertebrate sequence entries, part 692.
3230. gbinv693.seq - Invertebrate sequence entries, part 693.
3231. gbinv694.seq - Invertebrate sequence entries, part 694.
3232. gbinv695.seq - Invertebrate sequence entries, part 695.
3233. gbinv696.seq - Invertebrate sequence entries, part 696.
3234. gbinv697.seq - Invertebrate sequence entries, part 697.
3235. gbinv698.seq - Invertebrate sequence entries, part 698.
3236. gbinv699.seq - Invertebrate sequence entries, part 699.
3237. gbinv7.seq - Invertebrate sequence entries, part 7.
3238. gbinv70.seq - Invertebrate sequence entries, part 70.
3239. gbinv700.seq - Invertebrate sequence entries, part 700.
3240. gbinv701.seq - Invertebrate sequence entries, part 701.
3241. gbinv702.seq - Invertebrate sequence entries, part 702.
3242. gbinv703.seq - Invertebrate sequence entries, part 703.
3243. gbinv704.seq - Invertebrate sequence entries, part 704.
3244. gbinv705.seq - Invertebrate sequence entries, part 705.
3245. gbinv706.seq - Invertebrate sequence entries, part 706.
3246. gbinv707.seq - Invertebrate sequence entries, part 707.
3247. gbinv708.seq - Invertebrate sequence entries, part 708.
3248. gbinv709.seq - Invertebrate sequence entries, part 709.
3249. gbinv71.seq - Invertebrate sequence entries, part 71.
3250. gbinv710.seq - Invertebrate sequence entries, part 710.
3251. gbinv711.seq - Invertebrate sequence entries, part 711.
3252. gbinv712.seq - Invertebrate sequence entries, part 712.
3253. gbinv713.seq - Invertebrate sequence entries, part 713.
3254. gbinv714.seq - Invertebrate sequence entries, part 714.
3255. gbinv715.seq - Invertebrate sequence entries, part 715.
3256. gbinv716.seq - Invertebrate sequence entries, part 716.
3257. gbinv717.seq - Invertebrate sequence entries, part 717.
3258. gbinv718.seq - Invertebrate sequence entries, part 718.
3259. gbinv719.seq - Invertebrate sequence entries, part 719.
3260. gbinv72.seq - Invertebrate sequence entries, part 72.
3261. gbinv720.seq - Invertebrate sequence entries, part 720.
3262. gbinv721.seq - Invertebrate sequence entries, part 721.
3263. gbinv722.seq - Invertebrate sequence entries, part 722.
3264. gbinv723.seq - Invertebrate sequence entries, part 723.
3265. gbinv724.seq - Invertebrate sequence entries, part 724.
3266. gbinv725.seq - Invertebrate sequence entries, part 725.
3267. gbinv726.seq - Invertebrate sequence entries, part 726.
3268. gbinv727.seq - Invertebrate sequence entries, part 727.
3269. gbinv728.seq - Invertebrate sequence entries, part 728.
3270. gbinv729.seq - Invertebrate sequence entries, part 729.
3271. gbinv73.seq - Invertebrate sequence entries, part 73.
3272. gbinv730.seq - Invertebrate sequence entries, part 730.
3273. gbinv731.seq - Invertebrate sequence entries, part 731.
3274. gbinv732.seq - Invertebrate sequence entries, part 732.
3275. gbinv733.seq - Invertebrate sequence entries, part 733.
3276. gbinv734.seq - Invertebrate sequence entries, part 734.
3277. gbinv735.seq - Invertebrate sequence entries, part 735.
3278. gbinv736.seq - Invertebrate sequence entries, part 736.
3279. gbinv737.seq - Invertebrate sequence entries, part 737.
3280. gbinv738.seq - Invertebrate sequence entries, part 738.
3281. gbinv739.seq - Invertebrate sequence entries, part 739.
3282. gbinv74.seq - Invertebrate sequence entries, part 74.
3283. gbinv740.seq - Invertebrate sequence entries, part 740.
3284. gbinv741.seq - Invertebrate sequence entries, part 741.
3285. gbinv742.seq - Invertebrate sequence entries, part 742.
3286. gbinv743.seq - Invertebrate sequence entries, part 743.
3287. gbinv744.seq - Invertebrate sequence entries, part 744.
3288. gbinv745.seq - Invertebrate sequence entries, part 745.
3289. gbinv746.seq - Invertebrate sequence entries, part 746.
3290. gbinv747.seq - Invertebrate sequence entries, part 747.
3291. gbinv748.seq - Invertebrate sequence entries, part 748.
3292. gbinv749.seq - Invertebrate sequence entries, part 749.
3293. gbinv75.seq - Invertebrate sequence entries, part 75.
3294. gbinv750.seq - Invertebrate sequence entries, part 750.
3295. gbinv751.seq - Invertebrate sequence entries, part 751.
3296. gbinv752.seq - Invertebrate sequence entries, part 752.
3297. gbinv753.seq - Invertebrate sequence entries, part 753.
3298. gbinv754.seq - Invertebrate sequence entries, part 754.
3299. gbinv755.seq - Invertebrate sequence entries, part 755.
3300. gbinv756.seq - Invertebrate sequence entries, part 756.
3301. gbinv757.seq - Invertebrate sequence entries, part 757.
3302. gbinv758.seq - Invertebrate sequence entries, part 758.
3303. gbinv759.seq - Invertebrate sequence entries, part 759.
3304. gbinv76.seq - Invertebrate sequence entries, part 76.
3305. gbinv760.seq - Invertebrate sequence entries, part 760.
3306. gbinv761.seq - Invertebrate sequence entries, part 761.
3307. gbinv762.seq - Invertebrate sequence entries, part 762.
3308. gbinv763.seq - Invertebrate sequence entries, part 763.
3309. gbinv764.seq - Invertebrate sequence entries, part 764.
3310. gbinv765.seq - Invertebrate sequence entries, part 765.
3311. gbinv766.seq - Invertebrate sequence entries, part 766.
3312. gbinv767.seq - Invertebrate sequence entries, part 767.
3313. gbinv768.seq - Invertebrate sequence entries, part 768.
3314. gbinv769.seq - Invertebrate sequence entries, part 769.
3315. gbinv77.seq - Invertebrate sequence entries, part 77.
3316. gbinv770.seq - Invertebrate sequence entries, part 770.
3317. gbinv771.seq - Invertebrate sequence entries, part 771.
3318. gbinv772.seq - Invertebrate sequence entries, part 772.
3319. gbinv773.seq - Invertebrate sequence entries, part 773.
3320. gbinv774.seq - Invertebrate sequence entries, part 774.
3321. gbinv775.seq - Invertebrate sequence entries, part 775.
3322. gbinv776.seq - Invertebrate sequence entries, part 776.
3323. gbinv777.seq - Invertebrate sequence entries, part 777.
3324. gbinv778.seq - Invertebrate sequence entries, part 778.
3325. gbinv779.seq - Invertebrate sequence entries, part 779.
3326. gbinv78.seq - Invertebrate sequence entries, part 78.
3327. gbinv780.seq - Invertebrate sequence entries, part 780.
3328. gbinv781.seq - Invertebrate sequence entries, part 781.
3329. gbinv782.seq - Invertebrate sequence entries, part 782.
3330. gbinv783.seq - Invertebrate sequence entries, part 783.
3331. gbinv784.seq - Invertebrate sequence entries, part 784.
3332. gbinv785.seq - Invertebrate sequence entries, part 785.
3333. gbinv786.seq - Invertebrate sequence entries, part 786.
3334. gbinv787.seq - Invertebrate sequence entries, part 787.
3335. gbinv788.seq - Invertebrate sequence entries, part 788.
3336. gbinv789.seq - Invertebrate sequence entries, part 789.
3337. gbinv79.seq - Invertebrate sequence entries, part 79.
3338. gbinv790.seq - Invertebrate sequence entries, part 790.
3339. gbinv791.seq - Invertebrate sequence entries, part 791.
3340. gbinv792.seq - Invertebrate sequence entries, part 792.
3341. gbinv793.seq - Invertebrate sequence entries, part 793.
3342. gbinv794.seq - Invertebrate sequence entries, part 794.
3343. gbinv795.seq - Invertebrate sequence entries, part 795.
3344. gbinv796.seq - Invertebrate sequence entries, part 796.
3345. gbinv797.seq - Invertebrate sequence entries, part 797.
3346. gbinv798.seq - Invertebrate sequence entries, part 798.
3347. gbinv799.seq - Invertebrate sequence entries, part 799.
3348. gbinv8.seq - Invertebrate sequence entries, part 8.
3349. gbinv80.seq - Invertebrate sequence entries, part 80.
3350. gbinv800.seq - Invertebrate sequence entries, part 800.
3351. gbinv801.seq - Invertebrate sequence entries, part 801.
3352. gbinv802.seq - Invertebrate sequence entries, part 802.
3353. gbinv803.seq - Invertebrate sequence entries, part 803.
3354. gbinv804.seq - Invertebrate sequence entries, part 804.
3355. gbinv805.seq - Invertebrate sequence entries, part 805.
3356. gbinv806.seq - Invertebrate sequence entries, part 806.
3357. gbinv807.seq - Invertebrate sequence entries, part 807.
3358. gbinv808.seq - Invertebrate sequence entries, part 808.
3359. gbinv809.seq - Invertebrate sequence entries, part 809.
3360. gbinv81.seq - Invertebrate sequence entries, part 81.
3361. gbinv810.seq - Invertebrate sequence entries, part 810.
3362. gbinv811.seq - Invertebrate sequence entries, part 811.
3363. gbinv812.seq - Invertebrate sequence entries, part 812.
3364. gbinv813.seq - Invertebrate sequence entries, part 813.
3365. gbinv814.seq - Invertebrate sequence entries, part 814.
3366. gbinv815.seq - Invertebrate sequence entries, part 815.
3367. gbinv816.seq - Invertebrate sequence entries, part 816.
3368. gbinv817.seq - Invertebrate sequence entries, part 817.
3369. gbinv818.seq - Invertebrate sequence entries, part 818.
3370. gbinv819.seq - Invertebrate sequence entries, part 819.
3371. gbinv82.seq - Invertebrate sequence entries, part 82.
3372. gbinv820.seq - Invertebrate sequence entries, part 820.
3373. gbinv821.seq - Invertebrate sequence entries, part 821.
3374. gbinv822.seq - Invertebrate sequence entries, part 822.
3375. gbinv823.seq - Invertebrate sequence entries, part 823.
3376. gbinv824.seq - Invertebrate sequence entries, part 824.
3377. gbinv825.seq - Invertebrate sequence entries, part 825.
3378. gbinv826.seq - Invertebrate sequence entries, part 826.
3379. gbinv827.seq - Invertebrate sequence entries, part 827.
3380. gbinv828.seq - Invertebrate sequence entries, part 828.
3381. gbinv829.seq - Invertebrate sequence entries, part 829.
3382. gbinv83.seq - Invertebrate sequence entries, part 83.
3383. gbinv830.seq - Invertebrate sequence entries, part 830.
3384. gbinv831.seq - Invertebrate sequence entries, part 831.
3385. gbinv832.seq - Invertebrate sequence entries, part 832.
3386. gbinv833.seq - Invertebrate sequence entries, part 833.
3387. gbinv834.seq - Invertebrate sequence entries, part 834.
3388. gbinv835.seq - Invertebrate sequence entries, part 835.
3389. gbinv836.seq - Invertebrate sequence entries, part 836.
3390. gbinv837.seq - Invertebrate sequence entries, part 837.
3391. gbinv838.seq - Invertebrate sequence entries, part 838.
3392. gbinv839.seq - Invertebrate sequence entries, part 839.
3393. gbinv84.seq - Invertebrate sequence entries, part 84.
3394. gbinv840.seq - Invertebrate sequence entries, part 840.
3395. gbinv841.seq - Invertebrate sequence entries, part 841.
3396. gbinv842.seq - Invertebrate sequence entries, part 842.
3397. gbinv843.seq - Invertebrate sequence entries, part 843.
3398. gbinv844.seq - Invertebrate sequence entries, part 844.
3399. gbinv845.seq - Invertebrate sequence entries, part 845.
3400. gbinv846.seq - Invertebrate sequence entries, part 846.
3401. gbinv847.seq - Invertebrate sequence entries, part 847.
3402. gbinv848.seq - Invertebrate sequence entries, part 848.
3403. gbinv849.seq - Invertebrate sequence entries, part 849.
3404. gbinv85.seq - Invertebrate sequence entries, part 85.
3405. gbinv850.seq - Invertebrate sequence entries, part 850.
3406. gbinv851.seq - Invertebrate sequence entries, part 851.
3407. gbinv852.seq - Invertebrate sequence entries, part 852.
3408. gbinv853.seq - Invertebrate sequence entries, part 853.
3409. gbinv854.seq - Invertebrate sequence entries, part 854.
3410. gbinv855.seq - Invertebrate sequence entries, part 855.
3411. gbinv856.seq - Invertebrate sequence entries, part 856.
3412. gbinv857.seq - Invertebrate sequence entries, part 857.
3413. gbinv858.seq - Invertebrate sequence entries, part 858.
3414. gbinv859.seq - Invertebrate sequence entries, part 859.
3415. gbinv86.seq - Invertebrate sequence entries, part 86.
3416. gbinv860.seq - Invertebrate sequence entries, part 860.
3417. gbinv861.seq - Invertebrate sequence entries, part 861.
3418. gbinv862.seq - Invertebrate sequence entries, part 862.
3419. gbinv863.seq - Invertebrate sequence entries, part 863.
3420. gbinv864.seq - Invertebrate sequence entries, part 864.
3421. gbinv865.seq - Invertebrate sequence entries, part 865.
3422. gbinv866.seq - Invertebrate sequence entries, part 866.
3423. gbinv867.seq - Invertebrate sequence entries, part 867.
3424. gbinv868.seq - Invertebrate sequence entries, part 868.
3425. gbinv869.seq - Invertebrate sequence entries, part 869.
3426. gbinv87.seq - Invertebrate sequence entries, part 87.
3427. gbinv870.seq - Invertebrate sequence entries, part 870.
3428. gbinv871.seq - Invertebrate sequence entries, part 871.
3429. gbinv872.seq - Invertebrate sequence entries, part 872.
3430. gbinv873.seq - Invertebrate sequence entries, part 873.
3431. gbinv874.seq - Invertebrate sequence entries, part 874.
3432. gbinv875.seq - Invertebrate sequence entries, part 875.
3433. gbinv876.seq - Invertebrate sequence entries, part 876.
3434. gbinv877.seq - Invertebrate sequence entries, part 877.
3435. gbinv878.seq - Invertebrate sequence entries, part 878.
3436. gbinv879.seq - Invertebrate sequence entries, part 879.
3437. gbinv88.seq - Invertebrate sequence entries, part 88.
3438. gbinv880.seq - Invertebrate sequence entries, part 880.
3439. gbinv881.seq - Invertebrate sequence entries, part 881.
3440. gbinv882.seq - Invertebrate sequence entries, part 882.
3441. gbinv883.seq - Invertebrate sequence entries, part 883.
3442. gbinv884.seq - Invertebrate sequence entries, part 884.
3443. gbinv885.seq - Invertebrate sequence entries, part 885.
3444. gbinv886.seq - Invertebrate sequence entries, part 886.
3445. gbinv887.seq - Invertebrate sequence entries, part 887.
3446. gbinv888.seq - Invertebrate sequence entries, part 888.
3447. gbinv889.seq - Invertebrate sequence entries, part 889.
3448. gbinv89.seq - Invertebrate sequence entries, part 89.
3449. gbinv890.seq - Invertebrate sequence entries, part 890.
3450. gbinv891.seq - Invertebrate sequence entries, part 891.
3451. gbinv892.seq - Invertebrate sequence entries, part 892.
3452. gbinv893.seq - Invertebrate sequence entries, part 893.
3453. gbinv894.seq - Invertebrate sequence entries, part 894.
3454. gbinv895.seq - Invertebrate sequence entries, part 895.
3455. gbinv896.seq - Invertebrate sequence entries, part 896.
3456. gbinv897.seq - Invertebrate sequence entries, part 897.
3457. gbinv898.seq - Invertebrate sequence entries, part 898.
3458. gbinv899.seq - Invertebrate sequence entries, part 899.
3459. gbinv9.seq - Invertebrate sequence entries, part 9.
3460. gbinv90.seq - Invertebrate sequence entries, part 90.
3461. gbinv900.seq - Invertebrate sequence entries, part 900.
3462. gbinv901.seq - Invertebrate sequence entries, part 901.
3463. gbinv902.seq - Invertebrate sequence entries, part 902.
3464. gbinv903.seq - Invertebrate sequence entries, part 903.
3465. gbinv904.seq - Invertebrate sequence entries, part 904.
3466. gbinv905.seq - Invertebrate sequence entries, part 905.
3467. gbinv906.seq - Invertebrate sequence entries, part 906.
3468. gbinv907.seq - Invertebrate sequence entries, part 907.
3469. gbinv908.seq - Invertebrate sequence entries, part 908.
3470. gbinv909.seq - Invertebrate sequence entries, part 909.
3471. gbinv91.seq - Invertebrate sequence entries, part 91.
3472. gbinv910.seq - Invertebrate sequence entries, part 910.
3473. gbinv911.seq - Invertebrate sequence entries, part 911.
3474. gbinv912.seq - Invertebrate sequence entries, part 912.
3475. gbinv913.seq - Invertebrate sequence entries, part 913.
3476. gbinv914.seq - Invertebrate sequence entries, part 914.
3477. gbinv915.seq - Invertebrate sequence entries, part 915.
3478. gbinv916.seq - Invertebrate sequence entries, part 916.
3479. gbinv917.seq - Invertebrate sequence entries, part 917.
3480. gbinv918.seq - Invertebrate sequence entries, part 918.
3481. gbinv919.seq - Invertebrate sequence entries, part 919.
3482. gbinv92.seq - Invertebrate sequence entries, part 92.
3483. gbinv920.seq - Invertebrate sequence entries, part 920.
3484. gbinv921.seq - Invertebrate sequence entries, part 921.
3485. gbinv922.seq - Invertebrate sequence entries, part 922.
3486. gbinv923.seq - Invertebrate sequence entries, part 923.
3487. gbinv924.seq - Invertebrate sequence entries, part 924.
3488. gbinv925.seq - Invertebrate sequence entries, part 925.
3489. gbinv926.seq - Invertebrate sequence entries, part 926.
3490. gbinv927.seq - Invertebrate sequence entries, part 927.
3491. gbinv928.seq - Invertebrate sequence entries, part 928.
3492. gbinv929.seq - Invertebrate sequence entries, part 929.
3493. gbinv93.seq - Invertebrate sequence entries, part 93.
3494. gbinv930.seq - Invertebrate sequence entries, part 930.
3495. gbinv931.seq - Invertebrate sequence entries, part 931.
3496. gbinv932.seq - Invertebrate sequence entries, part 932.
3497. gbinv933.seq - Invertebrate sequence entries, part 933.
3498. gbinv934.seq - Invertebrate sequence entries, part 934.
3499. gbinv935.seq - Invertebrate sequence entries, part 935.
3500. gbinv936.seq - Invertebrate sequence entries, part 936.
3501. gbinv937.seq - Invertebrate sequence entries, part 937.
3502. gbinv938.seq - Invertebrate sequence entries, part 938.
3503. gbinv939.seq - Invertebrate sequence entries, part 939.
3504. gbinv94.seq - Invertebrate sequence entries, part 94.
3505. gbinv940.seq - Invertebrate sequence entries, part 940.
3506. gbinv941.seq - Invertebrate sequence entries, part 941.
3507. gbinv942.seq - Invertebrate sequence entries, part 942.
3508. gbinv943.seq - Invertebrate sequence entries, part 943.
3509. gbinv944.seq - Invertebrate sequence entries, part 944.
3510. gbinv945.seq - Invertebrate sequence entries, part 945.
3511. gbinv946.seq - Invertebrate sequence entries, part 946.
3512. gbinv947.seq - Invertebrate sequence entries, part 947.
3513. gbinv948.seq - Invertebrate sequence entries, part 948.
3514. gbinv949.seq - Invertebrate sequence entries, part 949.
3515. gbinv95.seq - Invertebrate sequence entries, part 95.
3516. gbinv950.seq - Invertebrate sequence entries, part 950.
3517. gbinv951.seq - Invertebrate sequence entries, part 951.
3518. gbinv952.seq - Invertebrate sequence entries, part 952.
3519. gbinv953.seq - Invertebrate sequence entries, part 953.
3520. gbinv954.seq - Invertebrate sequence entries, part 954.
3521. gbinv955.seq - Invertebrate sequence entries, part 955.
3522. gbinv956.seq - Invertebrate sequence entries, part 956.
3523. gbinv957.seq - Invertebrate sequence entries, part 957.
3524. gbinv958.seq - Invertebrate sequence entries, part 958.
3525. gbinv959.seq - Invertebrate sequence entries, part 959.
3526. gbinv96.seq - Invertebrate sequence entries, part 96.
3527. gbinv960.seq - Invertebrate sequence entries, part 960.
3528. gbinv961.seq - Invertebrate sequence entries, part 961.
3529. gbinv962.seq - Invertebrate sequence entries, part 962.
3530. gbinv963.seq - Invertebrate sequence entries, part 963.
3531. gbinv964.seq - Invertebrate sequence entries, part 964.
3532. gbinv965.seq - Invertebrate sequence entries, part 965.
3533. gbinv966.seq - Invertebrate sequence entries, part 966.
3534. gbinv967.seq - Invertebrate sequence entries, part 967.
3535. gbinv968.seq - Invertebrate sequence entries, part 968.
3536. gbinv969.seq - Invertebrate sequence entries, part 969.
3537. gbinv97.seq - Invertebrate sequence entries, part 97.
3538. gbinv970.seq - Invertebrate sequence entries, part 970.
3539. gbinv971.seq - Invertebrate sequence entries, part 971.
3540. gbinv972.seq - Invertebrate sequence entries, part 972.
3541. gbinv973.seq - Invertebrate sequence entries, part 973.
3542. gbinv974.seq - Invertebrate sequence entries, part 974.
3543. gbinv975.seq - Invertebrate sequence entries, part 975.
3544. gbinv976.seq - Invertebrate sequence entries, part 976.
3545. gbinv977.seq - Invertebrate sequence entries, part 977.
3546. gbinv978.seq - Invertebrate sequence entries, part 978.
3547. gbinv979.seq - Invertebrate sequence entries, part 979.
3548. gbinv98.seq - Invertebrate sequence entries, part 98.
3549. gbinv980.seq - Invertebrate sequence entries, part 980.
3550. gbinv981.seq - Invertebrate sequence entries, part 981.
3551. gbinv982.seq - Invertebrate sequence entries, part 982.
3552. gbinv983.seq - Invertebrate sequence entries, part 983.
3553. gbinv984.seq - Invertebrate sequence entries, part 984.
3554. gbinv985.seq - Invertebrate sequence entries, part 985.
3555. gbinv986.seq - Invertebrate sequence entries, part 986.
3556. gbinv987.seq - Invertebrate sequence entries, part 987.
3557. gbinv988.seq - Invertebrate sequence entries, part 988.
3558. gbinv989.seq - Invertebrate sequence entries, part 989.
3559. gbinv99.seq - Invertebrate sequence entries, part 99.
3560. gbinv990.seq - Invertebrate sequence entries, part 990.
3561. gbinv991.seq - Invertebrate sequence entries, part 991.
3562. gbinv992.seq - Invertebrate sequence entries, part 992.
3563. gbinv993.seq - Invertebrate sequence entries, part 993.
3564. gbinv994.seq - Invertebrate sequence entries, part 994.
3565. gbinv995.seq - Invertebrate sequence entries, part 995.
3566. gbinv996.seq - Invertebrate sequence entries, part 996.
3567. gbinv997.seq - Invertebrate sequence entries, part 997.
3568. gbinv998.seq - Invertebrate sequence entries, part 998.
3569. gbinv999.seq - Invertebrate sequence entries, part 999.
3570. gbmam1.seq - Other mammalian sequence entries, part 1.
3571. gbmam10.seq - Other mammalian sequence entries, part 10.
3572. gbmam100.seq - Other mammalian sequence entries, part 100.
3573. gbmam101.seq - Other mammalian sequence entries, part 101.
3574. gbmam102.seq - Other mammalian sequence entries, part 102.
3575. gbmam103.seq - Other mammalian sequence entries, part 103.
3576. gbmam104.seq - Other mammalian sequence entries, part 104.
3577. gbmam105.seq - Other mammalian sequence entries, part 105.
3578. gbmam106.seq - Other mammalian sequence entries, part 106.
3579. gbmam107.seq - Other mammalian sequence entries, part 107.
3580. gbmam108.seq - Other mammalian sequence entries, part 108.
3581. gbmam109.seq - Other mammalian sequence entries, part 109.
3582. gbmam11.seq - Other mammalian sequence entries, part 11.
3583. gbmam110.seq - Other mammalian sequence entries, part 110.
3584. gbmam111.seq - Other mammalian sequence entries, part 111.
3585. gbmam112.seq - Other mammalian sequence entries, part 112.
3586. gbmam113.seq - Other mammalian sequence entries, part 113.
3587. gbmam114.seq - Other mammalian sequence entries, part 114.
3588. gbmam115.seq - Other mammalian sequence entries, part 115.
3589. gbmam116.seq - Other mammalian sequence entries, part 116.
3590. gbmam117.seq - Other mammalian sequence entries, part 117.
3591. gbmam118.seq - Other mammalian sequence entries, part 118.
3592. gbmam119.seq - Other mammalian sequence entries, part 119.
3593. gbmam12.seq - Other mammalian sequence entries, part 12.
3594. gbmam120.seq - Other mammalian sequence entries, part 120.
3595. gbmam121.seq - Other mammalian sequence entries, part 121.
3596. gbmam122.seq - Other mammalian sequence entries, part 122.
3597. gbmam123.seq - Other mammalian sequence entries, part 123.
3598. gbmam124.seq - Other mammalian sequence entries, part 124.
3599. gbmam125.seq - Other mammalian sequence entries, part 125.
3600. gbmam126.seq - Other mammalian sequence entries, part 126.
3601. gbmam127.seq - Other mammalian sequence entries, part 127.
3602. gbmam128.seq - Other mammalian sequence entries, part 128.
3603. gbmam129.seq - Other mammalian sequence entries, part 129.
3604. gbmam13.seq - Other mammalian sequence entries, part 13.
3605. gbmam130.seq - Other mammalian sequence entries, part 130.
3606. gbmam131.seq - Other mammalian sequence entries, part 131.
3607. gbmam132.seq - Other mammalian sequence entries, part 132.
3608. gbmam133.seq - Other mammalian sequence entries, part 133.
3609. gbmam134.seq - Other mammalian sequence entries, part 134.
3610. gbmam135.seq - Other mammalian sequence entries, part 135.
3611. gbmam136.seq - Other mammalian sequence entries, part 136.
3612. gbmam137.seq - Other mammalian sequence entries, part 137.
3613. gbmam138.seq - Other mammalian sequence entries, part 138.
3614. gbmam139.seq - Other mammalian sequence entries, part 139.
3615. gbmam14.seq - Other mammalian sequence entries, part 14.
3616. gbmam140.seq - Other mammalian sequence entries, part 140.
3617. gbmam141.seq - Other mammalian sequence entries, part 141.
3618. gbmam142.seq - Other mammalian sequence entries, part 142.
3619. gbmam143.seq - Other mammalian sequence entries, part 143.
3620. gbmam144.seq - Other mammalian sequence entries, part 144.
3621. gbmam145.seq - Other mammalian sequence entries, part 145.
3622. gbmam146.seq - Other mammalian sequence entries, part 146.
3623. gbmam147.seq - Other mammalian sequence entries, part 147.
3624. gbmam148.seq - Other mammalian sequence entries, part 148.
3625. gbmam149.seq - Other mammalian sequence entries, part 149.
3626. gbmam15.seq - Other mammalian sequence entries, part 15.
3627. gbmam150.seq - Other mammalian sequence entries, part 150.
3628. gbmam151.seq - Other mammalian sequence entries, part 151.
3629. gbmam152.seq - Other mammalian sequence entries, part 152.
3630. gbmam153.seq - Other mammalian sequence entries, part 153.
3631. gbmam154.seq - Other mammalian sequence entries, part 154.
3632. gbmam155.seq - Other mammalian sequence entries, part 155.
3633. gbmam156.seq - Other mammalian sequence entries, part 156.
3634. gbmam157.seq - Other mammalian sequence entries, part 157.
3635. gbmam158.seq - Other mammalian sequence entries, part 158.
3636. gbmam159.seq - Other mammalian sequence entries, part 159.
3637. gbmam16.seq - Other mammalian sequence entries, part 16.
3638. gbmam160.seq - Other mammalian sequence entries, part 160.
3639. gbmam161.seq - Other mammalian sequence entries, part 161.
3640. gbmam162.seq - Other mammalian sequence entries, part 162.
3641. gbmam163.seq - Other mammalian sequence entries, part 163.
3642. gbmam164.seq - Other mammalian sequence entries, part 164.
3643. gbmam165.seq - Other mammalian sequence entries, part 165.
3644. gbmam166.seq - Other mammalian sequence entries, part 166.
3645. gbmam17.seq - Other mammalian sequence entries, part 17.
3646. gbmam18.seq - Other mammalian sequence entries, part 18.
3647. gbmam19.seq - Other mammalian sequence entries, part 19.
3648. gbmam2.seq - Other mammalian sequence entries, part 2.
3649. gbmam20.seq - Other mammalian sequence entries, part 20.
3650. gbmam21.seq - Other mammalian sequence entries, part 21.
3651. gbmam22.seq - Other mammalian sequence entries, part 22.
3652. gbmam23.seq - Other mammalian sequence entries, part 23.
3653. gbmam24.seq - Other mammalian sequence entries, part 24.
3654. gbmam25.seq - Other mammalian sequence entries, part 25.
3655. gbmam26.seq - Other mammalian sequence entries, part 26.
3656. gbmam27.seq - Other mammalian sequence entries, part 27.
3657. gbmam28.seq - Other mammalian sequence entries, part 28.
3658. gbmam29.seq - Other mammalian sequence entries, part 29.
3659. gbmam3.seq - Other mammalian sequence entries, part 3.
3660. gbmam30.seq - Other mammalian sequence entries, part 30.
3661. gbmam31.seq - Other mammalian sequence entries, part 31.
3662. gbmam32.seq - Other mammalian sequence entries, part 32.
3663. gbmam33.seq - Other mammalian sequence entries, part 33.
3664. gbmam34.seq - Other mammalian sequence entries, part 34.
3665. gbmam35.seq - Other mammalian sequence entries, part 35.
3666. gbmam36.seq - Other mammalian sequence entries, part 36.
3667. gbmam37.seq - Other mammalian sequence entries, part 37.
3668. gbmam38.seq - Other mammalian sequence entries, part 38.
3669. gbmam39.seq - Other mammalian sequence entries, part 39.
3670. gbmam4.seq - Other mammalian sequence entries, part 4.
3671. gbmam40.seq - Other mammalian sequence entries, part 40.
3672. gbmam41.seq - Other mammalian sequence entries, part 41.
3673. gbmam42.seq - Other mammalian sequence entries, part 42.
3674. gbmam43.seq - Other mammalian sequence entries, part 43.
3675. gbmam44.seq - Other mammalian sequence entries, part 44.
3676. gbmam45.seq - Other mammalian sequence entries, part 45.
3677. gbmam46.seq - Other mammalian sequence entries, part 46.
3678. gbmam47.seq - Other mammalian sequence entries, part 47.
3679. gbmam48.seq - Other mammalian sequence entries, part 48.
3680. gbmam49.seq - Other mammalian sequence entries, part 49.
3681. gbmam5.seq - Other mammalian sequence entries, part 5.
3682. gbmam50.seq - Other mammalian sequence entries, part 50.
3683. gbmam51.seq - Other mammalian sequence entries, part 51.
3684. gbmam52.seq - Other mammalian sequence entries, part 52.
3685. gbmam53.seq - Other mammalian sequence entries, part 53.
3686. gbmam54.seq - Other mammalian sequence entries, part 54.
3687. gbmam55.seq - Other mammalian sequence entries, part 55.
3688. gbmam56.seq - Other mammalian sequence entries, part 56.
3689. gbmam57.seq - Other mammalian sequence entries, part 57.
3690. gbmam58.seq - Other mammalian sequence entries, part 58.
3691. gbmam59.seq - Other mammalian sequence entries, part 59.
3692. gbmam6.seq - Other mammalian sequence entries, part 6.
3693. gbmam60.seq - Other mammalian sequence entries, part 60.
3694. gbmam61.seq - Other mammalian sequence entries, part 61.
3695. gbmam62.seq - Other mammalian sequence entries, part 62.
3696. gbmam63.seq - Other mammalian sequence entries, part 63.
3697. gbmam64.seq - Other mammalian sequence entries, part 64.
3698. gbmam65.seq - Other mammalian sequence entries, part 65.
3699. gbmam66.seq - Other mammalian sequence entries, part 66.
3700. gbmam67.seq - Other mammalian sequence entries, part 67.
3701. gbmam68.seq - Other mammalian sequence entries, part 68.
3702. gbmam69.seq - Other mammalian sequence entries, part 69.
3703. gbmam7.seq - Other mammalian sequence entries, part 7.
3704. gbmam70.seq - Other mammalian sequence entries, part 70.
3705. gbmam71.seq - Other mammalian sequence entries, part 71.
3706. gbmam72.seq - Other mammalian sequence entries, part 72.
3707. gbmam73.seq - Other mammalian sequence entries, part 73.
3708. gbmam74.seq - Other mammalian sequence entries, part 74.
3709. gbmam75.seq - Other mammalian sequence entries, part 75.
3710. gbmam76.seq - Other mammalian sequence entries, part 76.
3711. gbmam77.seq - Other mammalian sequence entries, part 77.
3712. gbmam78.seq - Other mammalian sequence entries, part 78.
3713. gbmam79.seq - Other mammalian sequence entries, part 79.
3714. gbmam8.seq - Other mammalian sequence entries, part 8.
3715. gbmam80.seq - Other mammalian sequence entries, part 80.
3716. gbmam81.seq - Other mammalian sequence entries, part 81.
3717. gbmam82.seq - Other mammalian sequence entries, part 82.
3718. gbmam83.seq - Other mammalian sequence entries, part 83.
3719. gbmam84.seq - Other mammalian sequence entries, part 84.
3720. gbmam85.seq - Other mammalian sequence entries, part 85.
3721. gbmam86.seq - Other mammalian sequence entries, part 86.
3722. gbmam87.seq - Other mammalian sequence entries, part 87.
3723. gbmam88.seq - Other mammalian sequence entries, part 88.
3724. gbmam89.seq - Other mammalian sequence entries, part 89.
3725. gbmam9.seq - Other mammalian sequence entries, part 9.
3726. gbmam90.seq - Other mammalian sequence entries, part 90.
3727. gbmam91.seq - Other mammalian sequence entries, part 91.
3728. gbmam92.seq - Other mammalian sequence entries, part 92.
3729. gbmam93.seq - Other mammalian sequence entries, part 93.
3730. gbmam94.seq - Other mammalian sequence entries, part 94.
3731. gbmam95.seq - Other mammalian sequence entries, part 95.
3732. gbmam96.seq - Other mammalian sequence entries, part 96.
3733. gbmam97.seq - Other mammalian sequence entries, part 97.
3734. gbmam98.seq - Other mammalian sequence entries, part 98.
3735. gbmam99.seq - Other mammalian sequence entries, part 99.
3736. gbnew.txt - Accession numbers of entries new since the previous release.
3737. gbpat1.seq - Patent sequence entries, part 1.
3738. gbpat10.seq - Patent sequence entries, part 10.
3739. gbpat100.seq - Patent sequence entries, part 100.
3740. gbpat101.seq - Patent sequence entries, part 101.
3741. gbpat102.seq - Patent sequence entries, part 102.
3742. gbpat103.seq - Patent sequence entries, part 103.
3743. gbpat104.seq - Patent sequence entries, part 104.
3744. gbpat105.seq - Patent sequence entries, part 105.
3745. gbpat106.seq - Patent sequence entries, part 106.
3746. gbpat107.seq - Patent sequence entries, part 107.
3747. gbpat108.seq - Patent sequence entries, part 108.
3748. gbpat109.seq - Patent sequence entries, part 109.
3749. gbpat11.seq - Patent sequence entries, part 11.
3750. gbpat110.seq - Patent sequence entries, part 110.
3751. gbpat111.seq - Patent sequence entries, part 111.
3752. gbpat112.seq - Patent sequence entries, part 112.
3753. gbpat113.seq - Patent sequence entries, part 113.
3754. gbpat114.seq - Patent sequence entries, part 114.
3755. gbpat115.seq - Patent sequence entries, part 115.
3756. gbpat116.seq - Patent sequence entries, part 116.
3757. gbpat117.seq - Patent sequence entries, part 117.
3758. gbpat118.seq - Patent sequence entries, part 118.
3759. gbpat119.seq - Patent sequence entries, part 119.
3760. gbpat12.seq - Patent sequence entries, part 12.
3761. gbpat120.seq - Patent sequence entries, part 120.
3762. gbpat121.seq - Patent sequence entries, part 121.
3763. gbpat122.seq - Patent sequence entries, part 122.
3764. gbpat123.seq - Patent sequence entries, part 123.
3765. gbpat124.seq - Patent sequence entries, part 124.
3766. gbpat125.seq - Patent sequence entries, part 125.
3767. gbpat126.seq - Patent sequence entries, part 126.
3768. gbpat127.seq - Patent sequence entries, part 127.
3769. gbpat128.seq - Patent sequence entries, part 128.
3770. gbpat129.seq - Patent sequence entries, part 129.
3771. gbpat13.seq - Patent sequence entries, part 13.
3772. gbpat130.seq - Patent sequence entries, part 130.
3773. gbpat131.seq - Patent sequence entries, part 131.
3774. gbpat132.seq - Patent sequence entries, part 132.
3775. gbpat133.seq - Patent sequence entries, part 133.
3776. gbpat134.seq - Patent sequence entries, part 134.
3777. gbpat135.seq - Patent sequence entries, part 135.
3778. gbpat136.seq - Patent sequence entries, part 136.
3779. gbpat137.seq - Patent sequence entries, part 137.
3780. gbpat138.seq - Patent sequence entries, part 138.
3781. gbpat139.seq - Patent sequence entries, part 139.
3782. gbpat14.seq - Patent sequence entries, part 14.
3783. gbpat140.seq - Patent sequence entries, part 140.
3784. gbpat141.seq - Patent sequence entries, part 141.
3785. gbpat142.seq - Patent sequence entries, part 142.
3786. gbpat143.seq - Patent sequence entries, part 143.
3787. gbpat144.seq - Patent sequence entries, part 144.
3788. gbpat145.seq - Patent sequence entries, part 145.
3789. gbpat146.seq - Patent sequence entries, part 146.
3790. gbpat147.seq - Patent sequence entries, part 147.
3791. gbpat148.seq - Patent sequence entries, part 148.
3792. gbpat149.seq - Patent sequence entries, part 149.
3793. gbpat15.seq - Patent sequence entries, part 15.
3794. gbpat150.seq - Patent sequence entries, part 150.
3795. gbpat151.seq - Patent sequence entries, part 151.
3796. gbpat152.seq - Patent sequence entries, part 152.
3797. gbpat153.seq - Patent sequence entries, part 153.
3798. gbpat154.seq - Patent sequence entries, part 154.
3799. gbpat155.seq - Patent sequence entries, part 155.
3800. gbpat156.seq - Patent sequence entries, part 156.
3801. gbpat157.seq - Patent sequence entries, part 157.
3802. gbpat158.seq - Patent sequence entries, part 158.
3803. gbpat159.seq - Patent sequence entries, part 159.
3804. gbpat16.seq - Patent sequence entries, part 16.
3805. gbpat160.seq - Patent sequence entries, part 160.
3806. gbpat161.seq - Patent sequence entries, part 161.
3807. gbpat162.seq - Patent sequence entries, part 162.
3808. gbpat163.seq - Patent sequence entries, part 163.
3809. gbpat164.seq - Patent sequence entries, part 164.
3810. gbpat165.seq - Patent sequence entries, part 165.
3811. gbpat166.seq - Patent sequence entries, part 166.
3812. gbpat167.seq - Patent sequence entries, part 167.
3813. gbpat168.seq - Patent sequence entries, part 168.
3814. gbpat169.seq - Patent sequence entries, part 169.
3815. gbpat17.seq - Patent sequence entries, part 17.
3816. gbpat170.seq - Patent sequence entries, part 170.
3817. gbpat171.seq - Patent sequence entries, part 171.
3818. gbpat172.seq - Patent sequence entries, part 172.
3819. gbpat173.seq - Patent sequence entries, part 173.
3820. gbpat174.seq - Patent sequence entries, part 174.
3821. gbpat175.seq - Patent sequence entries, part 175.
3822. gbpat176.seq - Patent sequence entries, part 176.
3823. gbpat177.seq - Patent sequence entries, part 177.
3824. gbpat178.seq - Patent sequence entries, part 178.
3825. gbpat179.seq - Patent sequence entries, part 179.
3826. gbpat18.seq - Patent sequence entries, part 18.
3827. gbpat180.seq - Patent sequence entries, part 180.
3828. gbpat181.seq - Patent sequence entries, part 181.
3829. gbpat182.seq - Patent sequence entries, part 182.
3830. gbpat183.seq - Patent sequence entries, part 183.
3831. gbpat184.seq - Patent sequence entries, part 184.
3832. gbpat185.seq - Patent sequence entries, part 185.
3833. gbpat186.seq - Patent sequence entries, part 186.
3834. gbpat187.seq - Patent sequence entries, part 187.
3835. gbpat188.seq - Patent sequence entries, part 188.
3836. gbpat189.seq - Patent sequence entries, part 189.
3837. gbpat19.seq - Patent sequence entries, part 19.
3838. gbpat190.seq - Patent sequence entries, part 190.
3839. gbpat191.seq - Patent sequence entries, part 191.
3840. gbpat192.seq - Patent sequence entries, part 192.
3841. gbpat193.seq - Patent sequence entries, part 193.
3842. gbpat194.seq - Patent sequence entries, part 194.
3843. gbpat195.seq - Patent sequence entries, part 195.
3844. gbpat196.seq - Patent sequence entries, part 196.
3845. gbpat197.seq - Patent sequence entries, part 197.
3846. gbpat198.seq - Patent sequence entries, part 198.
3847. gbpat199.seq - Patent sequence entries, part 199.
3848. gbpat2.seq - Patent sequence entries, part 2.
3849. gbpat20.seq - Patent sequence entries, part 20.
3850. gbpat200.seq - Patent sequence entries, part 200.
3851. gbpat201.seq - Patent sequence entries, part 201.
3852. gbpat202.seq - Patent sequence entries, part 202.
3853. gbpat203.seq - Patent sequence entries, part 203.
3854. gbpat204.seq - Patent sequence entries, part 204.
3855. gbpat205.seq - Patent sequence entries, part 205.
3856. gbpat206.seq - Patent sequence entries, part 206.
3857. gbpat207.seq - Patent sequence entries, part 207.
3858. gbpat208.seq - Patent sequence entries, part 208.
3859. gbpat209.seq - Patent sequence entries, part 209.
3860. gbpat21.seq - Patent sequence entries, part 21.
3861. gbpat210.seq - Patent sequence entries, part 210.
3862. gbpat211.seq - Patent sequence entries, part 211.
3863. gbpat212.seq - Patent sequence entries, part 212.
3864. gbpat213.seq - Patent sequence entries, part 213.
3865. gbpat214.seq - Patent sequence entries, part 214.
3866. gbpat215.seq - Patent sequence entries, part 215.
3867. gbpat216.seq - Patent sequence entries, part 216.
3868. gbpat217.seq - Patent sequence entries, part 217.
3869. gbpat218.seq - Patent sequence entries, part 218.
3870. gbpat219.seq - Patent sequence entries, part 219.
3871. gbpat22.seq - Patent sequence entries, part 22.
3872. gbpat220.seq - Patent sequence entries, part 220.
3873. gbpat221.seq - Patent sequence entries, part 221.
3874. gbpat222.seq - Patent sequence entries, part 222.
3875. gbpat223.seq - Patent sequence entries, part 223.
3876. gbpat224.seq - Patent sequence entries, part 224.
3877. gbpat225.seq - Patent sequence entries, part 225.
3878. gbpat226.seq - Patent sequence entries, part 226.
3879. gbpat227.seq - Patent sequence entries, part 227.
3880. gbpat228.seq - Patent sequence entries, part 228.
3881. gbpat229.seq - Patent sequence entries, part 229.
3882. gbpat23.seq - Patent sequence entries, part 23.
3883. gbpat230.seq - Patent sequence entries, part 230.
3884. gbpat231.seq - Patent sequence entries, part 231.
3885. gbpat232.seq - Patent sequence entries, part 232.
3886. gbpat233.seq - Patent sequence entries, part 233.
3887. gbpat234.seq - Patent sequence entries, part 234.
3888. gbpat235.seq - Patent sequence entries, part 235.
3889. gbpat236.seq - Patent sequence entries, part 236.
3890. gbpat237.seq - Patent sequence entries, part 237.
3891. gbpat238.seq - Patent sequence entries, part 238.
3892. gbpat239.seq - Patent sequence entries, part 239.
3893. gbpat24.seq - Patent sequence entries, part 24.
3894. gbpat240.seq - Patent sequence entries, part 240.
3895. gbpat241.seq - Patent sequence entries, part 241.
3896. gbpat242.seq - Patent sequence entries, part 242.
3897. gbpat243.seq - Patent sequence entries, part 243.
3898. gbpat244.seq - Patent sequence entries, part 244.
3899. gbpat245.seq - Patent sequence entries, part 245.
3900. gbpat246.seq - Patent sequence entries, part 246.
3901. gbpat247.seq - Patent sequence entries, part 247.
3902. gbpat248.seq - Patent sequence entries, part 248.
3903. gbpat249.seq - Patent sequence entries, part 249.
3904. gbpat25.seq - Patent sequence entries, part 25.
3905. gbpat250.seq - Patent sequence entries, part 250.
3906. gbpat251.seq - Patent sequence entries, part 251.
3907. gbpat252.seq - Patent sequence entries, part 252.
3908. gbpat26.seq - Patent sequence entries, part 26.
3909. gbpat27.seq - Patent sequence entries, part 27.
3910. gbpat28.seq - Patent sequence entries, part 28.
3911. gbpat29.seq - Patent sequence entries, part 29.
3912. gbpat3.seq - Patent sequence entries, part 3.
3913. gbpat30.seq - Patent sequence entries, part 30.
3914. gbpat31.seq - Patent sequence entries, part 31.
3915. gbpat32.seq - Patent sequence entries, part 32.
3916. gbpat33.seq - Patent sequence entries, part 33.
3917. gbpat34.seq - Patent sequence entries, part 34.
3918. gbpat35.seq - Patent sequence entries, part 35.
3919. gbpat36.seq - Patent sequence entries, part 36.
3920. gbpat37.seq - Patent sequence entries, part 37.
3921. gbpat38.seq - Patent sequence entries, part 38.
3922. gbpat39.seq - Patent sequence entries, part 39.
3923. gbpat4.seq - Patent sequence entries, part 4.
3924. gbpat40.seq - Patent sequence entries, part 40.
3925. gbpat41.seq - Patent sequence entries, part 41.
3926. gbpat42.seq - Patent sequence entries, part 42.
3927. gbpat43.seq - Patent sequence entries, part 43.
3928. gbpat44.seq - Patent sequence entries, part 44.
3929. gbpat45.seq - Patent sequence entries, part 45.
3930. gbpat46.seq - Patent sequence entries, part 46.
3931. gbpat47.seq - Patent sequence entries, part 47.
3932. gbpat48.seq - Patent sequence entries, part 48.
3933. gbpat49.seq - Patent sequence entries, part 49.
3934. gbpat5.seq - Patent sequence entries, part 5.
3935. gbpat50.seq - Patent sequence entries, part 50.
3936. gbpat51.seq - Patent sequence entries, part 51.
3937. gbpat52.seq - Patent sequence entries, part 52.
3938. gbpat53.seq - Patent sequence entries, part 53.
3939. gbpat54.seq - Patent sequence entries, part 54.
3940. gbpat55.seq - Patent sequence entries, part 55.
3941. gbpat56.seq - Patent sequence entries, part 56.
3942. gbpat57.seq - Patent sequence entries, part 57.
3943. gbpat58.seq - Patent sequence entries, part 58.
3944. gbpat59.seq - Patent sequence entries, part 59.
3945. gbpat6.seq - Patent sequence entries, part 6.
3946. gbpat60.seq - Patent sequence entries, part 60.
3947. gbpat61.seq - Patent sequence entries, part 61.
3948. gbpat62.seq - Patent sequence entries, part 62.
3949. gbpat63.seq - Patent sequence entries, part 63.
3950. gbpat64.seq - Patent sequence entries, part 64.
3951. gbpat65.seq - Patent sequence entries, part 65.
3952. gbpat66.seq - Patent sequence entries, part 66.
3953. gbpat67.seq - Patent sequence entries, part 67.
3954. gbpat68.seq - Patent sequence entries, part 68.
3955. gbpat69.seq - Patent sequence entries, part 69.
3956. gbpat7.seq - Patent sequence entries, part 7.
3957. gbpat70.seq - Patent sequence entries, part 70.
3958. gbpat71.seq - Patent sequence entries, part 71.
3959. gbpat72.seq - Patent sequence entries, part 72.
3960. gbpat73.seq - Patent sequence entries, part 73.
3961. gbpat74.seq - Patent sequence entries, part 74.
3962. gbpat75.seq - Patent sequence entries, part 75.
3963. gbpat76.seq - Patent sequence entries, part 76.
3964. gbpat77.seq - Patent sequence entries, part 77.
3965. gbpat78.seq - Patent sequence entries, part 78.
3966. gbpat79.seq - Patent sequence entries, part 79.
3967. gbpat8.seq - Patent sequence entries, part 8.
3968. gbpat80.seq - Patent sequence entries, part 80.
3969. gbpat81.seq - Patent sequence entries, part 81.
3970. gbpat82.seq - Patent sequence entries, part 82.
3971. gbpat83.seq - Patent sequence entries, part 83.
3972. gbpat84.seq - Patent sequence entries, part 84.
3973. gbpat85.seq - Patent sequence entries, part 85.
3974. gbpat86.seq - Patent sequence entries, part 86.
3975. gbpat87.seq - Patent sequence entries, part 87.
3976. gbpat88.seq - Patent sequence entries, part 88.
3977. gbpat89.seq - Patent sequence entries, part 89.
3978. gbpat9.seq - Patent sequence entries, part 9.
3979. gbpat90.seq - Patent sequence entries, part 90.
3980. gbpat91.seq - Patent sequence entries, part 91.
3981. gbpat92.seq - Patent sequence entries, part 92.
3982. gbpat93.seq - Patent sequence entries, part 93.
3983. gbpat94.seq - Patent sequence entries, part 94.
3984. gbpat95.seq - Patent sequence entries, part 95.
3985. gbpat96.seq - Patent sequence entries, part 96.
3986. gbpat97.seq - Patent sequence entries, part 97.
3987. gbpat98.seq - Patent sequence entries, part 98.
3988. gbpat99.seq - Patent sequence entries, part 99.
3989. gbphg1.seq - Phage sequence entries, part 1.
3990. gbphg2.seq - Phage sequence entries, part 2.
3991. gbphg3.seq - Phage sequence entries, part 3.
3992. gbphg4.seq - Phage sequence entries, part 4.
3993. gbphg5.seq - Phage sequence entries, part 5.
3994. gbphg6.seq - Phage sequence entries, part 6.
3995. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
3996. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
3997. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
3998. gbpln1000.seq - Plant sequence entries (including fungi and algae), part 1000.
3999. gbpln1001.seq - Plant sequence entries (including fungi and algae), part 1001.
4000. gbpln1002.seq - Plant sequence entries (including fungi and algae), part 1002.
4001. gbpln1003.seq - Plant sequence entries (including fungi and algae), part 1003.
4002. gbpln1004.seq - Plant sequence entries (including fungi and algae), part 1004.
4003. gbpln1005.seq - Plant sequence entries (including fungi and algae), part 1005.
4004. gbpln1006.seq - Plant sequence entries (including fungi and algae), part 1006.
4005. gbpln1007.seq - Plant sequence entries (including fungi and algae), part 1007.
4006. gbpln1008.seq - Plant sequence entries (including fungi and algae), part 1008.
4007. gbpln1009.seq - Plant sequence entries (including fungi and algae), part 1009.
4008. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
4009. gbpln1010.seq - Plant sequence entries (including fungi and algae), part 1010.
4010. gbpln1011.seq - Plant sequence entries (including fungi and algae), part 1011.
4011. gbpln1012.seq - Plant sequence entries (including fungi and algae), part 1012.
4012. gbpln1013.seq - Plant sequence entries (including fungi and algae), part 1013.
4013. gbpln1014.seq - Plant sequence entries (including fungi and algae), part 1014.
4014. gbpln1015.seq - Plant sequence entries (including fungi and algae), part 1015.
4015. gbpln1016.seq - Plant sequence entries (including fungi and algae), part 1016.
4016. gbpln1017.seq - Plant sequence entries (including fungi and algae), part 1017.
4017. gbpln1018.seq - Plant sequence entries (including fungi and algae), part 1018.
4018. gbpln1019.seq - Plant sequence entries (including fungi and algae), part 1019.
4019. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
4020. gbpln1020.seq - Plant sequence entries (including fungi and algae), part 1020.
4021. gbpln1021.seq - Plant sequence entries (including fungi and algae), part 1021.
4022. gbpln1022.seq - Plant sequence entries (including fungi and algae), part 1022.
4023. gbpln1023.seq - Plant sequence entries (including fungi and algae), part 1023.
4024. gbpln1024.seq - Plant sequence entries (including fungi and algae), part 1024.
4025. gbpln1025.seq - Plant sequence entries (including fungi and algae), part 1025.
4026. gbpln1026.seq - Plant sequence entries (including fungi and algae), part 1026.
4027. gbpln1027.seq - Plant sequence entries (including fungi and algae), part 1027.
4028. gbpln1028.seq - Plant sequence entries (including fungi and algae), part 1028.
4029. gbpln1029.seq - Plant sequence entries (including fungi and algae), part 1029.
4030. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
4031. gbpln1030.seq - Plant sequence entries (including fungi and algae), part 1030.
4032. gbpln1031.seq - Plant sequence entries (including fungi and algae), part 1031.
4033. gbpln1032.seq - Plant sequence entries (including fungi and algae), part 1032.
4034. gbpln1033.seq - Plant sequence entries (including fungi and algae), part 1033.
4035. gbpln1034.seq - Plant sequence entries (including fungi and algae), part 1034.
4036. gbpln1035.seq - Plant sequence entries (including fungi and algae), part 1035.
4037. gbpln1036.seq - Plant sequence entries (including fungi and algae), part 1036.
4038. gbpln1037.seq - Plant sequence entries (including fungi and algae), part 1037.
4039. gbpln1038.seq - Plant sequence entries (including fungi and algae), part 1038.
4040. gbpln1039.seq - Plant sequence entries (including fungi and algae), part 1039.
4041. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
4042. gbpln1040.seq - Plant sequence entries (including fungi and algae), part 1040.
4043. gbpln1041.seq - Plant sequence entries (including fungi and algae), part 1041.
4044. gbpln1042.seq - Plant sequence entries (including fungi and algae), part 1042.
4045. gbpln1043.seq - Plant sequence entries (including fungi and algae), part 1043.
4046. gbpln1044.seq - Plant sequence entries (including fungi and algae), part 1044.
4047. gbpln1045.seq - Plant sequence entries (including fungi and algae), part 1045.
4048. gbpln1046.seq - Plant sequence entries (including fungi and algae), part 1046.
4049. gbpln1047.seq - Plant sequence entries (including fungi and algae), part 1047.
4050. gbpln1048.seq - Plant sequence entries (including fungi and algae), part 1048.
4051. gbpln1049.seq - Plant sequence entries (including fungi and algae), part 1049.
4052. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
4053. gbpln1050.seq - Plant sequence entries (including fungi and algae), part 1050.
4054. gbpln1051.seq - Plant sequence entries (including fungi and algae), part 1051.
4055. gbpln1052.seq - Plant sequence entries (including fungi and algae), part 1052.
4056. gbpln1053.seq - Plant sequence entries (including fungi and algae), part 1053.
4057. gbpln1054.seq - Plant sequence entries (including fungi and algae), part 1054.
4058. gbpln1055.seq - Plant sequence entries (including fungi and algae), part 1055.
4059. gbpln1056.seq - Plant sequence entries (including fungi and algae), part 1056.
4060. gbpln1057.seq - Plant sequence entries (including fungi and algae), part 1057.
4061. gbpln1058.seq - Plant sequence entries (including fungi and algae), part 1058.
4062. gbpln1059.seq - Plant sequence entries (including fungi and algae), part 1059.
4063. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
4064. gbpln1060.seq - Plant sequence entries (including fungi and algae), part 1060.
4065. gbpln1061.seq - Plant sequence entries (including fungi and algae), part 1061.
4066. gbpln1062.seq - Plant sequence entries (including fungi and algae), part 1062.
4067. gbpln1063.seq - Plant sequence entries (including fungi and algae), part 1063.
4068. gbpln1064.seq - Plant sequence entries (including fungi and algae), part 1064.
4069. gbpln1065.seq - Plant sequence entries (including fungi and algae), part 1065.
4070. gbpln1066.seq - Plant sequence entries (including fungi and algae), part 1066.
4071. gbpln1067.seq - Plant sequence entries (including fungi and algae), part 1067.
4072. gbpln1068.seq - Plant sequence entries (including fungi and algae), part 1068.
4073. gbpln1069.seq - Plant sequence entries (including fungi and algae), part 1069.
4074. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
4075. gbpln1070.seq - Plant sequence entries (including fungi and algae), part 1070.
4076. gbpln1071.seq - Plant sequence entries (including fungi and algae), part 1071.
4077. gbpln1072.seq - Plant sequence entries (including fungi and algae), part 1072.
4078. gbpln1073.seq - Plant sequence entries (including fungi and algae), part 1073.
4079. gbpln1074.seq - Plant sequence entries (including fungi and algae), part 1074.
4080. gbpln1075.seq - Plant sequence entries (including fungi and algae), part 1075.
4081. gbpln1076.seq - Plant sequence entries (including fungi and algae), part 1076.
4082. gbpln1077.seq - Plant sequence entries (including fungi and algae), part 1077.
4083. gbpln1078.seq - Plant sequence entries (including fungi and algae), part 1078.
4084. gbpln1079.seq - Plant sequence entries (including fungi and algae), part 1079.
4085. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
4086. gbpln1080.seq - Plant sequence entries (including fungi and algae), part 1080.
4087. gbpln1081.seq - Plant sequence entries (including fungi and algae), part 1081.
4088. gbpln1082.seq - Plant sequence entries (including fungi and algae), part 1082.
4089. gbpln1083.seq - Plant sequence entries (including fungi and algae), part 1083.
4090. gbpln1084.seq - Plant sequence entries (including fungi and algae), part 1084.
4091. gbpln1085.seq - Plant sequence entries (including fungi and algae), part 1085.
4092. gbpln1086.seq - Plant sequence entries (including fungi and algae), part 1086.
4093. gbpln1087.seq - Plant sequence entries (including fungi and algae), part 1087.
4094. gbpln1088.seq - Plant sequence entries (including fungi and algae), part 1088.
4095. gbpln1089.seq - Plant sequence entries (including fungi and algae), part 1089.
4096. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
4097. gbpln1090.seq - Plant sequence entries (including fungi and algae), part 1090.
4098. gbpln1091.seq - Plant sequence entries (including fungi and algae), part 1091.
4099. gbpln1092.seq - Plant sequence entries (including fungi and algae), part 1092.
4100. gbpln1093.seq - Plant sequence entries (including fungi and algae), part 1093.
4101. gbpln1094.seq - Plant sequence entries (including fungi and algae), part 1094.
4102. gbpln1095.seq - Plant sequence entries (including fungi and algae), part 1095.
4103. gbpln1096.seq - Plant sequence entries (including fungi and algae), part 1096.
4104. gbpln1097.seq - Plant sequence entries (including fungi and algae), part 1097.
4105. gbpln1098.seq - Plant sequence entries (including fungi and algae), part 1098.
4106. gbpln1099.seq - Plant sequence entries (including fungi and algae), part 1099.
4107. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
4108. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
4109. gbpln1100.seq - Plant sequence entries (including fungi and algae), part 1100.
4110. gbpln1101.seq - Plant sequence entries (including fungi and algae), part 1101.
4111. gbpln1102.seq - Plant sequence entries (including fungi and algae), part 1102.
4112. gbpln1103.seq - Plant sequence entries (including fungi and algae), part 1103.
4113. gbpln1104.seq - Plant sequence entries (including fungi and algae), part 1104.
4114. gbpln1105.seq - Plant sequence entries (including fungi and algae), part 1105.
4115. gbpln1106.seq - Plant sequence entries (including fungi and algae), part 1106.
4116. gbpln1107.seq - Plant sequence entries (including fungi and algae), part 1107.
4117. gbpln1108.seq - Plant sequence entries (including fungi and algae), part 1108.
4118. gbpln1109.seq - Plant sequence entries (including fungi and algae), part 1109.
4119. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
4120. gbpln1110.seq - Plant sequence entries (including fungi and algae), part 1110.
4121. gbpln1111.seq - Plant sequence entries (including fungi and algae), part 1111.
4122. gbpln1112.seq - Plant sequence entries (including fungi and algae), part 1112.
4123. gbpln1113.seq - Plant sequence entries (including fungi and algae), part 1113.
4124. gbpln1114.seq - Plant sequence entries (including fungi and algae), part 1114.
4125. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
4126. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
4127. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
4128. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
4129. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
4130. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
4131. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
4132. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
4133. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
4134. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
4135. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
4136. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
4137. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
4138. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
4139. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
4140. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
4141. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
4142. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
4143. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
4144. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
4145. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
4146. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
4147. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
4148. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
4149. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
4150. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
4151. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
4152. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
4153. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
4154. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
4155. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
4156. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
4157. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
4158. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
4159. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
4160. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
4161. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
4162. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
4163. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
4164. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
4165. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
4166. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
4167. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
4168. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
4169. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
4170. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
4171. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
4172. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
4173. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
4174. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
4175. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
4176. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
4177. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
4178. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
4179. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
4180. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
4181. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
4182. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
4183. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
4184. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
4185. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
4186. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
4187. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
4188. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
4189. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
4190. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
4191. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
4192. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
4193. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
4194. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
4195. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
4196. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
4197. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
4198. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
4199. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
4200. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
4201. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
4202. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
4203. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
4204. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
4205. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
4206. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
4207. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
4208. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
4209. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
4210. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
4211. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
4212. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
4213. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
4214. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
4215. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
4216. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
4217. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
4218. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
4219. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
4220. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
4221. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
4222. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
4223. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
4224. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
4225. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
4226. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
4227. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
4228. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
4229. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
4230. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
4231. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
4232. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
4233. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
4234. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
4235. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
4236. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
4237. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
4238. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
4239. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
4240. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
4241. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
4242. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
4243. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
4244. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
4245. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
4246. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
4247. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
4248. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
4249. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
4250. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
4251. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
4252. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
4253. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
4254. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
4255. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
4256. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
4257. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
4258. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
4259. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
4260. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
4261. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
4262. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
4263. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
4264. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
4265. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
4266. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
4267. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
4268. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
4269. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
4270. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
4271. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
4272. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
4273. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
4274. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
4275. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
4276. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
4277. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
4278. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
4279. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
4280. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
4281. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
4282. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
4283. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
4284. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
4285. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
4286. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
4287. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
4288. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
4289. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
4290. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
4291. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
4292. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
4293. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
4294. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
4295. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
4296. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
4297. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
4298. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
4299. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
4300. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
4301. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
4302. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
4303. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
4304. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
4305. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
4306. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
4307. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
4308. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
4309. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
4310. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
4311. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
4312. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
4313. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
4314. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
4315. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
4316. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
4317. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
4318. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
4319. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
4320. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
4321. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
4322. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
4323. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
4324. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
4325. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
4326. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
4327. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
4328. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
4329. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
4330. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
4331. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
4332. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
4333. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
4334. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
4335. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
4336. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
4337. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
4338. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
4339. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
4340. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
4341. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
4342. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
4343. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
4344. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
4345. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
4346. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
4347. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
4348. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
4349. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
4350. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
4351. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
4352. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
4353. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
4354. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
4355. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
4356. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
4357. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
4358. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
4359. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
4360. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
4361. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
4362. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
4363. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
4364. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
4365. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
4366. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
4367. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
4368. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
4369. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
4370. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
4371. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
4372. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
4373. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
4374. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
4375. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
4376. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
4377. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
4378. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
4379. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
4380. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
4381. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
4382. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
4383. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
4384. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
4385. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
4386. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
4387. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
4388. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
4389. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
4390. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
4391. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
4392. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
4393. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
4394. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
4395. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
4396. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
4397. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
4398. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
4399. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
4400. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
4401. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
4402. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
4403. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
4404. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
4405. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
4406. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
4407. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
4408. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
4409. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
4410. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
4411. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
4412. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
4413. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
4414. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
4415. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
4416. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
4417. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
4418. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
4419. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
4420. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
4421. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
4422. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
4423. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
4424. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
4425. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
4426. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
4427. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
4428. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
4429. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
4430. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
4431. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
4432. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
4433. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
4434. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
4435. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
4436. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
4437. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
4438. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
4439. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
4440. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
4441. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
4442. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
4443. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
4444. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
4445. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
4446. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
4447. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
4448. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
4449. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
4450. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
4451. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
4452. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
4453. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
4454. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
4455. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
4456. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
4457. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
4458. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
4459. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
4460. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
4461. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
4462. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
4463. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
4464. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
4465. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
4466. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
4467. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
4468. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
4469. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
4470. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
4471. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
4472. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
4473. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
4474. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
4475. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
4476. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
4477. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
4478. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
4479. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
4480. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
4481. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
4482. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
4483. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
4484. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
4485. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
4486. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
4487. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
4488. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
4489. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
4490. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
4491. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
4492. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
4493. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
4494. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
4495. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
4496. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
4497. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
4498. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
4499. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
4500. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
4501. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
4502. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
4503. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
4504. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
4505. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
4506. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
4507. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
4508. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
4509. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
4510. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
4511. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
4512. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
4513. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
4514. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
4515. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
4516. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
4517. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
4518. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
4519. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
4520. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
4521. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
4522. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
4523. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
4524. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
4525. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
4526. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
4527. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
4528. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
4529. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
4530. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
4531. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
4532. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
4533. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
4534. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
4535. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
4536. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
4537. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
4538. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
4539. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
4540. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
4541. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
4542. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
4543. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
4544. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
4545. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
4546. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
4547. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
4548. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
4549. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
4550. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
4551. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
4552. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
4553. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
4554. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
4555. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
4556. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
4557. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
4558. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
4559. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
4560. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
4561. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
4562. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
4563. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
4564. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
4565. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
4566. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
4567. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
4568. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
4569. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
4570. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
4571. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
4572. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
4573. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
4574. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
4575. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
4576. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
4577. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
4578. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
4579. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
4580. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
4581. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
4582. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
4583. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
4584. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
4585. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
4586. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
4587. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
4588. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
4589. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
4590. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
4591. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
4592. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
4593. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
4594. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
4595. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
4596. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
4597. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
4598. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
4599. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
4600. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
4601. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
4602. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
4603. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
4604. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
4605. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
4606. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
4607. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
4608. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548.
4609. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549.
4610. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
4611. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550.
4612. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551.
4613. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552.
4614. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553.
4615. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554.
4616. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555.
4617. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556.
4618. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557.
4619. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558.
4620. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559.
4621. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
4622. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560.
4623. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561.
4624. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562.
4625. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563.
4626. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564.
4627. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565.
4628. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566.
4629. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567.
4630. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568.
4631. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569.
4632. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
4633. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570.
4634. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571.
4635. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572.
4636. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573.
4637. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574.
4638. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575.
4639. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576.
4640. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577.
4641. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578.
4642. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579.
4643. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
4644. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580.
4645. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581.
4646. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582.
4647. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583.
4648. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584.
4649. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585.
4650. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586.
4651. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587.
4652. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588.
4653. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589.
4654. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
4655. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590.
4656. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591.
4657. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592.
4658. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593.
4659. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594.
4660. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595.
4661. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596.
4662. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597.
4663. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598.
4664. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599.
4665. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
4666. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
4667. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600.
4668. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601.
4669. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602.
4670. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603.
4671. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604.
4672. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605.
4673. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606.
4674. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607.
4675. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608.
4676. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609.
4677. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
4678. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610.
4679. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611.
4680. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612.
4681. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613.
4682. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614.
4683. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615.
4684. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616.
4685. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617.
4686. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618.
4687. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619.
4688. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
4689. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620.
4690. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621.
4691. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622.
4692. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623.
4693. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624.
4694. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625.
4695. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626.
4696. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627.
4697. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628.
4698. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629.
4699. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
4700. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630.
4701. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631.
4702. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632.
4703. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633.
4704. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634.
4705. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635.
4706. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636.
4707. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637.
4708. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638.
4709. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639.
4710. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
4711. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640.
4712. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641.
4713. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642.
4714. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643.
4715. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644.
4716. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645.
4717. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646.
4718. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647.
4719. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648.
4720. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649.
4721. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
4722. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650.
4723. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651.
4724. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652.
4725. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653.
4726. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654.
4727. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655.
4728. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656.
4729. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657.
4730. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658.
4731. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659.
4732. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
4733. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660.
4734. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661.
4735. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662.
4736. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663.
4737. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664.
4738. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665.
4739. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666.
4740. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667.
4741. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668.
4742. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669.
4743. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
4744. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670.
4745. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671.
4746. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672.
4747. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673.
4748. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674.
4749. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675.
4750. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676.
4751. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677.
4752. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678.
4753. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679.
4754. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
4755. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680.
4756. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681.
4757. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682.
4758. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683.
4759. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684.
4760. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685.
4761. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686.
4762. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687.
4763. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688.
4764. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689.
4765. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
4766. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690.
4767. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691.
4768. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692.
4769. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693.
4770. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694.
4771. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695.
4772. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696.
4773. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697.
4774. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698.
4775. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699.
4776. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
4777. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
4778. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700.
4779. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701.
4780. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702.
4781. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703.
4782. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704.
4783. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705.
4784. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706.
4785. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707.
4786. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708.
4787. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709.
4788. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
4789. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710.
4790. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711.
4791. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712.
4792. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713.
4793. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714.
4794. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715.
4795. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716.
4796. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717.
4797. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718.
4798. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719.
4799. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
4800. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720.
4801. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721.
4802. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722.
4803. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723.
4804. gbpln724.seq - Plant sequence entries (including fungi and algae), part 724.
4805. gbpln725.seq - Plant sequence entries (including fungi and algae), part 725.
4806. gbpln726.seq - Plant sequence entries (including fungi and algae), part 726.
4807. gbpln727.seq - Plant sequence entries (including fungi and algae), part 727.
4808. gbpln728.seq - Plant sequence entries (including fungi and algae), part 728.
4809. gbpln729.seq - Plant sequence entries (including fungi and algae), part 729.
4810. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
4811. gbpln730.seq - Plant sequence entries (including fungi and algae), part 730.
4812. gbpln731.seq - Plant sequence entries (including fungi and algae), part 731.
4813. gbpln732.seq - Plant sequence entries (including fungi and algae), part 732.
4814. gbpln733.seq - Plant sequence entries (including fungi and algae), part 733.
4815. gbpln734.seq - Plant sequence entries (including fungi and algae), part 734.
4816. gbpln735.seq - Plant sequence entries (including fungi and algae), part 735.
4817. gbpln736.seq - Plant sequence entries (including fungi and algae), part 736.
4818. gbpln737.seq - Plant sequence entries (including fungi and algae), part 737.
4819. gbpln738.seq - Plant sequence entries (including fungi and algae), part 738.
4820. gbpln739.seq - Plant sequence entries (including fungi and algae), part 739.
4821. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
4822. gbpln740.seq - Plant sequence entries (including fungi and algae), part 740.
4823. gbpln741.seq - Plant sequence entries (including fungi and algae), part 741.
4824. gbpln742.seq - Plant sequence entries (including fungi and algae), part 742.
4825. gbpln743.seq - Plant sequence entries (including fungi and algae), part 743.
4826. gbpln744.seq - Plant sequence entries (including fungi and algae), part 744.
4827. gbpln745.seq - Plant sequence entries (including fungi and algae), part 745.
4828. gbpln746.seq - Plant sequence entries (including fungi and algae), part 746.
4829. gbpln747.seq - Plant sequence entries (including fungi and algae), part 747.
4830. gbpln748.seq - Plant sequence entries (including fungi and algae), part 748.
4831. gbpln749.seq - Plant sequence entries (including fungi and algae), part 749.
4832. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
4833. gbpln750.seq - Plant sequence entries (including fungi and algae), part 750.
4834. gbpln751.seq - Plant sequence entries (including fungi and algae), part 751.
4835. gbpln752.seq - Plant sequence entries (including fungi and algae), part 752.
4836. gbpln753.seq - Plant sequence entries (including fungi and algae), part 753.
4837. gbpln754.seq - Plant sequence entries (including fungi and algae), part 754.
4838. gbpln755.seq - Plant sequence entries (including fungi and algae), part 755.
4839. gbpln756.seq - Plant sequence entries (including fungi and algae), part 756.
4840. gbpln757.seq - Plant sequence entries (including fungi and algae), part 757.
4841. gbpln758.seq - Plant sequence entries (including fungi and algae), part 758.
4842. gbpln759.seq - Plant sequence entries (including fungi and algae), part 759.
4843. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
4844. gbpln760.seq - Plant sequence entries (including fungi and algae), part 760.
4845. gbpln761.seq - Plant sequence entries (including fungi and algae), part 761.
4846. gbpln762.seq - Plant sequence entries (including fungi and algae), part 762.
4847. gbpln763.seq - Plant sequence entries (including fungi and algae), part 763.
4848. gbpln764.seq - Plant sequence entries (including fungi and algae), part 764.
4849. gbpln765.seq - Plant sequence entries (including fungi and algae), part 765.
4850. gbpln766.seq - Plant sequence entries (including fungi and algae), part 766.
4851. gbpln767.seq - Plant sequence entries (including fungi and algae), part 767.
4852. gbpln768.seq - Plant sequence entries (including fungi and algae), part 768.
4853. gbpln769.seq - Plant sequence entries (including fungi and algae), part 769.
4854. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
4855. gbpln770.seq - Plant sequence entries (including fungi and algae), part 770.
4856. gbpln771.seq - Plant sequence entries (including fungi and algae), part 771.
4857. gbpln772.seq - Plant sequence entries (including fungi and algae), part 772.
4858. gbpln773.seq - Plant sequence entries (including fungi and algae), part 773.
4859. gbpln774.seq - Plant sequence entries (including fungi and algae), part 774.
4860. gbpln775.seq - Plant sequence entries (including fungi and algae), part 775.
4861. gbpln776.seq - Plant sequence entries (including fungi and algae), part 776.
4862. gbpln777.seq - Plant sequence entries (including fungi and algae), part 777.
4863. gbpln778.seq - Plant sequence entries (including fungi and algae), part 778.
4864. gbpln779.seq - Plant sequence entries (including fungi and algae), part 779.
4865. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
4866. gbpln780.seq - Plant sequence entries (including fungi and algae), part 780.
4867. gbpln781.seq - Plant sequence entries (including fungi and algae), part 781.
4868. gbpln782.seq - Plant sequence entries (including fungi and algae), part 782.
4869. gbpln783.seq - Plant sequence entries (including fungi and algae), part 783.
4870. gbpln784.seq - Plant sequence entries (including fungi and algae), part 784.
4871. gbpln785.seq - Plant sequence entries (including fungi and algae), part 785.
4872. gbpln786.seq - Plant sequence entries (including fungi and algae), part 786.
4873. gbpln787.seq - Plant sequence entries (including fungi and algae), part 787.
4874. gbpln788.seq - Plant sequence entries (including fungi and algae), part 788.
4875. gbpln789.seq - Plant sequence entries (including fungi and algae), part 789.
4876. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
4877. gbpln790.seq - Plant sequence entries (including fungi and algae), part 790.
4878. gbpln791.seq - Plant sequence entries (including fungi and algae), part 791.
4879. gbpln792.seq - Plant sequence entries (including fungi and algae), part 792.
4880. gbpln793.seq - Plant sequence entries (including fungi and algae), part 793.
4881. gbpln794.seq - Plant sequence entries (including fungi and algae), part 794.
4882. gbpln795.seq - Plant sequence entries (including fungi and algae), part 795.
4883. gbpln796.seq - Plant sequence entries (including fungi and algae), part 796.
4884. gbpln797.seq - Plant sequence entries (including fungi and algae), part 797.
4885. gbpln798.seq - Plant sequence entries (including fungi and algae), part 798.
4886. gbpln799.seq - Plant sequence entries (including fungi and algae), part 799.
4887. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
4888. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
4889. gbpln800.seq - Plant sequence entries (including fungi and algae), part 800.
4890. gbpln801.seq - Plant sequence entries (including fungi and algae), part 801.
4891. gbpln802.seq - Plant sequence entries (including fungi and algae), part 802.
4892. gbpln803.seq - Plant sequence entries (including fungi and algae), part 803.
4893. gbpln804.seq - Plant sequence entries (including fungi and algae), part 804.
4894. gbpln805.seq - Plant sequence entries (including fungi and algae), part 805.
4895. gbpln806.seq - Plant sequence entries (including fungi and algae), part 806.
4896. gbpln807.seq - Plant sequence entries (including fungi and algae), part 807.
4897. gbpln808.seq - Plant sequence entries (including fungi and algae), part 808.
4898. gbpln809.seq - Plant sequence entries (including fungi and algae), part 809.
4899. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
4900. gbpln810.seq - Plant sequence entries (including fungi and algae), part 810.
4901. gbpln811.seq - Plant sequence entries (including fungi and algae), part 811.
4902. gbpln812.seq - Plant sequence entries (including fungi and algae), part 812.
4903. gbpln813.seq - Plant sequence entries (including fungi and algae), part 813.
4904. gbpln814.seq - Plant sequence entries (including fungi and algae), part 814.
4905. gbpln815.seq - Plant sequence entries (including fungi and algae), part 815.
4906. gbpln816.seq - Plant sequence entries (including fungi and algae), part 816.
4907. gbpln817.seq - Plant sequence entries (including fungi and algae), part 817.
4908. gbpln818.seq - Plant sequence entries (including fungi and algae), part 818.
4909. gbpln819.seq - Plant sequence entries (including fungi and algae), part 819.
4910. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
4911. gbpln820.seq - Plant sequence entries (including fungi and algae), part 820.
4912. gbpln821.seq - Plant sequence entries (including fungi and algae), part 821.
4913. gbpln822.seq - Plant sequence entries (including fungi and algae), part 822.
4914. gbpln823.seq - Plant sequence entries (including fungi and algae), part 823.
4915. gbpln824.seq - Plant sequence entries (including fungi and algae), part 824.
4916. gbpln825.seq - Plant sequence entries (including fungi and algae), part 825.
4917. gbpln826.seq - Plant sequence entries (including fungi and algae), part 826.
4918. gbpln827.seq - Plant sequence entries (including fungi and algae), part 827.
4919. gbpln828.seq - Plant sequence entries (including fungi and algae), part 828.
4920. gbpln829.seq - Plant sequence entries (including fungi and algae), part 829.
4921. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
4922. gbpln830.seq - Plant sequence entries (including fungi and algae), part 830.
4923. gbpln831.seq - Plant sequence entries (including fungi and algae), part 831.
4924. gbpln832.seq - Plant sequence entries (including fungi and algae), part 832.
4925. gbpln833.seq - Plant sequence entries (including fungi and algae), part 833.
4926. gbpln834.seq - Plant sequence entries (including fungi and algae), part 834.
4927. gbpln835.seq - Plant sequence entries (including fungi and algae), part 835.
4928. gbpln836.seq - Plant sequence entries (including fungi and algae), part 836.
4929. gbpln837.seq - Plant sequence entries (including fungi and algae), part 837.
4930. gbpln838.seq - Plant sequence entries (including fungi and algae), part 838.
4931. gbpln839.seq - Plant sequence entries (including fungi and algae), part 839.
4932. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
4933. gbpln840.seq - Plant sequence entries (including fungi and algae), part 840.
4934. gbpln841.seq - Plant sequence entries (including fungi and algae), part 841.
4935. gbpln842.seq - Plant sequence entries (including fungi and algae), part 842.
4936. gbpln843.seq - Plant sequence entries (including fungi and algae), part 843.
4937. gbpln844.seq - Plant sequence entries (including fungi and algae), part 844.
4938. gbpln845.seq - Plant sequence entries (including fungi and algae), part 845.
4939. gbpln846.seq - Plant sequence entries (including fungi and algae), part 846.
4940. gbpln847.seq - Plant sequence entries (including fungi and algae), part 847.
4941. gbpln848.seq - Plant sequence entries (including fungi and algae), part 848.
4942. gbpln849.seq - Plant sequence entries (including fungi and algae), part 849.
4943. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
4944. gbpln850.seq - Plant sequence entries (including fungi and algae), part 850.
4945. gbpln851.seq - Plant sequence entries (including fungi and algae), part 851.
4946. gbpln852.seq - Plant sequence entries (including fungi and algae), part 852.
4947. gbpln853.seq - Plant sequence entries (including fungi and algae), part 853.
4948. gbpln854.seq - Plant sequence entries (including fungi and algae), part 854.
4949. gbpln855.seq - Plant sequence entries (including fungi and algae), part 855.
4950. gbpln856.seq - Plant sequence entries (including fungi and algae), part 856.
4951. gbpln857.seq - Plant sequence entries (including fungi and algae), part 857.
4952. gbpln858.seq - Plant sequence entries (including fungi and algae), part 858.
4953. gbpln859.seq - Plant sequence entries (including fungi and algae), part 859.
4954. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
4955. gbpln860.seq - Plant sequence entries (including fungi and algae), part 860.
4956. gbpln861.seq - Plant sequence entries (including fungi and algae), part 861.
4957. gbpln862.seq - Plant sequence entries (including fungi and algae), part 862.
4958. gbpln863.seq - Plant sequence entries (including fungi and algae), part 863.
4959. gbpln864.seq - Plant sequence entries (including fungi and algae), part 864.
4960. gbpln865.seq - Plant sequence entries (including fungi and algae), part 865.
4961. gbpln866.seq - Plant sequence entries (including fungi and algae), part 866.
4962. gbpln867.seq - Plant sequence entries (including fungi and algae), part 867.
4963. gbpln868.seq - Plant sequence entries (including fungi and algae), part 868.
4964. gbpln869.seq - Plant sequence entries (including fungi and algae), part 869.
4965. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
4966. gbpln870.seq - Plant sequence entries (including fungi and algae), part 870.
4967. gbpln871.seq - Plant sequence entries (including fungi and algae), part 871.
4968. gbpln872.seq - Plant sequence entries (including fungi and algae), part 872.
4969. gbpln873.seq - Plant sequence entries (including fungi and algae), part 873.
4970. gbpln874.seq - Plant sequence entries (including fungi and algae), part 874.
4971. gbpln875.seq - Plant sequence entries (including fungi and algae), part 875.
4972. gbpln876.seq - Plant sequence entries (including fungi and algae), part 876.
4973. gbpln877.seq - Plant sequence entries (including fungi and algae), part 877.
4974. gbpln878.seq - Plant sequence entries (including fungi and algae), part 878.
4975. gbpln879.seq - Plant sequence entries (including fungi and algae), part 879.
4976. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
4977. gbpln880.seq - Plant sequence entries (including fungi and algae), part 880.
4978. gbpln881.seq - Plant sequence entries (including fungi and algae), part 881.
4979. gbpln882.seq - Plant sequence entries (including fungi and algae), part 882.
4980. gbpln883.seq - Plant sequence entries (including fungi and algae), part 883.
4981. gbpln884.seq - Plant sequence entries (including fungi and algae), part 884.
4982. gbpln885.seq - Plant sequence entries (including fungi and algae), part 885.
4983. gbpln886.seq - Plant sequence entries (including fungi and algae), part 886.
4984. gbpln887.seq - Plant sequence entries (including fungi and algae), part 887.
4985. gbpln888.seq - Plant sequence entries (including fungi and algae), part 888.
4986. gbpln889.seq - Plant sequence entries (including fungi and algae), part 889.
4987. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
4988. gbpln890.seq - Plant sequence entries (including fungi and algae), part 890.
4989. gbpln891.seq - Plant sequence entries (including fungi and algae), part 891.
4990. gbpln892.seq - Plant sequence entries (including fungi and algae), part 892.
4991. gbpln893.seq - Plant sequence entries (including fungi and algae), part 893.
4992. gbpln894.seq - Plant sequence entries (including fungi and algae), part 894.
4993. gbpln895.seq - Plant sequence entries (including fungi and algae), part 895.
4994. gbpln896.seq - Plant sequence entries (including fungi and algae), part 896.
4995. gbpln897.seq - Plant sequence entries (including fungi and algae), part 897.
4996. gbpln898.seq - Plant sequence entries (including fungi and algae), part 898.
4997. gbpln899.seq - Plant sequence entries (including fungi and algae), part 899.
4998. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
4999. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
5000. gbpln900.seq - Plant sequence entries (including fungi and algae), part 900.
5001. gbpln901.seq - Plant sequence entries (including fungi and algae), part 901.
5002. gbpln902.seq - Plant sequence entries (including fungi and algae), part 902.
5003. gbpln903.seq - Plant sequence entries (including fungi and algae), part 903.
5004. gbpln904.seq - Plant sequence entries (including fungi and algae), part 904.
5005. gbpln905.seq - Plant sequence entries (including fungi and algae), part 905.
5006. gbpln906.seq - Plant sequence entries (including fungi and algae), part 906.
5007. gbpln907.seq - Plant sequence entries (including fungi and algae), part 907.
5008. gbpln908.seq - Plant sequence entries (including fungi and algae), part 908.
5009. gbpln909.seq - Plant sequence entries (including fungi and algae), part 909.
5010. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
5011. gbpln910.seq - Plant sequence entries (including fungi and algae), part 910.
5012. gbpln911.seq - Plant sequence entries (including fungi and algae), part 911.
5013. gbpln912.seq - Plant sequence entries (including fungi and algae), part 912.
5014. gbpln913.seq - Plant sequence entries (including fungi and algae), part 913.
5015. gbpln914.seq - Plant sequence entries (including fungi and algae), part 914.
5016. gbpln915.seq - Plant sequence entries (including fungi and algae), part 915.
5017. gbpln916.seq - Plant sequence entries (including fungi and algae), part 916.
5018. gbpln917.seq - Plant sequence entries (including fungi and algae), part 917.
5019. gbpln918.seq - Plant sequence entries (including fungi and algae), part 918.
5020. gbpln919.seq - Plant sequence entries (including fungi and algae), part 919.
5021. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
5022. gbpln920.seq - Plant sequence entries (including fungi and algae), part 920.
5023. gbpln921.seq - Plant sequence entries (including fungi and algae), part 921.
5024. gbpln922.seq - Plant sequence entries (including fungi and algae), part 922.
5025. gbpln923.seq - Plant sequence entries (including fungi and algae), part 923.
5026. gbpln924.seq - Plant sequence entries (including fungi and algae), part 924.
5027. gbpln925.seq - Plant sequence entries (including fungi and algae), part 925.
5028. gbpln926.seq - Plant sequence entries (including fungi and algae), part 926.
5029. gbpln927.seq - Plant sequence entries (including fungi and algae), part 927.
5030. gbpln928.seq - Plant sequence entries (including fungi and algae), part 928.
5031. gbpln929.seq - Plant sequence entries (including fungi and algae), part 929.
5032. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
5033. gbpln930.seq - Plant sequence entries (including fungi and algae), part 930.
5034. gbpln931.seq - Plant sequence entries (including fungi and algae), part 931.
5035. gbpln932.seq - Plant sequence entries (including fungi and algae), part 932.
5036. gbpln933.seq - Plant sequence entries (including fungi and algae), part 933.
5037. gbpln934.seq - Plant sequence entries (including fungi and algae), part 934.
5038. gbpln935.seq - Plant sequence entries (including fungi and algae), part 935.
5039. gbpln936.seq - Plant sequence entries (including fungi and algae), part 936.
5040. gbpln937.seq - Plant sequence entries (including fungi and algae), part 937.
5041. gbpln938.seq - Plant sequence entries (including fungi and algae), part 938.
5042. gbpln939.seq - Plant sequence entries (including fungi and algae), part 939.
5043. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
5044. gbpln940.seq - Plant sequence entries (including fungi and algae), part 940.
5045. gbpln941.seq - Plant sequence entries (including fungi and algae), part 941.
5046. gbpln942.seq - Plant sequence entries (including fungi and algae), part 942.
5047. gbpln943.seq - Plant sequence entries (including fungi and algae), part 943.
5048. gbpln944.seq - Plant sequence entries (including fungi and algae), part 944.
5049. gbpln945.seq - Plant sequence entries (including fungi and algae), part 945.
5050. gbpln946.seq - Plant sequence entries (including fungi and algae), part 946.
5051. gbpln947.seq - Plant sequence entries (including fungi and algae), part 947.
5052. gbpln948.seq - Plant sequence entries (including fungi and algae), part 948.
5053. gbpln949.seq - Plant sequence entries (including fungi and algae), part 949.
5054. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
5055. gbpln950.seq - Plant sequence entries (including fungi and algae), part 950.
5056. gbpln951.seq - Plant sequence entries (including fungi and algae), part 951.
5057. gbpln952.seq - Plant sequence entries (including fungi and algae), part 952.
5058. gbpln953.seq - Plant sequence entries (including fungi and algae), part 953.
5059. gbpln954.seq - Plant sequence entries (including fungi and algae), part 954.
5060. gbpln955.seq - Plant sequence entries (including fungi and algae), part 955.
5061. gbpln956.seq - Plant sequence entries (including fungi and algae), part 956.
5062. gbpln957.seq - Plant sequence entries (including fungi and algae), part 957.
5063. gbpln958.seq - Plant sequence entries (including fungi and algae), part 958.
5064. gbpln959.seq - Plant sequence entries (including fungi and algae), part 959.
5065. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
5066. gbpln960.seq - Plant sequence entries (including fungi and algae), part 960.
5067. gbpln961.seq - Plant sequence entries (including fungi and algae), part 961.
5068. gbpln962.seq - Plant sequence entries (including fungi and algae), part 962.
5069. gbpln963.seq - Plant sequence entries (including fungi and algae), part 963.
5070. gbpln964.seq - Plant sequence entries (including fungi and algae), part 964.
5071. gbpln965.seq - Plant sequence entries (including fungi and algae), part 965.
5072. gbpln966.seq - Plant sequence entries (including fungi and algae), part 966.
5073. gbpln967.seq - Plant sequence entries (including fungi and algae), part 967.
5074. gbpln968.seq - Plant sequence entries (including fungi and algae), part 968.
5075. gbpln969.seq - Plant sequence entries (including fungi and algae), part 969.
5076. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
5077. gbpln970.seq - Plant sequence entries (including fungi and algae), part 970.
5078. gbpln971.seq - Plant sequence entries (including fungi and algae), part 971.
5079. gbpln972.seq - Plant sequence entries (including fungi and algae), part 972.
5080. gbpln973.seq - Plant sequence entries (including fungi and algae), part 973.
5081. gbpln974.seq - Plant sequence entries (including fungi and algae), part 974.
5082. gbpln975.seq - Plant sequence entries (including fungi and algae), part 975.
5083. gbpln976.seq - Plant sequence entries (including fungi and algae), part 976.
5084. gbpln977.seq - Plant sequence entries (including fungi and algae), part 977.
5085. gbpln978.seq - Plant sequence entries (including fungi and algae), part 978.
5086. gbpln979.seq - Plant sequence entries (including fungi and algae), part 979.
5087. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
5088. gbpln980.seq - Plant sequence entries (including fungi and algae), part 980.
5089. gbpln981.seq - Plant sequence entries (including fungi and algae), part 981.
5090. gbpln982.seq - Plant sequence entries (including fungi and algae), part 982.
5091. gbpln983.seq - Plant sequence entries (including fungi and algae), part 983.
5092. gbpln984.seq - Plant sequence entries (including fungi and algae), part 984.
5093. gbpln985.seq - Plant sequence entries (including fungi and algae), part 985.
5094. gbpln986.seq - Plant sequence entries (including fungi and algae), part 986.
5095. gbpln987.seq - Plant sequence entries (including fungi and algae), part 987.
5096. gbpln988.seq - Plant sequence entries (including fungi and algae), part 988.
5097. gbpln989.seq - Plant sequence entries (including fungi and algae), part 989.
5098. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
5099. gbpln990.seq - Plant sequence entries (including fungi and algae), part 990.
5100. gbpln991.seq - Plant sequence entries (including fungi and algae), part 991.
5101. gbpln992.seq - Plant sequence entries (including fungi and algae), part 992.
5102. gbpln993.seq - Plant sequence entries (including fungi and algae), part 993.
5103. gbpln994.seq - Plant sequence entries (including fungi and algae), part 994.
5104. gbpln995.seq - Plant sequence entries (including fungi and algae), part 995.
5105. gbpln996.seq - Plant sequence entries (including fungi and algae), part 996.
5106. gbpln997.seq - Plant sequence entries (including fungi and algae), part 997.
5107. gbpln998.seq - Plant sequence entries (including fungi and algae), part 998.
5108. gbpln999.seq - Plant sequence entries (including fungi and algae), part 999.
5109. gbpri1.seq - Primate sequence entries, part 1.
5110. gbpri10.seq - Primate sequence entries, part 10.
5111. gbpri11.seq - Primate sequence entries, part 11.
5112. gbpri12.seq - Primate sequence entries, part 12.
5113. gbpri13.seq - Primate sequence entries, part 13.
5114. gbpri14.seq - Primate sequence entries, part 14.
5115. gbpri15.seq - Primate sequence entries, part 15.
5116. gbpri16.seq - Primate sequence entries, part 16.
5117. gbpri17.seq - Primate sequence entries, part 17.
5118. gbpri18.seq - Primate sequence entries, part 18.
5119. gbpri19.seq - Primate sequence entries, part 19.
5120. gbpri2.seq - Primate sequence entries, part 2.
5121. gbpri20.seq - Primate sequence entries, part 20.
5122. gbpri21.seq - Primate sequence entries, part 21.
5123. gbpri22.seq - Primate sequence entries, part 22.
5124. gbpri23.seq - Primate sequence entries, part 23.
5125. gbpri24.seq - Primate sequence entries, part 24.
5126. gbpri25.seq - Primate sequence entries, part 25.
5127. gbpri26.seq - Primate sequence entries, part 26.
5128. gbpri27.seq - Primate sequence entries, part 27.
5129. gbpri28.seq - Primate sequence entries, part 28.
5130. gbpri29.seq - Primate sequence entries, part 29.
5131. gbpri3.seq - Primate sequence entries, part 3.
5132. gbpri30.seq - Primate sequence entries, part 30.
5133. gbpri31.seq - Primate sequence entries, part 31.
5134. gbpri32.seq - Primate sequence entries, part 32.
5135. gbpri33.seq - Primate sequence entries, part 33.
5136. gbpri34.seq - Primate sequence entries, part 34.
5137. gbpri35.seq - Primate sequence entries, part 35.
5138. gbpri36.seq - Primate sequence entries, part 36.
5139. gbpri37.seq - Primate sequence entries, part 37.
5140. gbpri38.seq - Primate sequence entries, part 38.
5141. gbpri39.seq - Primate sequence entries, part 39.
5142. gbpri4.seq - Primate sequence entries, part 4.
5143. gbpri40.seq - Primate sequence entries, part 40.
5144. gbpri41.seq - Primate sequence entries, part 41.
5145. gbpri42.seq - Primate sequence entries, part 42.
5146. gbpri43.seq - Primate sequence entries, part 43.
5147. gbpri44.seq - Primate sequence entries, part 44.
5148. gbpri45.seq - Primate sequence entries, part 45.
5149. gbpri46.seq - Primate sequence entries, part 46.
5150. gbpri47.seq - Primate sequence entries, part 47.
5151. gbpri48.seq - Primate sequence entries, part 48.
5152. gbpri49.seq - Primate sequence entries, part 49.
5153. gbpri5.seq - Primate sequence entries, part 5.
5154. gbpri50.seq - Primate sequence entries, part 50.
5155. gbpri51.seq - Primate sequence entries, part 51.
5156. gbpri52.seq - Primate sequence entries, part 52.
5157. gbpri53.seq - Primate sequence entries, part 53.
5158. gbpri54.seq - Primate sequence entries, part 54.
5159. gbpri55.seq - Primate sequence entries, part 55.
5160. gbpri56.seq - Primate sequence entries, part 56.
5161. gbpri57.seq - Primate sequence entries, part 57.
5162. gbpri6.seq - Primate sequence entries, part 6.
5163. gbpri7.seq - Primate sequence entries, part 7.
5164. gbpri8.seq - Primate sequence entries, part 8.
5165. gbpri9.seq - Primate sequence entries, part 9.
5166. gbrel.txt - Release notes (this document).
5167. gbrod1.seq - Rodent sequence entries, part 1.
5168. gbrod10.seq - Rodent sequence entries, part 10.
5169. gbrod100.seq - Rodent sequence entries, part 100.
5170. gbrod101.seq - Rodent sequence entries, part 101.
5171. gbrod102.seq - Rodent sequence entries, part 102.
5172. gbrod103.seq - Rodent sequence entries, part 103.
5173. gbrod104.seq - Rodent sequence entries, part 104.
5174. gbrod105.seq - Rodent sequence entries, part 105.
5175. gbrod106.seq - Rodent sequence entries, part 106.
5176. gbrod107.seq - Rodent sequence entries, part 107.
5177. gbrod108.seq - Rodent sequence entries, part 108.
5178. gbrod109.seq - Rodent sequence entries, part 109.
5179. gbrod11.seq - Rodent sequence entries, part 11.
5180. gbrod110.seq - Rodent sequence entries, part 110.
5181. gbrod111.seq - Rodent sequence entries, part 111.
5182. gbrod112.seq - Rodent sequence entries, part 112.
5183. gbrod113.seq - Rodent sequence entries, part 113.
5184. gbrod114.seq - Rodent sequence entries, part 114.
5185. gbrod115.seq - Rodent sequence entries, part 115.
5186. gbrod116.seq - Rodent sequence entries, part 116.
5187. gbrod117.seq - Rodent sequence entries, part 117.
5188. gbrod118.seq - Rodent sequence entries, part 118.
5189. gbrod119.seq - Rodent sequence entries, part 119.
5190. gbrod12.seq - Rodent sequence entries, part 12.
5191. gbrod120.seq - Rodent sequence entries, part 120.
5192. gbrod121.seq - Rodent sequence entries, part 121.
5193. gbrod122.seq - Rodent sequence entries, part 122.
5194. gbrod123.seq - Rodent sequence entries, part 123.
5195. gbrod124.seq - Rodent sequence entries, part 124.
5196. gbrod125.seq - Rodent sequence entries, part 125.
5197. gbrod126.seq - Rodent sequence entries, part 126.
5198. gbrod127.seq - Rodent sequence entries, part 127.
5199. gbrod128.seq - Rodent sequence entries, part 128.
5200. gbrod129.seq - Rodent sequence entries, part 129.
5201. gbrod13.seq - Rodent sequence entries, part 13.
5202. gbrod130.seq - Rodent sequence entries, part 130.
5203. gbrod131.seq - Rodent sequence entries, part 131.
5204. gbrod132.seq - Rodent sequence entries, part 132.
5205. gbrod133.seq - Rodent sequence entries, part 133.
5206. gbrod134.seq - Rodent sequence entries, part 134.
5207. gbrod135.seq - Rodent sequence entries, part 135.
5208. gbrod136.seq - Rodent sequence entries, part 136.
5209. gbrod137.seq - Rodent sequence entries, part 137.
5210. gbrod138.seq - Rodent sequence entries, part 138.
5211. gbrod139.seq - Rodent sequence entries, part 139.
5212. gbrod14.seq - Rodent sequence entries, part 14.
5213. gbrod140.seq - Rodent sequence entries, part 140.
5214. gbrod141.seq - Rodent sequence entries, part 141.
5215. gbrod142.seq - Rodent sequence entries, part 142.
5216. gbrod143.seq - Rodent sequence entries, part 143.
5217. gbrod144.seq - Rodent sequence entries, part 144.
5218. gbrod145.seq - Rodent sequence entries, part 145.
5219. gbrod146.seq - Rodent sequence entries, part 146.
5220. gbrod147.seq - Rodent sequence entries, part 147.
5221. gbrod148.seq - Rodent sequence entries, part 148.
5222. gbrod149.seq - Rodent sequence entries, part 149.
5223. gbrod15.seq - Rodent sequence entries, part 15.
5224. gbrod150.seq - Rodent sequence entries, part 150.
5225. gbrod151.seq - Rodent sequence entries, part 151.
5226. gbrod152.seq - Rodent sequence entries, part 152.
5227. gbrod153.seq - Rodent sequence entries, part 153.
5228. gbrod154.seq - Rodent sequence entries, part 154.
5229. gbrod155.seq - Rodent sequence entries, part 155.
5230. gbrod156.seq - Rodent sequence entries, part 156.
5231. gbrod157.seq - Rodent sequence entries, part 157.
5232. gbrod158.seq - Rodent sequence entries, part 158.
5233. gbrod159.seq - Rodent sequence entries, part 159.
5234. gbrod16.seq - Rodent sequence entries, part 16.
5235. gbrod160.seq - Rodent sequence entries, part 160.
5236. gbrod161.seq - Rodent sequence entries, part 161.
5237. gbrod162.seq - Rodent sequence entries, part 162.
5238. gbrod163.seq - Rodent sequence entries, part 163.
5239. gbrod164.seq - Rodent sequence entries, part 164.
5240. gbrod165.seq - Rodent sequence entries, part 165.
5241. gbrod166.seq - Rodent sequence entries, part 166.
5242. gbrod167.seq - Rodent sequence entries, part 167.
5243. gbrod168.seq - Rodent sequence entries, part 168.
5244. gbrod169.seq - Rodent sequence entries, part 169.
5245. gbrod17.seq - Rodent sequence entries, part 17.
5246. gbrod170.seq - Rodent sequence entries, part 170.
5247. gbrod171.seq - Rodent sequence entries, part 171.
5248. gbrod172.seq - Rodent sequence entries, part 172.
5249. gbrod173.seq - Rodent sequence entries, part 173.
5250. gbrod174.seq - Rodent sequence entries, part 174.
5251. gbrod175.seq - Rodent sequence entries, part 175.
5252. gbrod176.seq - Rodent sequence entries, part 176.
5253. gbrod177.seq - Rodent sequence entries, part 177.
5254. gbrod178.seq - Rodent sequence entries, part 178.
5255. gbrod179.seq - Rodent sequence entries, part 179.
5256. gbrod18.seq - Rodent sequence entries, part 18.
5257. gbrod180.seq - Rodent sequence entries, part 180.
5258. gbrod181.seq - Rodent sequence entries, part 181.
5259. gbrod182.seq - Rodent sequence entries, part 182.
5260. gbrod183.seq - Rodent sequence entries, part 183.
5261. gbrod184.seq - Rodent sequence entries, part 184.
5262. gbrod185.seq - Rodent sequence entries, part 185.
5263. gbrod186.seq - Rodent sequence entries, part 186.
5264. gbrod187.seq - Rodent sequence entries, part 187.
5265. gbrod188.seq - Rodent sequence entries, part 188.
5266. gbrod189.seq - Rodent sequence entries, part 189.
5267. gbrod19.seq - Rodent sequence entries, part 19.
5268. gbrod190.seq - Rodent sequence entries, part 190.
5269. gbrod191.seq - Rodent sequence entries, part 191.
5270. gbrod192.seq - Rodent sequence entries, part 192.
5271. gbrod193.seq - Rodent sequence entries, part 193.
5272. gbrod194.seq - Rodent sequence entries, part 194.
5273. gbrod195.seq - Rodent sequence entries, part 195.
5274. gbrod196.seq - Rodent sequence entries, part 196.
5275. gbrod197.seq - Rodent sequence entries, part 197.
5276. gbrod198.seq - Rodent sequence entries, part 198.
5277. gbrod199.seq - Rodent sequence entries, part 199.
5278. gbrod2.seq - Rodent sequence entries, part 2.
5279. gbrod20.seq - Rodent sequence entries, part 20.
5280. gbrod200.seq - Rodent sequence entries, part 200.
5281. gbrod201.seq - Rodent sequence entries, part 201.
5282. gbrod202.seq - Rodent sequence entries, part 202.
5283. gbrod203.seq - Rodent sequence entries, part 203.
5284. gbrod204.seq - Rodent sequence entries, part 204.
5285. gbrod205.seq - Rodent sequence entries, part 205.
5286. gbrod206.seq - Rodent sequence entries, part 206.
5287. gbrod207.seq - Rodent sequence entries, part 207.
5288. gbrod208.seq - Rodent sequence entries, part 208.
5289. gbrod209.seq - Rodent sequence entries, part 209.
5290. gbrod21.seq - Rodent sequence entries, part 21.
5291. gbrod210.seq - Rodent sequence entries, part 210.
5292. gbrod211.seq - Rodent sequence entries, part 211.
5293. gbrod212.seq - Rodent sequence entries, part 212.
5294. gbrod213.seq - Rodent sequence entries, part 213.
5295. gbrod214.seq - Rodent sequence entries, part 214.
5296. gbrod215.seq - Rodent sequence entries, part 215.
5297. gbrod216.seq - Rodent sequence entries, part 216.
5298. gbrod217.seq - Rodent sequence entries, part 217.
5299. gbrod218.seq - Rodent sequence entries, part 218.
5300. gbrod219.seq - Rodent sequence entries, part 219.
5301. gbrod22.seq - Rodent sequence entries, part 22.
5302. gbrod220.seq - Rodent sequence entries, part 220.
5303. gbrod221.seq - Rodent sequence entries, part 221.
5304. gbrod222.seq - Rodent sequence entries, part 222.
5305. gbrod223.seq - Rodent sequence entries, part 223.
5306. gbrod224.seq - Rodent sequence entries, part 224.
5307. gbrod225.seq - Rodent sequence entries, part 225.
5308. gbrod226.seq - Rodent sequence entries, part 226.
5309. gbrod227.seq - Rodent sequence entries, part 227.
5310. gbrod228.seq - Rodent sequence entries, part 228.
5311. gbrod229.seq - Rodent sequence entries, part 229.
5312. gbrod23.seq - Rodent sequence entries, part 23.
5313. gbrod230.seq - Rodent sequence entries, part 230.
5314. gbrod231.seq - Rodent sequence entries, part 231.
5315. gbrod232.seq - Rodent sequence entries, part 232.
5316. gbrod233.seq - Rodent sequence entries, part 233.
5317. gbrod234.seq - Rodent sequence entries, part 234.
5318. gbrod235.seq - Rodent sequence entries, part 235.
5319. gbrod236.seq - Rodent sequence entries, part 236.
5320. gbrod237.seq - Rodent sequence entries, part 237.
5321. gbrod238.seq - Rodent sequence entries, part 238.
5322. gbrod239.seq - Rodent sequence entries, part 239.
5323. gbrod24.seq - Rodent sequence entries, part 24.
5324. gbrod240.seq - Rodent sequence entries, part 240.
5325. gbrod241.seq - Rodent sequence entries, part 241.
5326. gbrod242.seq - Rodent sequence entries, part 242.
5327. gbrod243.seq - Rodent sequence entries, part 243.
5328. gbrod244.seq - Rodent sequence entries, part 244.
5329. gbrod245.seq - Rodent sequence entries, part 245.
5330. gbrod246.seq - Rodent sequence entries, part 246.
5331. gbrod247.seq - Rodent sequence entries, part 247.
5332. gbrod248.seq - Rodent sequence entries, part 248.
5333. gbrod249.seq - Rodent sequence entries, part 249.
5334. gbrod25.seq - Rodent sequence entries, part 25.
5335. gbrod250.seq - Rodent sequence entries, part 250.
5336. gbrod251.seq - Rodent sequence entries, part 251.
5337. gbrod252.seq - Rodent sequence entries, part 252.
5338. gbrod253.seq - Rodent sequence entries, part 253.
5339. gbrod254.seq - Rodent sequence entries, part 254.
5340. gbrod255.seq - Rodent sequence entries, part 255.
5341. gbrod256.seq - Rodent sequence entries, part 256.
5342. gbrod257.seq - Rodent sequence entries, part 257.
5343. gbrod258.seq - Rodent sequence entries, part 258.
5344. gbrod259.seq - Rodent sequence entries, part 259.
5345. gbrod26.seq - Rodent sequence entries, part 26.
5346. gbrod260.seq - Rodent sequence entries, part 260.
5347. gbrod261.seq - Rodent sequence entries, part 261.
5348. gbrod262.seq - Rodent sequence entries, part 262.
5349. gbrod263.seq - Rodent sequence entries, part 263.
5350. gbrod264.seq - Rodent sequence entries, part 264.
5351. gbrod265.seq - Rodent sequence entries, part 265.
5352. gbrod266.seq - Rodent sequence entries, part 266.
5353. gbrod267.seq - Rodent sequence entries, part 267.
5354. gbrod268.seq - Rodent sequence entries, part 268.
5355. gbrod269.seq - Rodent sequence entries, part 269.
5356. gbrod27.seq - Rodent sequence entries, part 27.
5357. gbrod270.seq - Rodent sequence entries, part 270.
5358. gbrod271.seq - Rodent sequence entries, part 271.
5359. gbrod272.seq - Rodent sequence entries, part 272.
5360. gbrod273.seq - Rodent sequence entries, part 273.
5361. gbrod274.seq - Rodent sequence entries, part 274.
5362. gbrod275.seq - Rodent sequence entries, part 275.
5363. gbrod276.seq - Rodent sequence entries, part 276.
5364. gbrod277.seq - Rodent sequence entries, part 277.
5365. gbrod278.seq - Rodent sequence entries, part 278.
5366. gbrod279.seq - Rodent sequence entries, part 279.
5367. gbrod28.seq - Rodent sequence entries, part 28.
5368. gbrod280.seq - Rodent sequence entries, part 280.
5369. gbrod281.seq - Rodent sequence entries, part 281.
5370. gbrod282.seq - Rodent sequence entries, part 282.
5371. gbrod283.seq - Rodent sequence entries, part 283.
5372. gbrod284.seq - Rodent sequence entries, part 284.
5373. gbrod285.seq - Rodent sequence entries, part 285.
5374. gbrod286.seq - Rodent sequence entries, part 286.
5375. gbrod287.seq - Rodent sequence entries, part 287.
5376. gbrod288.seq - Rodent sequence entries, part 288.
5377. gbrod289.seq - Rodent sequence entries, part 289.
5378. gbrod29.seq - Rodent sequence entries, part 29.
5379. gbrod290.seq - Rodent sequence entries, part 290.
5380. gbrod291.seq - Rodent sequence entries, part 291.
5381. gbrod292.seq - Rodent sequence entries, part 292.
5382. gbrod293.seq - Rodent sequence entries, part 293.
5383. gbrod294.seq - Rodent sequence entries, part 294.
5384. gbrod295.seq - Rodent sequence entries, part 295.
5385. gbrod296.seq - Rodent sequence entries, part 296.
5386. gbrod297.seq - Rodent sequence entries, part 297.
5387. gbrod298.seq - Rodent sequence entries, part 298.
5388. gbrod299.seq - Rodent sequence entries, part 299.
5389. gbrod3.seq - Rodent sequence entries, part 3.
5390. gbrod30.seq - Rodent sequence entries, part 30.
5391. gbrod300.seq - Rodent sequence entries, part 300.
5392. gbrod31.seq - Rodent sequence entries, part 31.
5393. gbrod32.seq - Rodent sequence entries, part 32.
5394. gbrod33.seq - Rodent sequence entries, part 33.
5395. gbrod34.seq - Rodent sequence entries, part 34.
5396. gbrod35.seq - Rodent sequence entries, part 35.
5397. gbrod36.seq - Rodent sequence entries, part 36.
5398. gbrod37.seq - Rodent sequence entries, part 37.
5399. gbrod38.seq - Rodent sequence entries, part 38.
5400. gbrod39.seq - Rodent sequence entries, part 39.
5401. gbrod4.seq - Rodent sequence entries, part 4.
5402. gbrod40.seq - Rodent sequence entries, part 40.
5403. gbrod41.seq - Rodent sequence entries, part 41.
5404. gbrod42.seq - Rodent sequence entries, part 42.
5405. gbrod43.seq - Rodent sequence entries, part 43.
5406. gbrod44.seq - Rodent sequence entries, part 44.
5407. gbrod45.seq - Rodent sequence entries, part 45.
5408. gbrod46.seq - Rodent sequence entries, part 46.
5409. gbrod47.seq - Rodent sequence entries, part 47.
5410. gbrod48.seq - Rodent sequence entries, part 48.
5411. gbrod49.seq - Rodent sequence entries, part 49.
5412. gbrod5.seq - Rodent sequence entries, part 5.
5413. gbrod50.seq - Rodent sequence entries, part 50.
5414. gbrod51.seq - Rodent sequence entries, part 51.
5415. gbrod52.seq - Rodent sequence entries, part 52.
5416. gbrod53.seq - Rodent sequence entries, part 53.
5417. gbrod54.seq - Rodent sequence entries, part 54.
5418. gbrod55.seq - Rodent sequence entries, part 55.
5419. gbrod56.seq - Rodent sequence entries, part 56.
5420. gbrod57.seq - Rodent sequence entries, part 57.
5421. gbrod58.seq - Rodent sequence entries, part 58.
5422. gbrod59.seq - Rodent sequence entries, part 59.
5423. gbrod6.seq - Rodent sequence entries, part 6.
5424. gbrod60.seq - Rodent sequence entries, part 60.
5425. gbrod61.seq - Rodent sequence entries, part 61.
5426. gbrod62.seq - Rodent sequence entries, part 62.
5427. gbrod63.seq - Rodent sequence entries, part 63.
5428. gbrod64.seq - Rodent sequence entries, part 64.
5429. gbrod65.seq - Rodent sequence entries, part 65.
5430. gbrod66.seq - Rodent sequence entries, part 66.
5431. gbrod67.seq - Rodent sequence entries, part 67.
5432. gbrod68.seq - Rodent sequence entries, part 68.
5433. gbrod69.seq - Rodent sequence entries, part 69.
5434. gbrod7.seq - Rodent sequence entries, part 7.
5435. gbrod70.seq - Rodent sequence entries, part 70.
5436. gbrod71.seq - Rodent sequence entries, part 71.
5437. gbrod72.seq - Rodent sequence entries, part 72.
5438. gbrod73.seq - Rodent sequence entries, part 73.
5439. gbrod74.seq - Rodent sequence entries, part 74.
5440. gbrod75.seq - Rodent sequence entries, part 75.
5441. gbrod76.seq - Rodent sequence entries, part 76.
5442. gbrod77.seq - Rodent sequence entries, part 77.
5443. gbrod78.seq - Rodent sequence entries, part 78.
5444. gbrod79.seq - Rodent sequence entries, part 79.
5445. gbrod8.seq - Rodent sequence entries, part 8.
5446. gbrod80.seq - Rodent sequence entries, part 80.
5447. gbrod81.seq - Rodent sequence entries, part 81.
5448. gbrod82.seq - Rodent sequence entries, part 82.
5449. gbrod83.seq - Rodent sequence entries, part 83.
5450. gbrod84.seq - Rodent sequence entries, part 84.
5451. gbrod85.seq - Rodent sequence entries, part 85.
5452. gbrod86.seq - Rodent sequence entries, part 86.
5453. gbrod87.seq - Rodent sequence entries, part 87.
5454. gbrod88.seq - Rodent sequence entries, part 88.
5455. gbrod89.seq - Rodent sequence entries, part 89.
5456. gbrod9.seq - Rodent sequence entries, part 9.
5457. gbrod90.seq - Rodent sequence entries, part 90.
5458. gbrod91.seq - Rodent sequence entries, part 91.
5459. gbrod92.seq - Rodent sequence entries, part 92.
5460. gbrod93.seq - Rodent sequence entries, part 93.
5461. gbrod94.seq - Rodent sequence entries, part 94.
5462. gbrod95.seq - Rodent sequence entries, part 95.
5463. gbrod96.seq - Rodent sequence entries, part 96.
5464. gbrod97.seq - Rodent sequence entries, part 97.
5465. gbrod98.seq - Rodent sequence entries, part 98.
5466. gbrod99.seq - Rodent sequence entries, part 99.
5467. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
5468. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
5469. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
5470. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
5471. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
5472. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
5473. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
5474. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
5475. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
5476. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
5477. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
5478. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
5479. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
5480. gbsyn11.seq - Synthetic and chimeric sequence entries, part 11.
5481. gbsyn12.seq - Synthetic and chimeric sequence entries, part 12.
5482. gbsyn13.seq - Synthetic and chimeric sequence entries, part 13.
5483. gbsyn14.seq - Synthetic and chimeric sequence entries, part 14.
5484. gbsyn15.seq - Synthetic and chimeric sequence entries, part 15.
5485. gbsyn16.seq - Synthetic and chimeric sequence entries, part 16.
5486. gbsyn17.seq - Synthetic and chimeric sequence entries, part 17.
5487. gbsyn18.seq - Synthetic and chimeric sequence entries, part 18.
5488. gbsyn19.seq - Synthetic and chimeric sequence entries, part 19.
5489. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
5490. gbsyn20.seq - Synthetic and chimeric sequence entries, part 20.
5491. gbsyn21.seq - Synthetic and chimeric sequence entries, part 21.
5492. gbsyn22.seq - Synthetic and chimeric sequence entries, part 22.
5493. gbsyn23.seq - Synthetic and chimeric sequence entries, part 23.
5494. gbsyn24.seq - Synthetic and chimeric sequence entries, part 24.
5495. gbsyn25.seq - Synthetic and chimeric sequence entries, part 25.
5496. gbsyn26.seq - Synthetic and chimeric sequence entries, part 26.
5497. gbsyn27.seq - Synthetic and chimeric sequence entries, part 27.
5498. gbsyn28.seq - Synthetic and chimeric sequence entries, part 28.
5499. gbsyn29.seq - Synthetic and chimeric sequence entries, part 29.
5500. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
5501. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
5502. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
5503. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
5504. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
5505. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
5506. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
5507. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
5508. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
5509. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
5510. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
5511. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
5512. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
5513. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
5514. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
5515. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
5516. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
5517. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
5518. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
5519. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
5520. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
5521. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
5522. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
5523. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
5524. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
5525. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
5526. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
5527. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
5528. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
5529. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
5530. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
5531. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
5532. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
5533. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
5534. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
5535. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
5536. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
5537. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
5538. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
5539. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
5540. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
5541. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
5542. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
5543. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
5544. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
5545. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
5546. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
5547. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
5548. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
5549. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
5550. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
5551. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
5552. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
5553. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
5554. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
5555. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
5556. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
5557. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
5558. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
5559. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
5560. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
5561. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
5562. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
5563. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
5564. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
5565. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
5566. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
5567. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
5568. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
5569. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
5570. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
5571. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
5572. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
5573. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
5574. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
5575. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
5576. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
5577. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
5578. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
5579. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
5580. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
5581. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
5582. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
5583. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
5584. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
5585. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
5586. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
5587. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
5588. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
5589. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
5590. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
5591. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
5592. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
5593. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
5594. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
5595. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
5596. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
5597. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
5598. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
5599. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
5600. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
5601. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
5602. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
5603. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
5604. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
5605. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
5606. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
5607. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
5608. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
5609. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
5610. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
5611. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
5612. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
5613. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
5614. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
5615. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
5616. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
5617. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
5618. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
5619. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
5620. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
5621. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
5622. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
5623. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
5624. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
5625. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
5626. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
5627. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
5628. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
5629. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
5630. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
5631. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
5632. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
5633. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
5634. gbuna1.seq - Unannotated sequence entries, part 1.
5635. gbvrl1.seq - Viral sequence entries, part 1.
5636. gbvrl10.seq - Viral sequence entries, part 10.
5637. gbvrl100.seq - Viral sequence entries, part 100.
5638. gbvrl101.seq - Viral sequence entries, part 101.
5639. gbvrl102.seq - Viral sequence entries, part 102.
5640. gbvrl103.seq - Viral sequence entries, part 103.
5641. gbvrl104.seq - Viral sequence entries, part 104.
5642. gbvrl105.seq - Viral sequence entries, part 105.
5643. gbvrl106.seq - Viral sequence entries, part 106.
5644. gbvrl107.seq - Viral sequence entries, part 107.
5645. gbvrl108.seq - Viral sequence entries, part 108.
5646. gbvrl109.seq - Viral sequence entries, part 109.
5647. gbvrl11.seq - Viral sequence entries, part 11.
5648. gbvrl110.seq - Viral sequence entries, part 110.
5649. gbvrl111.seq - Viral sequence entries, part 111.
5650. gbvrl112.seq - Viral sequence entries, part 112.
5651. gbvrl113.seq - Viral sequence entries, part 113.
5652. gbvrl114.seq - Viral sequence entries, part 114.
5653. gbvrl115.seq - Viral sequence entries, part 115.
5654. gbvrl116.seq - Viral sequence entries, part 116.
5655. gbvrl117.seq - Viral sequence entries, part 117.
5656. gbvrl118.seq - Viral sequence entries, part 118.
5657. gbvrl119.seq - Viral sequence entries, part 119.
5658. gbvrl12.seq - Viral sequence entries, part 12.
5659. gbvrl120.seq - Viral sequence entries, part 120.
5660. gbvrl121.seq - Viral sequence entries, part 121.
5661. gbvrl122.seq - Viral sequence entries, part 122.
5662. gbvrl123.seq - Viral sequence entries, part 123.
5663. gbvrl124.seq - Viral sequence entries, part 124.
5664. gbvrl125.seq - Viral sequence entries, part 125.
5665. gbvrl126.seq - Viral sequence entries, part 126.
5666. gbvrl127.seq - Viral sequence entries, part 127.
5667. gbvrl128.seq - Viral sequence entries, part 128.
5668. gbvrl129.seq - Viral sequence entries, part 129.
5669. gbvrl13.seq - Viral sequence entries, part 13.
5670. gbvrl130.seq - Viral sequence entries, part 130.
5671. gbvrl131.seq - Viral sequence entries, part 131.
5672. gbvrl132.seq - Viral sequence entries, part 132.
5673. gbvrl133.seq - Viral sequence entries, part 133.
5674. gbvrl134.seq - Viral sequence entries, part 134.
5675. gbvrl135.seq - Viral sequence entries, part 135.
5676. gbvrl136.seq - Viral sequence entries, part 136.
5677. gbvrl137.seq - Viral sequence entries, part 137.
5678. gbvrl138.seq - Viral sequence entries, part 138.
5679. gbvrl139.seq - Viral sequence entries, part 139.
5680. gbvrl14.seq - Viral sequence entries, part 14.
5681. gbvrl140.seq - Viral sequence entries, part 140.
5682. gbvrl141.seq - Viral sequence entries, part 141.
5683. gbvrl142.seq - Viral sequence entries, part 142.
5684. gbvrl143.seq - Viral sequence entries, part 143.
5685. gbvrl144.seq - Viral sequence entries, part 144.
5686. gbvrl145.seq - Viral sequence entries, part 145.
5687. gbvrl146.seq - Viral sequence entries, part 146.
5688. gbvrl147.seq - Viral sequence entries, part 147.
5689. gbvrl148.seq - Viral sequence entries, part 148.
5690. gbvrl149.seq - Viral sequence entries, part 149.
5691. gbvrl15.seq - Viral sequence entries, part 15.
5692. gbvrl150.seq - Viral sequence entries, part 150.
5693. gbvrl151.seq - Viral sequence entries, part 151.
5694. gbvrl152.seq - Viral sequence entries, part 152.
5695. gbvrl153.seq - Viral sequence entries, part 153.
5696. gbvrl154.seq - Viral sequence entries, part 154.
5697. gbvrl155.seq - Viral sequence entries, part 155.
5698. gbvrl156.seq - Viral sequence entries, part 156.
5699. gbvrl157.seq - Viral sequence entries, part 157.
5700. gbvrl158.seq - Viral sequence entries, part 158.
5701. gbvrl159.seq - Viral sequence entries, part 159.
5702. gbvrl16.seq - Viral sequence entries, part 16.
5703. gbvrl160.seq - Viral sequence entries, part 160.
5704. gbvrl161.seq - Viral sequence entries, part 161.
5705. gbvrl162.seq - Viral sequence entries, part 162.
5706. gbvrl163.seq - Viral sequence entries, part 163.
5707. gbvrl164.seq - Viral sequence entries, part 164.
5708. gbvrl165.seq - Viral sequence entries, part 165.
5709. gbvrl166.seq - Viral sequence entries, part 166.
5710. gbvrl167.seq - Viral sequence entries, part 167.
5711. gbvrl168.seq - Viral sequence entries, part 168.
5712. gbvrl169.seq - Viral sequence entries, part 169.
5713. gbvrl17.seq - Viral sequence entries, part 17.
5714. gbvrl170.seq - Viral sequence entries, part 170.
5715. gbvrl171.seq - Viral sequence entries, part 171.
5716. gbvrl172.seq - Viral sequence entries, part 172.
5717. gbvrl173.seq - Viral sequence entries, part 173.
5718. gbvrl174.seq - Viral sequence entries, part 174.
5719. gbvrl175.seq - Viral sequence entries, part 175.
5720. gbvrl176.seq - Viral sequence entries, part 176.
5721. gbvrl177.seq - Viral sequence entries, part 177.
5722. gbvrl178.seq - Viral sequence entries, part 178.
5723. gbvrl179.seq - Viral sequence entries, part 179.
5724. gbvrl18.seq - Viral sequence entries, part 18.
5725. gbvrl180.seq - Viral sequence entries, part 180.
5726. gbvrl181.seq - Viral sequence entries, part 181.
5727. gbvrl182.seq - Viral sequence entries, part 182.
5728. gbvrl183.seq - Viral sequence entries, part 183.
5729. gbvrl184.seq - Viral sequence entries, part 184.
5730. gbvrl185.seq - Viral sequence entries, part 185.
5731. gbvrl186.seq - Viral sequence entries, part 186.
5732. gbvrl187.seq - Viral sequence entries, part 187.
5733. gbvrl188.seq - Viral sequence entries, part 188.
5734. gbvrl189.seq - Viral sequence entries, part 189.
5735. gbvrl19.seq - Viral sequence entries, part 19.
5736. gbvrl190.seq - Viral sequence entries, part 190.
5737. gbvrl191.seq - Viral sequence entries, part 191.
5738. gbvrl192.seq - Viral sequence entries, part 192.
5739. gbvrl193.seq - Viral sequence entries, part 193.
5740. gbvrl194.seq - Viral sequence entries, part 194.
5741. gbvrl195.seq - Viral sequence entries, part 195.
5742. gbvrl196.seq - Viral sequence entries, part 196.
5743. gbvrl197.seq - Viral sequence entries, part 197.
5744. gbvrl198.seq - Viral sequence entries, part 198.
5745. gbvrl199.seq - Viral sequence entries, part 199.
5746. gbvrl2.seq - Viral sequence entries, part 2.
5747. gbvrl20.seq - Viral sequence entries, part 20.
5748. gbvrl200.seq - Viral sequence entries, part 200.
5749. gbvrl201.seq - Viral sequence entries, part 201.
5750. gbvrl202.seq - Viral sequence entries, part 202.
5751. gbvrl203.seq - Viral sequence entries, part 203.
5752. gbvrl204.seq - Viral sequence entries, part 204.
5753. gbvrl205.seq - Viral sequence entries, part 205.
5754. gbvrl206.seq - Viral sequence entries, part 206.
5755. gbvrl207.seq - Viral sequence entries, part 207.
5756. gbvrl208.seq - Viral sequence entries, part 208.
5757. gbvrl209.seq - Viral sequence entries, part 209.
5758. gbvrl21.seq - Viral sequence entries, part 21.
5759. gbvrl210.seq - Viral sequence entries, part 210.
5760. gbvrl211.seq - Viral sequence entries, part 211.
5761. gbvrl212.seq - Viral sequence entries, part 212.
5762. gbvrl213.seq - Viral sequence entries, part 213.
5763. gbvrl214.seq - Viral sequence entries, part 214.
5764. gbvrl215.seq - Viral sequence entries, part 215.
5765. gbvrl216.seq - Viral sequence entries, part 216.
5766. gbvrl217.seq - Viral sequence entries, part 217.
5767. gbvrl218.seq - Viral sequence entries, part 218.
5768. gbvrl219.seq - Viral sequence entries, part 219.
5769. gbvrl22.seq - Viral sequence entries, part 22.
5770. gbvrl220.seq - Viral sequence entries, part 220.
5771. gbvrl221.seq - Viral sequence entries, part 221.
5772. gbvrl222.seq - Viral sequence entries, part 222.
5773. gbvrl223.seq - Viral sequence entries, part 223.
5774. gbvrl224.seq - Viral sequence entries, part 224.
5775. gbvrl225.seq - Viral sequence entries, part 225.
5776. gbvrl226.seq - Viral sequence entries, part 226.
5777. gbvrl227.seq - Viral sequence entries, part 227.
5778. gbvrl228.seq - Viral sequence entries, part 228.
5779. gbvrl229.seq - Viral sequence entries, part 229.
5780. gbvrl23.seq - Viral sequence entries, part 23.
5781. gbvrl230.seq - Viral sequence entries, part 230.
5782. gbvrl231.seq - Viral sequence entries, part 231.
5783. gbvrl232.seq - Viral sequence entries, part 232.
5784. gbvrl233.seq - Viral sequence entries, part 233.
5785. gbvrl234.seq - Viral sequence entries, part 234.
5786. gbvrl235.seq - Viral sequence entries, part 235.
5787. gbvrl236.seq - Viral sequence entries, part 236.
5788. gbvrl237.seq - Viral sequence entries, part 237.
5789. gbvrl238.seq - Viral sequence entries, part 238.
5790. gbvrl239.seq - Viral sequence entries, part 239.
5791. gbvrl24.seq - Viral sequence entries, part 24.
5792. gbvrl240.seq - Viral sequence entries, part 240.
5793. gbvrl241.seq - Viral sequence entries, part 241.
5794. gbvrl242.seq - Viral sequence entries, part 242.
5795. gbvrl243.seq - Viral sequence entries, part 243.
5796. gbvrl244.seq - Viral sequence entries, part 244.
5797. gbvrl245.seq - Viral sequence entries, part 245.
5798. gbvrl246.seq - Viral sequence entries, part 246.
5799. gbvrl247.seq - Viral sequence entries, part 247.
5800. gbvrl248.seq - Viral sequence entries, part 248.
5801. gbvrl249.seq - Viral sequence entries, part 249.
5802. gbvrl25.seq - Viral sequence entries, part 25.
5803. gbvrl250.seq - Viral sequence entries, part 250.
5804. gbvrl251.seq - Viral sequence entries, part 251.
5805. gbvrl252.seq - Viral sequence entries, part 252.
5806. gbvrl253.seq - Viral sequence entries, part 253.
5807. gbvrl254.seq - Viral sequence entries, part 254.
5808. gbvrl255.seq - Viral sequence entries, part 255.
5809. gbvrl256.seq - Viral sequence entries, part 256.
5810. gbvrl257.seq - Viral sequence entries, part 257.
5811. gbvrl258.seq - Viral sequence entries, part 258.
5812. gbvrl259.seq - Viral sequence entries, part 259.
5813. gbvrl26.seq - Viral sequence entries, part 26.
5814. gbvrl260.seq - Viral sequence entries, part 260.
5815. gbvrl261.seq - Viral sequence entries, part 261.
5816. gbvrl262.seq - Viral sequence entries, part 262.
5817. gbvrl263.seq - Viral sequence entries, part 263.
5818. gbvrl264.seq - Viral sequence entries, part 264.
5819. gbvrl265.seq - Viral sequence entries, part 265.
5820. gbvrl266.seq - Viral sequence entries, part 266.
5821. gbvrl267.seq - Viral sequence entries, part 267.
5822. gbvrl268.seq - Viral sequence entries, part 268.
5823. gbvrl269.seq - Viral sequence entries, part 269.
5824. gbvrl27.seq - Viral sequence entries, part 27.
5825. gbvrl270.seq - Viral sequence entries, part 270.
5826. gbvrl271.seq - Viral sequence entries, part 271.
5827. gbvrl272.seq - Viral sequence entries, part 272.
5828. gbvrl273.seq - Viral sequence entries, part 273.
5829. gbvrl274.seq - Viral sequence entries, part 274.
5830. gbvrl275.seq - Viral sequence entries, part 275.
5831. gbvrl276.seq - Viral sequence entries, part 276.
5832. gbvrl277.seq - Viral sequence entries, part 277.
5833. gbvrl278.seq - Viral sequence entries, part 278.
5834. gbvrl279.seq - Viral sequence entries, part 279.
5835. gbvrl28.seq - Viral sequence entries, part 28.
5836. gbvrl280.seq - Viral sequence entries, part 280.
5837. gbvrl281.seq - Viral sequence entries, part 281.
5838. gbvrl282.seq - Viral sequence entries, part 282.
5839. gbvrl283.seq - Viral sequence entries, part 283.
5840. gbvrl284.seq - Viral sequence entries, part 284.
5841. gbvrl285.seq - Viral sequence entries, part 285.
5842. gbvrl286.seq - Viral sequence entries, part 286.
5843. gbvrl287.seq - Viral sequence entries, part 287.
5844. gbvrl288.seq - Viral sequence entries, part 288.
5845. gbvrl289.seq - Viral sequence entries, part 289.
5846. gbvrl29.seq - Viral sequence entries, part 29.
5847. gbvrl290.seq - Viral sequence entries, part 290.
5848. gbvrl291.seq - Viral sequence entries, part 291.
5849. gbvrl292.seq - Viral sequence entries, part 292.
5850. gbvrl293.seq - Viral sequence entries, part 293.
5851. gbvrl294.seq - Viral sequence entries, part 294.
5852. gbvrl295.seq - Viral sequence entries, part 295.
5853. gbvrl296.seq - Viral sequence entries, part 296.
5854. gbvrl297.seq - Viral sequence entries, part 297.
5855. gbvrl298.seq - Viral sequence entries, part 298.
5856. gbvrl299.seq - Viral sequence entries, part 299.
5857. gbvrl3.seq - Viral sequence entries, part 3.
5858. gbvrl30.seq - Viral sequence entries, part 30.
5859. gbvrl300.seq - Viral sequence entries, part 300.
5860. gbvrl301.seq - Viral sequence entries, part 301.
5861. gbvrl302.seq - Viral sequence entries, part 302.
5862. gbvrl303.seq - Viral sequence entries, part 303.
5863. gbvrl304.seq - Viral sequence entries, part 304.
5864. gbvrl305.seq - Viral sequence entries, part 305.
5865. gbvrl306.seq - Viral sequence entries, part 306.
5866. gbvrl307.seq - Viral sequence entries, part 307.
5867. gbvrl308.seq - Viral sequence entries, part 308.
5868. gbvrl309.seq - Viral sequence entries, part 309.
5869. gbvrl31.seq - Viral sequence entries, part 31.
5870. gbvrl310.seq - Viral sequence entries, part 310.
5871. gbvrl311.seq - Viral sequence entries, part 311.
5872. gbvrl312.seq - Viral sequence entries, part 312.
5873. gbvrl313.seq - Viral sequence entries, part 313.
5874. gbvrl314.seq - Viral sequence entries, part 314.
5875. gbvrl315.seq - Viral sequence entries, part 315.
5876. gbvrl316.seq - Viral sequence entries, part 316.
5877. gbvrl317.seq - Viral sequence entries, part 317.
5878. gbvrl318.seq - Viral sequence entries, part 318.
5879. gbvrl319.seq - Viral sequence entries, part 319.
5880. gbvrl32.seq - Viral sequence entries, part 32.
5881. gbvrl320.seq - Viral sequence entries, part 320.
5882. gbvrl321.seq - Viral sequence entries, part 321.
5883. gbvrl322.seq - Viral sequence entries, part 322.
5884. gbvrl323.seq - Viral sequence entries, part 323.
5885. gbvrl324.seq - Viral sequence entries, part 324.
5886. gbvrl325.seq - Viral sequence entries, part 325.
5887. gbvrl326.seq - Viral sequence entries, part 326.
5888. gbvrl327.seq - Viral sequence entries, part 327.
5889. gbvrl328.seq - Viral sequence entries, part 328.
5890. gbvrl329.seq - Viral sequence entries, part 329.
5891. gbvrl33.seq - Viral sequence entries, part 33.
5892. gbvrl330.seq - Viral sequence entries, part 330.
5893. gbvrl331.seq - Viral sequence entries, part 331.
5894. gbvrl332.seq - Viral sequence entries, part 332.
5895. gbvrl333.seq - Viral sequence entries, part 333.
5896. gbvrl334.seq - Viral sequence entries, part 334.
5897. gbvrl335.seq - Viral sequence entries, part 335.
5898. gbvrl336.seq - Viral sequence entries, part 336.
5899. gbvrl337.seq - Viral sequence entries, part 337.
5900. gbvrl338.seq - Viral sequence entries, part 338.
5901. gbvrl339.seq - Viral sequence entries, part 339.
5902. gbvrl34.seq - Viral sequence entries, part 34.
5903. gbvrl340.seq - Viral sequence entries, part 340.
5904. gbvrl341.seq - Viral sequence entries, part 341.
5905. gbvrl342.seq - Viral sequence entries, part 342.
5906. gbvrl343.seq - Viral sequence entries, part 343.
5907. gbvrl344.seq - Viral sequence entries, part 344.
5908. gbvrl345.seq - Viral sequence entries, part 345.
5909. gbvrl346.seq - Viral sequence entries, part 346.
5910. gbvrl347.seq - Viral sequence entries, part 347.
5911. gbvrl348.seq - Viral sequence entries, part 348.
5912. gbvrl349.seq - Viral sequence entries, part 349.
5913. gbvrl35.seq - Viral sequence entries, part 35.
5914. gbvrl350.seq - Viral sequence entries, part 350.
5915. gbvrl351.seq - Viral sequence entries, part 351.
5916. gbvrl352.seq - Viral sequence entries, part 352.
5917. gbvrl353.seq - Viral sequence entries, part 353.
5918. gbvrl354.seq - Viral sequence entries, part 354.
5919. gbvrl355.seq - Viral sequence entries, part 355.
5920. gbvrl356.seq - Viral sequence entries, part 356.
5921. gbvrl357.seq - Viral sequence entries, part 357.
5922. gbvrl358.seq - Viral sequence entries, part 358.
5923. gbvrl359.seq - Viral sequence entries, part 359.
5924. gbvrl36.seq - Viral sequence entries, part 36.
5925. gbvrl360.seq - Viral sequence entries, part 360.
5926. gbvrl361.seq - Viral sequence entries, part 361.
5927. gbvrl362.seq - Viral sequence entries, part 362.
5928. gbvrl363.seq - Viral sequence entries, part 363.
5929. gbvrl364.seq - Viral sequence entries, part 364.
5930. gbvrl365.seq - Viral sequence entries, part 365.
5931. gbvrl366.seq - Viral sequence entries, part 366.
5932. gbvrl367.seq - Viral sequence entries, part 367.
5933. gbvrl368.seq - Viral sequence entries, part 368.
5934. gbvrl369.seq - Viral sequence entries, part 369.
5935. gbvrl37.seq - Viral sequence entries, part 37.
5936. gbvrl370.seq - Viral sequence entries, part 370.
5937. gbvrl371.seq - Viral sequence entries, part 371.
5938. gbvrl372.seq - Viral sequence entries, part 372.
5939. gbvrl373.seq - Viral sequence entries, part 373.
5940. gbvrl374.seq - Viral sequence entries, part 374.
5941. gbvrl375.seq - Viral sequence entries, part 375.
5942. gbvrl376.seq - Viral sequence entries, part 376.
5943. gbvrl377.seq - Viral sequence entries, part 377.
5944. gbvrl378.seq - Viral sequence entries, part 378.
5945. gbvrl379.seq - Viral sequence entries, part 379.
5946. gbvrl38.seq - Viral sequence entries, part 38.
5947. gbvrl380.seq - Viral sequence entries, part 380.
5948. gbvrl381.seq - Viral sequence entries, part 381.
5949. gbvrl382.seq - Viral sequence entries, part 382.
5950. gbvrl383.seq - Viral sequence entries, part 383.
5951. gbvrl384.seq - Viral sequence entries, part 384.
5952. gbvrl385.seq - Viral sequence entries, part 385.
5953. gbvrl386.seq - Viral sequence entries, part 386.
5954. gbvrl387.seq - Viral sequence entries, part 387.
5955. gbvrl388.seq - Viral sequence entries, part 388.
5956. gbvrl389.seq - Viral sequence entries, part 389.
5957. gbvrl39.seq - Viral sequence entries, part 39.
5958. gbvrl390.seq - Viral sequence entries, part 390.
5959. gbvrl391.seq - Viral sequence entries, part 391.
5960. gbvrl392.seq - Viral sequence entries, part 392.
5961. gbvrl393.seq - Viral sequence entries, part 393.
5962. gbvrl394.seq - Viral sequence entries, part 394.
5963. gbvrl395.seq - Viral sequence entries, part 395.
5964. gbvrl396.seq - Viral sequence entries, part 396.
5965. gbvrl397.seq - Viral sequence entries, part 397.
5966. gbvrl398.seq - Viral sequence entries, part 398.
5967. gbvrl399.seq - Viral sequence entries, part 399.
5968. gbvrl4.seq - Viral sequence entries, part 4.
5969. gbvrl40.seq - Viral sequence entries, part 40.
5970. gbvrl400.seq - Viral sequence entries, part 400.
5971. gbvrl401.seq - Viral sequence entries, part 401.
5972. gbvrl402.seq - Viral sequence entries, part 402.
5973. gbvrl403.seq - Viral sequence entries, part 403.
5974. gbvrl404.seq - Viral sequence entries, part 404.
5975. gbvrl405.seq - Viral sequence entries, part 405.
5976. gbvrl406.seq - Viral sequence entries, part 406.
5977. gbvrl407.seq - Viral sequence entries, part 407.
5978. gbvrl408.seq - Viral sequence entries, part 408.
5979. gbvrl409.seq - Viral sequence entries, part 409.
5980. gbvrl41.seq - Viral sequence entries, part 41.
5981. gbvrl410.seq - Viral sequence entries, part 410.
5982. gbvrl411.seq - Viral sequence entries, part 411.
5983. gbvrl412.seq - Viral sequence entries, part 412.
5984. gbvrl413.seq - Viral sequence entries, part 413.
5985. gbvrl414.seq - Viral sequence entries, part 414.
5986. gbvrl415.seq - Viral sequence entries, part 415.
5987. gbvrl416.seq - Viral sequence entries, part 416.
5988. gbvrl417.seq - Viral sequence entries, part 417.
5989. gbvrl418.seq - Viral sequence entries, part 418.
5990. gbvrl419.seq - Viral sequence entries, part 419.
5991. gbvrl42.seq - Viral sequence entries, part 42.
5992. gbvrl420.seq - Viral sequence entries, part 420.
5993. gbvrl421.seq - Viral sequence entries, part 421.
5994. gbvrl422.seq - Viral sequence entries, part 422.
5995. gbvrl423.seq - Viral sequence entries, part 423.
5996. gbvrl424.seq - Viral sequence entries, part 424.
5997. gbvrl425.seq - Viral sequence entries, part 425.
5998. gbvrl426.seq - Viral sequence entries, part 426.
5999. gbvrl427.seq - Viral sequence entries, part 427.
6000. gbvrl428.seq - Viral sequence entries, part 428.
6001. gbvrl429.seq - Viral sequence entries, part 429.
6002. gbvrl43.seq - Viral sequence entries, part 43.
6003. gbvrl430.seq - Viral sequence entries, part 430.
6004. gbvrl431.seq - Viral sequence entries, part 431.
6005. gbvrl432.seq - Viral sequence entries, part 432.
6006. gbvrl433.seq - Viral sequence entries, part 433.
6007. gbvrl434.seq - Viral sequence entries, part 434.
6008. gbvrl435.seq - Viral sequence entries, part 435.
6009. gbvrl436.seq - Viral sequence entries, part 436.
6010. gbvrl437.seq - Viral sequence entries, part 437.
6011. gbvrl438.seq - Viral sequence entries, part 438.
6012. gbvrl439.seq - Viral sequence entries, part 439.
6013. gbvrl44.seq - Viral sequence entries, part 44.
6014. gbvrl440.seq - Viral sequence entries, part 440.
6015. gbvrl441.seq - Viral sequence entries, part 441.
6016. gbvrl442.seq - Viral sequence entries, part 442.
6017. gbvrl443.seq - Viral sequence entries, part 443.
6018. gbvrl444.seq - Viral sequence entries, part 444.
6019. gbvrl445.seq - Viral sequence entries, part 445.
6020. gbvrl446.seq - Viral sequence entries, part 446.
6021. gbvrl447.seq - Viral sequence entries, part 447.
6022. gbvrl448.seq - Viral sequence entries, part 448.
6023. gbvrl449.seq - Viral sequence entries, part 449.
6024. gbvrl45.seq - Viral sequence entries, part 45.
6025. gbvrl450.seq - Viral sequence entries, part 450.
6026. gbvrl451.seq - Viral sequence entries, part 451.
6027. gbvrl452.seq - Viral sequence entries, part 452.
6028. gbvrl453.seq - Viral sequence entries, part 453.
6029. gbvrl454.seq - Viral sequence entries, part 454.
6030. gbvrl455.seq - Viral sequence entries, part 455.
6031. gbvrl456.seq - Viral sequence entries, part 456.
6032. gbvrl457.seq - Viral sequence entries, part 457.
6033. gbvrl458.seq - Viral sequence entries, part 458.
6034. gbvrl459.seq - Viral sequence entries, part 459.
6035. gbvrl46.seq - Viral sequence entries, part 46.
6036. gbvrl460.seq - Viral sequence entries, part 460.
6037. gbvrl461.seq - Viral sequence entries, part 461.
6038. gbvrl462.seq - Viral sequence entries, part 462.
6039. gbvrl463.seq - Viral sequence entries, part 463.
6040. gbvrl464.seq - Viral sequence entries, part 464.
6041. gbvrl465.seq - Viral sequence entries, part 465.
6042. gbvrl466.seq - Viral sequence entries, part 466.
6043. gbvrl467.seq - Viral sequence entries, part 467.
6044. gbvrl468.seq - Viral sequence entries, part 468.
6045. gbvrl469.seq - Viral sequence entries, part 469.
6046. gbvrl47.seq - Viral sequence entries, part 47.
6047. gbvrl470.seq - Viral sequence entries, part 470.
6048. gbvrl471.seq - Viral sequence entries, part 471.
6049. gbvrl472.seq - Viral sequence entries, part 472.
6050. gbvrl473.seq - Viral sequence entries, part 473.
6051. gbvrl474.seq - Viral sequence entries, part 474.
6052. gbvrl475.seq - Viral sequence entries, part 475.
6053. gbvrl476.seq - Viral sequence entries, part 476.
6054. gbvrl477.seq - Viral sequence entries, part 477.
6055. gbvrl478.seq - Viral sequence entries, part 478.
6056. gbvrl479.seq - Viral sequence entries, part 479.
6057. gbvrl48.seq - Viral sequence entries, part 48.
6058. gbvrl480.seq - Viral sequence entries, part 480.
6059. gbvrl481.seq - Viral sequence entries, part 481.
6060. gbvrl482.seq - Viral sequence entries, part 482.
6061. gbvrl483.seq - Viral sequence entries, part 483.
6062. gbvrl484.seq - Viral sequence entries, part 484.
6063. gbvrl485.seq - Viral sequence entries, part 485.
6064. gbvrl486.seq - Viral sequence entries, part 486.
6065. gbvrl487.seq - Viral sequence entries, part 487.
6066. gbvrl488.seq - Viral sequence entries, part 488.
6067. gbvrl489.seq - Viral sequence entries, part 489.
6068. gbvrl49.seq - Viral sequence entries, part 49.
6069. gbvrl490.seq - Viral sequence entries, part 490.
6070. gbvrl491.seq - Viral sequence entries, part 491.
6071. gbvrl492.seq - Viral sequence entries, part 492.
6072. gbvrl493.seq - Viral sequence entries, part 493.
6073. gbvrl494.seq - Viral sequence entries, part 494.
6074. gbvrl495.seq - Viral sequence entries, part 495.
6075. gbvrl496.seq - Viral sequence entries, part 496.
6076. gbvrl497.seq - Viral sequence entries, part 497.
6077. gbvrl498.seq - Viral sequence entries, part 498.
6078. gbvrl499.seq - Viral sequence entries, part 499.
6079. gbvrl5.seq - Viral sequence entries, part 5.
6080. gbvrl50.seq - Viral sequence entries, part 50.
6081. gbvrl500.seq - Viral sequence entries, part 500.
6082. gbvrl501.seq - Viral sequence entries, part 501.
6083. gbvrl502.seq - Viral sequence entries, part 502.
6084. gbvrl503.seq - Viral sequence entries, part 503.
6085. gbvrl504.seq - Viral sequence entries, part 504.
6086. gbvrl505.seq - Viral sequence entries, part 505.
6087. gbvrl506.seq - Viral sequence entries, part 506.
6088. gbvrl507.seq - Viral sequence entries, part 507.
6089. gbvrl508.seq - Viral sequence entries, part 508.
6090. gbvrl509.seq - Viral sequence entries, part 509.
6091. gbvrl51.seq - Viral sequence entries, part 51.
6092. gbvrl510.seq - Viral sequence entries, part 510.
6093. gbvrl511.seq - Viral sequence entries, part 511.
6094. gbvrl512.seq - Viral sequence entries, part 512.
6095. gbvrl513.seq - Viral sequence entries, part 513.
6096. gbvrl514.seq - Viral sequence entries, part 514.
6097. gbvrl515.seq - Viral sequence entries, part 515.
6098. gbvrl516.seq - Viral sequence entries, part 516.
6099. gbvrl517.seq - Viral sequence entries, part 517.
6100. gbvrl518.seq - Viral sequence entries, part 518.
6101. gbvrl519.seq - Viral sequence entries, part 519.
6102. gbvrl52.seq - Viral sequence entries, part 52.
6103. gbvrl520.seq - Viral sequence entries, part 520.
6104. gbvrl521.seq - Viral sequence entries, part 521.
6105. gbvrl522.seq - Viral sequence entries, part 522.
6106. gbvrl523.seq - Viral sequence entries, part 523.
6107. gbvrl524.seq - Viral sequence entries, part 524.
6108. gbvrl525.seq - Viral sequence entries, part 525.
6109. gbvrl526.seq - Viral sequence entries, part 526.
6110. gbvrl527.seq - Viral sequence entries, part 527.
6111. gbvrl528.seq - Viral sequence entries, part 528.
6112. gbvrl529.seq - Viral sequence entries, part 529.
6113. gbvrl53.seq - Viral sequence entries, part 53.
6114. gbvrl530.seq - Viral sequence entries, part 530.
6115. gbvrl531.seq - Viral sequence entries, part 531.
6116. gbvrl532.seq - Viral sequence entries, part 532.
6117. gbvrl533.seq - Viral sequence entries, part 533.
6118. gbvrl534.seq - Viral sequence entries, part 534.
6119. gbvrl535.seq - Viral sequence entries, part 535.
6120. gbvrl536.seq - Viral sequence entries, part 536.
6121. gbvrl537.seq - Viral sequence entries, part 537.
6122. gbvrl538.seq - Viral sequence entries, part 538.
6123. gbvrl539.seq - Viral sequence entries, part 539.
6124. gbvrl54.seq - Viral sequence entries, part 54.
6125. gbvrl540.seq - Viral sequence entries, part 540.
6126. gbvrl541.seq - Viral sequence entries, part 541.
6127. gbvrl542.seq - Viral sequence entries, part 542.
6128. gbvrl543.seq - Viral sequence entries, part 543.
6129. gbvrl544.seq - Viral sequence entries, part 544.
6130. gbvrl545.seq - Viral sequence entries, part 545.
6131. gbvrl546.seq - Viral sequence entries, part 546.
6132. gbvrl547.seq - Viral sequence entries, part 547.
6133. gbvrl548.seq - Viral sequence entries, part 548.
6134. gbvrl549.seq - Viral sequence entries, part 549.
6135. gbvrl55.seq - Viral sequence entries, part 55.
6136. gbvrl550.seq - Viral sequence entries, part 550.
6137. gbvrl551.seq - Viral sequence entries, part 551.
6138. gbvrl552.seq - Viral sequence entries, part 552.
6139. gbvrl553.seq - Viral sequence entries, part 553.
6140. gbvrl554.seq - Viral sequence entries, part 554.
6141. gbvrl555.seq - Viral sequence entries, part 555.
6142. gbvrl556.seq - Viral sequence entries, part 556.
6143. gbvrl557.seq - Viral sequence entries, part 557.
6144. gbvrl558.seq - Viral sequence entries, part 558.
6145. gbvrl559.seq - Viral sequence entries, part 559.
6146. gbvrl56.seq - Viral sequence entries, part 56.
6147. gbvrl560.seq - Viral sequence entries, part 560.
6148. gbvrl561.seq - Viral sequence entries, part 561.
6149. gbvrl562.seq - Viral sequence entries, part 562.
6150. gbvrl563.seq - Viral sequence entries, part 563.
6151. gbvrl564.seq - Viral sequence entries, part 564.
6152. gbvrl565.seq - Viral sequence entries, part 565.
6153. gbvrl566.seq - Viral sequence entries, part 566.
6154. gbvrl567.seq - Viral sequence entries, part 567.
6155. gbvrl568.seq - Viral sequence entries, part 568.
6156. gbvrl569.seq - Viral sequence entries, part 569.
6157. gbvrl57.seq - Viral sequence entries, part 57.
6158. gbvrl570.seq - Viral sequence entries, part 570.
6159. gbvrl571.seq - Viral sequence entries, part 571.
6160. gbvrl572.seq - Viral sequence entries, part 572.
6161. gbvrl573.seq - Viral sequence entries, part 573.
6162. gbvrl574.seq - Viral sequence entries, part 574.
6163. gbvrl575.seq - Viral sequence entries, part 575.
6164. gbvrl576.seq - Viral sequence entries, part 576.
6165. gbvrl577.seq - Viral sequence entries, part 577.
6166. gbvrl578.seq - Viral sequence entries, part 578.
6167. gbvrl579.seq - Viral sequence entries, part 579.
6168. gbvrl58.seq - Viral sequence entries, part 58.
6169. gbvrl580.seq - Viral sequence entries, part 580.
6170. gbvrl581.seq - Viral sequence entries, part 581.
6171. gbvrl582.seq - Viral sequence entries, part 582.
6172. gbvrl583.seq - Viral sequence entries, part 583.
6173. gbvrl584.seq - Viral sequence entries, part 584.
6174. gbvrl585.seq - Viral sequence entries, part 585.
6175. gbvrl586.seq - Viral sequence entries, part 586.
6176. gbvrl587.seq - Viral sequence entries, part 587.
6177. gbvrl588.seq - Viral sequence entries, part 588.
6178. gbvrl589.seq - Viral sequence entries, part 589.
6179. gbvrl59.seq - Viral sequence entries, part 59.
6180. gbvrl590.seq - Viral sequence entries, part 590.
6181. gbvrl591.seq - Viral sequence entries, part 591.
6182. gbvrl592.seq - Viral sequence entries, part 592.
6183. gbvrl593.seq - Viral sequence entries, part 593.
6184. gbvrl594.seq - Viral sequence entries, part 594.
6185. gbvrl595.seq - Viral sequence entries, part 595.
6186. gbvrl596.seq - Viral sequence entries, part 596.
6187. gbvrl597.seq - Viral sequence entries, part 597.
6188. gbvrl598.seq - Viral sequence entries, part 598.
6189. gbvrl599.seq - Viral sequence entries, part 599.
6190. gbvrl6.seq - Viral sequence entries, part 6.
6191. gbvrl60.seq - Viral sequence entries, part 60.
6192. gbvrl600.seq - Viral sequence entries, part 600.
6193. gbvrl601.seq - Viral sequence entries, part 601.
6194. gbvrl602.seq - Viral sequence entries, part 602.
6195. gbvrl603.seq - Viral sequence entries, part 603.
6196. gbvrl604.seq - Viral sequence entries, part 604.
6197. gbvrl605.seq - Viral sequence entries, part 605.
6198. gbvrl606.seq - Viral sequence entries, part 606.
6199. gbvrl607.seq - Viral sequence entries, part 607.
6200. gbvrl608.seq - Viral sequence entries, part 608.
6201. gbvrl609.seq - Viral sequence entries, part 609.
6202. gbvrl61.seq - Viral sequence entries, part 61.
6203. gbvrl610.seq - Viral sequence entries, part 610.
6204. gbvrl611.seq - Viral sequence entries, part 611.
6205. gbvrl612.seq - Viral sequence entries, part 612.
6206. gbvrl613.seq - Viral sequence entries, part 613.
6207. gbvrl614.seq - Viral sequence entries, part 614.
6208. gbvrl615.seq - Viral sequence entries, part 615.
6209. gbvrl616.seq - Viral sequence entries, part 616.
6210. gbvrl617.seq - Viral sequence entries, part 617.
6211. gbvrl618.seq - Viral sequence entries, part 618.
6212. gbvrl619.seq - Viral sequence entries, part 619.
6213. gbvrl62.seq - Viral sequence entries, part 62.
6214. gbvrl620.seq - Viral sequence entries, part 620.
6215. gbvrl621.seq - Viral sequence entries, part 621.
6216. gbvrl622.seq - Viral sequence entries, part 622.
6217. gbvrl623.seq - Viral sequence entries, part 623.
6218. gbvrl624.seq - Viral sequence entries, part 624.
6219. gbvrl625.seq - Viral sequence entries, part 625.
6220. gbvrl626.seq - Viral sequence entries, part 626.
6221. gbvrl627.seq - Viral sequence entries, part 627.
6222. gbvrl628.seq - Viral sequence entries, part 628.
6223. gbvrl629.seq - Viral sequence entries, part 629.
6224. gbvrl63.seq - Viral sequence entries, part 63.
6225. gbvrl630.seq - Viral sequence entries, part 630.
6226. gbvrl631.seq - Viral sequence entries, part 631.
6227. gbvrl632.seq - Viral sequence entries, part 632.
6228. gbvrl633.seq - Viral sequence entries, part 633.
6229. gbvrl634.seq - Viral sequence entries, part 634.
6230. gbvrl635.seq - Viral sequence entries, part 635.
6231. gbvrl636.seq - Viral sequence entries, part 636.
6232. gbvrl637.seq - Viral sequence entries, part 637.
6233. gbvrl638.seq - Viral sequence entries, part 638.
6234. gbvrl639.seq - Viral sequence entries, part 639.
6235. gbvrl64.seq - Viral sequence entries, part 64.
6236. gbvrl640.seq - Viral sequence entries, part 640.
6237. gbvrl641.seq - Viral sequence entries, part 641.
6238. gbvrl642.seq - Viral sequence entries, part 642.
6239. gbvrl643.seq - Viral sequence entries, part 643.
6240. gbvrl644.seq - Viral sequence entries, part 644.
6241. gbvrl645.seq - Viral sequence entries, part 645.
6242. gbvrl646.seq - Viral sequence entries, part 646.
6243. gbvrl647.seq - Viral sequence entries, part 647.
6244. gbvrl648.seq - Viral sequence entries, part 648.
6245. gbvrl649.seq - Viral sequence entries, part 649.
6246. gbvrl65.seq - Viral sequence entries, part 65.
6247. gbvrl650.seq - Viral sequence entries, part 650.
6248. gbvrl651.seq - Viral sequence entries, part 651.
6249. gbvrl652.seq - Viral sequence entries, part 652.
6250. gbvrl653.seq - Viral sequence entries, part 653.
6251. gbvrl654.seq - Viral sequence entries, part 654.
6252. gbvrl655.seq - Viral sequence entries, part 655.
6253. gbvrl656.seq - Viral sequence entries, part 656.
6254. gbvrl657.seq - Viral sequence entries, part 657.
6255. gbvrl658.seq - Viral sequence entries, part 658.
6256. gbvrl659.seq - Viral sequence entries, part 659.
6257. gbvrl66.seq - Viral sequence entries, part 66.
6258. gbvrl660.seq - Viral sequence entries, part 660.
6259. gbvrl661.seq - Viral sequence entries, part 661.
6260. gbvrl662.seq - Viral sequence entries, part 662.
6261. gbvrl663.seq - Viral sequence entries, part 663.
6262. gbvrl664.seq - Viral sequence entries, part 664.
6263. gbvrl665.seq - Viral sequence entries, part 665.
6264. gbvrl666.seq - Viral sequence entries, part 666.
6265. gbvrl667.seq - Viral sequence entries, part 667.
6266. gbvrl668.seq - Viral sequence entries, part 668.
6267. gbvrl669.seq - Viral sequence entries, part 669.
6268. gbvrl67.seq - Viral sequence entries, part 67.
6269. gbvrl670.seq - Viral sequence entries, part 670.
6270. gbvrl671.seq - Viral sequence entries, part 671.
6271. gbvrl672.seq - Viral sequence entries, part 672.
6272. gbvrl673.seq - Viral sequence entries, part 673.
6273. gbvrl674.seq - Viral sequence entries, part 674.
6274. gbvrl675.seq - Viral sequence entries, part 675.
6275. gbvrl676.seq - Viral sequence entries, part 676.
6276. gbvrl677.seq - Viral sequence entries, part 677.
6277. gbvrl678.seq - Viral sequence entries, part 678.
6278. gbvrl679.seq - Viral sequence entries, part 679.
6279. gbvrl68.seq - Viral sequence entries, part 68.
6280. gbvrl680.seq - Viral sequence entries, part 680.
6281. gbvrl681.seq - Viral sequence entries, part 681.
6282. gbvrl682.seq - Viral sequence entries, part 682.
6283. gbvrl683.seq - Viral sequence entries, part 683.
6284. gbvrl684.seq - Viral sequence entries, part 684.
6285. gbvrl685.seq - Viral sequence entries, part 685.
6286. gbvrl686.seq - Viral sequence entries, part 686.
6287. gbvrl687.seq - Viral sequence entries, part 687.
6288. gbvrl688.seq - Viral sequence entries, part 688.
6289. gbvrl689.seq - Viral sequence entries, part 689.
6290. gbvrl69.seq - Viral sequence entries, part 69.
6291. gbvrl690.seq - Viral sequence entries, part 690.
6292. gbvrl691.seq - Viral sequence entries, part 691.
6293. gbvrl692.seq - Viral sequence entries, part 692.
6294. gbvrl693.seq - Viral sequence entries, part 693.
6295. gbvrl694.seq - Viral sequence entries, part 694.
6296. gbvrl695.seq - Viral sequence entries, part 695.
6297. gbvrl696.seq - Viral sequence entries, part 696.
6298. gbvrl697.seq - Viral sequence entries, part 697.
6299. gbvrl698.seq - Viral sequence entries, part 698.
6300. gbvrl699.seq - Viral sequence entries, part 699.
6301. gbvrl7.seq - Viral sequence entries, part 7.
6302. gbvrl70.seq - Viral sequence entries, part 70.
6303. gbvrl700.seq - Viral sequence entries, part 700.
6304. gbvrl701.seq - Viral sequence entries, part 701.
6305. gbvrl702.seq - Viral sequence entries, part 702.
6306. gbvrl703.seq - Viral sequence entries, part 703.
6307. gbvrl704.seq - Viral sequence entries, part 704.
6308. gbvrl705.seq - Viral sequence entries, part 705.
6309. gbvrl706.seq - Viral sequence entries, part 706.
6310. gbvrl707.seq - Viral sequence entries, part 707.
6311. gbvrl708.seq - Viral sequence entries, part 708.
6312. gbvrl709.seq - Viral sequence entries, part 709.
6313. gbvrl71.seq - Viral sequence entries, part 71.
6314. gbvrl710.seq - Viral sequence entries, part 710.
6315. gbvrl711.seq - Viral sequence entries, part 711.
6316. gbvrl712.seq - Viral sequence entries, part 712.
6317. gbvrl713.seq - Viral sequence entries, part 713.
6318. gbvrl714.seq - Viral sequence entries, part 714.
6319. gbvrl715.seq - Viral sequence entries, part 715.
6320. gbvrl716.seq - Viral sequence entries, part 716.
6321. gbvrl717.seq - Viral sequence entries, part 717.
6322. gbvrl718.seq - Viral sequence entries, part 718.
6323. gbvrl719.seq - Viral sequence entries, part 719.
6324. gbvrl72.seq - Viral sequence entries, part 72.
6325. gbvrl720.seq - Viral sequence entries, part 720.
6326. gbvrl721.seq - Viral sequence entries, part 721.
6327. gbvrl722.seq - Viral sequence entries, part 722.
6328. gbvrl723.seq - Viral sequence entries, part 723.
6329. gbvrl724.seq - Viral sequence entries, part 724.
6330. gbvrl725.seq - Viral sequence entries, part 725.
6331. gbvrl726.seq - Viral sequence entries, part 726.
6332. gbvrl727.seq - Viral sequence entries, part 727.
6333. gbvrl728.seq - Viral sequence entries, part 728.
6334. gbvrl729.seq - Viral sequence entries, part 729.
6335. gbvrl73.seq - Viral sequence entries, part 73.
6336. gbvrl730.seq - Viral sequence entries, part 730.
6337. gbvrl731.seq - Viral sequence entries, part 731.
6338. gbvrl732.seq - Viral sequence entries, part 732.
6339. gbvrl733.seq - Viral sequence entries, part 733.
6340. gbvrl734.seq - Viral sequence entries, part 734.
6341. gbvrl735.seq - Viral sequence entries, part 735.
6342. gbvrl736.seq - Viral sequence entries, part 736.
6343. gbvrl737.seq - Viral sequence entries, part 737.
6344. gbvrl738.seq - Viral sequence entries, part 738.
6345. gbvrl739.seq - Viral sequence entries, part 739.
6346. gbvrl74.seq - Viral sequence entries, part 74.
6347. gbvrl740.seq - Viral sequence entries, part 740.
6348. gbvrl741.seq - Viral sequence entries, part 741.
6349. gbvrl742.seq - Viral sequence entries, part 742.
6350. gbvrl743.seq - Viral sequence entries, part 743.
6351. gbvrl744.seq - Viral sequence entries, part 744.
6352. gbvrl745.seq - Viral sequence entries, part 745.
6353. gbvrl746.seq - Viral sequence entries, part 746.
6354. gbvrl747.seq - Viral sequence entries, part 747.
6355. gbvrl748.seq - Viral sequence entries, part 748.
6356. gbvrl749.seq - Viral sequence entries, part 749.
6357. gbvrl75.seq - Viral sequence entries, part 75.
6358. gbvrl750.seq - Viral sequence entries, part 750.
6359. gbvrl751.seq - Viral sequence entries, part 751.
6360. gbvrl752.seq - Viral sequence entries, part 752.
6361. gbvrl753.seq - Viral sequence entries, part 753.
6362. gbvrl754.seq - Viral sequence entries, part 754.
6363. gbvrl755.seq - Viral sequence entries, part 755.
6364. gbvrl756.seq - Viral sequence entries, part 756.
6365. gbvrl757.seq - Viral sequence entries, part 757.
6366. gbvrl758.seq - Viral sequence entries, part 758.
6367. gbvrl759.seq - Viral sequence entries, part 759.
6368. gbvrl76.seq - Viral sequence entries, part 76.
6369. gbvrl760.seq - Viral sequence entries, part 760.
6370. gbvrl761.seq - Viral sequence entries, part 761.
6371. gbvrl762.seq - Viral sequence entries, part 762.
6372. gbvrl763.seq - Viral sequence entries, part 763.
6373. gbvrl764.seq - Viral sequence entries, part 764.
6374. gbvrl765.seq - Viral sequence entries, part 765.
6375. gbvrl766.seq - Viral sequence entries, part 766.
6376. gbvrl767.seq - Viral sequence entries, part 767.
6377. gbvrl768.seq - Viral sequence entries, part 768.
6378. gbvrl769.seq - Viral sequence entries, part 769.
6379. gbvrl77.seq - Viral sequence entries, part 77.
6380. gbvrl770.seq - Viral sequence entries, part 770.
6381. gbvrl771.seq - Viral sequence entries, part 771.
6382. gbvrl772.seq - Viral sequence entries, part 772.
6383. gbvrl773.seq - Viral sequence entries, part 773.
6384. gbvrl774.seq - Viral sequence entries, part 774.
6385. gbvrl775.seq - Viral sequence entries, part 775.
6386. gbvrl776.seq - Viral sequence entries, part 776.
6387. gbvrl777.seq - Viral sequence entries, part 777.
6388. gbvrl778.seq - Viral sequence entries, part 778.
6389. gbvrl779.seq - Viral sequence entries, part 779.
6390. gbvrl78.seq - Viral sequence entries, part 78.
6391. gbvrl780.seq - Viral sequence entries, part 780.
6392. gbvrl781.seq - Viral sequence entries, part 781.
6393. gbvrl782.seq - Viral sequence entries, part 782.
6394. gbvrl783.seq - Viral sequence entries, part 783.
6395. gbvrl784.seq - Viral sequence entries, part 784.
6396. gbvrl785.seq - Viral sequence entries, part 785.
6397. gbvrl786.seq - Viral sequence entries, part 786.
6398. gbvrl787.seq - Viral sequence entries, part 787.
6399. gbvrl788.seq - Viral sequence entries, part 788.
6400. gbvrl789.seq - Viral sequence entries, part 789.
6401. gbvrl79.seq - Viral sequence entries, part 79.
6402. gbvrl790.seq - Viral sequence entries, part 790.
6403. gbvrl791.seq - Viral sequence entries, part 791.
6404. gbvrl792.seq - Viral sequence entries, part 792.
6405. gbvrl793.seq - Viral sequence entries, part 793.
6406. gbvrl794.seq - Viral sequence entries, part 794.
6407. gbvrl795.seq - Viral sequence entries, part 795.
6408. gbvrl796.seq - Viral sequence entries, part 796.
6409. gbvrl797.seq - Viral sequence entries, part 797.
6410. gbvrl798.seq - Viral sequence entries, part 798.
6411. gbvrl799.seq - Viral sequence entries, part 799.
6412. gbvrl8.seq - Viral sequence entries, part 8.
6413. gbvrl80.seq - Viral sequence entries, part 80.
6414. gbvrl800.seq - Viral sequence entries, part 800.
6415. gbvrl801.seq - Viral sequence entries, part 801.
6416. gbvrl802.seq - Viral sequence entries, part 802.
6417. gbvrl803.seq - Viral sequence entries, part 803.
6418. gbvrl804.seq - Viral sequence entries, part 804.
6419. gbvrl805.seq - Viral sequence entries, part 805.
6420. gbvrl806.seq - Viral sequence entries, part 806.
6421. gbvrl807.seq - Viral sequence entries, part 807.
6422. gbvrl808.seq - Viral sequence entries, part 808.
6423. gbvrl809.seq - Viral sequence entries, part 809.
6424. gbvrl81.seq - Viral sequence entries, part 81.
6425. gbvrl810.seq - Viral sequence entries, part 810.
6426. gbvrl811.seq - Viral sequence entries, part 811.
6427. gbvrl812.seq - Viral sequence entries, part 812.
6428. gbvrl813.seq - Viral sequence entries, part 813.
6429. gbvrl814.seq - Viral sequence entries, part 814.
6430. gbvrl815.seq - Viral sequence entries, part 815.
6431. gbvrl816.seq - Viral sequence entries, part 816.
6432. gbvrl817.seq - Viral sequence entries, part 817.
6433. gbvrl818.seq - Viral sequence entries, part 818.
6434. gbvrl819.seq - Viral sequence entries, part 819.
6435. gbvrl82.seq - Viral sequence entries, part 82.
6436. gbvrl820.seq - Viral sequence entries, part 820.
6437. gbvrl821.seq - Viral sequence entries, part 821.
6438. gbvrl822.seq - Viral sequence entries, part 822.
6439. gbvrl823.seq - Viral sequence entries, part 823.
6440. gbvrl824.seq - Viral sequence entries, part 824.
6441. gbvrl825.seq - Viral sequence entries, part 825.
6442. gbvrl826.seq - Viral sequence entries, part 826.
6443. gbvrl827.seq - Viral sequence entries, part 827.
6444. gbvrl828.seq - Viral sequence entries, part 828.
6445. gbvrl829.seq - Viral sequence entries, part 829.
6446. gbvrl83.seq - Viral sequence entries, part 83.
6447. gbvrl830.seq - Viral sequence entries, part 830.
6448. gbvrl831.seq - Viral sequence entries, part 831.
6449. gbvrl832.seq - Viral sequence entries, part 832.
6450. gbvrl833.seq - Viral sequence entries, part 833.
6451. gbvrl834.seq - Viral sequence entries, part 834.
6452. gbvrl835.seq - Viral sequence entries, part 835.
6453. gbvrl836.seq - Viral sequence entries, part 836.
6454. gbvrl837.seq - Viral sequence entries, part 837.
6455. gbvrl838.seq - Viral sequence entries, part 838.
6456. gbvrl839.seq - Viral sequence entries, part 839.
6457. gbvrl84.seq - Viral sequence entries, part 84.
6458. gbvrl840.seq - Viral sequence entries, part 840.
6459. gbvrl841.seq - Viral sequence entries, part 841.
6460. gbvrl842.seq - Viral sequence entries, part 842.
6461. gbvrl843.seq - Viral sequence entries, part 843.
6462. gbvrl844.seq - Viral sequence entries, part 844.
6463. gbvrl845.seq - Viral sequence entries, part 845.
6464. gbvrl846.seq - Viral sequence entries, part 846.
6465. gbvrl847.seq - Viral sequence entries, part 847.
6466. gbvrl848.seq - Viral sequence entries, part 848.
6467. gbvrl849.seq - Viral sequence entries, part 849.
6468. gbvrl85.seq - Viral sequence entries, part 85.
6469. gbvrl850.seq - Viral sequence entries, part 850.
6470. gbvrl851.seq - Viral sequence entries, part 851.
6471. gbvrl852.seq - Viral sequence entries, part 852.
6472. gbvrl853.seq - Viral sequence entries, part 853.
6473. gbvrl854.seq - Viral sequence entries, part 854.
6474. gbvrl855.seq - Viral sequence entries, part 855.
6475. gbvrl856.seq - Viral sequence entries, part 856.
6476. gbvrl857.seq - Viral sequence entries, part 857.
6477. gbvrl858.seq - Viral sequence entries, part 858.
6478. gbvrl859.seq - Viral sequence entries, part 859.
6479. gbvrl86.seq - Viral sequence entries, part 86.
6480. gbvrl860.seq - Viral sequence entries, part 860.
6481. gbvrl861.seq - Viral sequence entries, part 861.
6482. gbvrl862.seq - Viral sequence entries, part 862.
6483. gbvrl863.seq - Viral sequence entries, part 863.
6484. gbvrl864.seq - Viral sequence entries, part 864.
6485. gbvrl865.seq - Viral sequence entries, part 865.
6486. gbvrl866.seq - Viral sequence entries, part 866.
6487. gbvrl867.seq - Viral sequence entries, part 867.
6488. gbvrl868.seq - Viral sequence entries, part 868.
6489. gbvrl869.seq - Viral sequence entries, part 869.
6490. gbvrl87.seq - Viral sequence entries, part 87.
6491. gbvrl870.seq - Viral sequence entries, part 870.
6492. gbvrl871.seq - Viral sequence entries, part 871.
6493. gbvrl872.seq - Viral sequence entries, part 872.
6494. gbvrl873.seq - Viral sequence entries, part 873.
6495. gbvrl874.seq - Viral sequence entries, part 874.
6496. gbvrl875.seq - Viral sequence entries, part 875.
6497. gbvrl876.seq - Viral sequence entries, part 876.
6498. gbvrl877.seq - Viral sequence entries, part 877.
6499. gbvrl878.seq - Viral sequence entries, part 878.
6500. gbvrl879.seq - Viral sequence entries, part 879.
6501. gbvrl88.seq - Viral sequence entries, part 88.
6502. gbvrl880.seq - Viral sequence entries, part 880.
6503. gbvrl881.seq - Viral sequence entries, part 881.
6504. gbvrl882.seq - Viral sequence entries, part 882.
6505. gbvrl883.seq - Viral sequence entries, part 883.
6506. gbvrl884.seq - Viral sequence entries, part 884.
6507. gbvrl885.seq - Viral sequence entries, part 885.
6508. gbvrl886.seq - Viral sequence entries, part 886.
6509. gbvrl89.seq - Viral sequence entries, part 89.
6510. gbvrl9.seq - Viral sequence entries, part 9.
6511. gbvrl90.seq - Viral sequence entries, part 90.
6512. gbvrl91.seq - Viral sequence entries, part 91.
6513. gbvrl92.seq - Viral sequence entries, part 92.
6514. gbvrl93.seq - Viral sequence entries, part 93.
6515. gbvrl94.seq - Viral sequence entries, part 94.
6516. gbvrl95.seq - Viral sequence entries, part 95.
6517. gbvrl96.seq - Viral sequence entries, part 96.
6518. gbvrl97.seq - Viral sequence entries, part 97.
6519. gbvrl98.seq - Viral sequence entries, part 98.
6520. gbvrl99.seq - Viral sequence entries, part 99.
6521. gbvrt1.seq - Other vertebrate sequence entries, part 1.
6522. gbvrt10.seq - Other vertebrate sequence entries, part 10.
6523. gbvrt100.seq - Other vertebrate sequence entries, part 100.
6524. gbvrt101.seq - Other vertebrate sequence entries, part 101.
6525. gbvrt102.seq - Other vertebrate sequence entries, part 102.
6526. gbvrt103.seq - Other vertebrate sequence entries, part 103.
6527. gbvrt104.seq - Other vertebrate sequence entries, part 104.
6528. gbvrt105.seq - Other vertebrate sequence entries, part 105.
6529. gbvrt106.seq - Other vertebrate sequence entries, part 106.
6530. gbvrt107.seq - Other vertebrate sequence entries, part 107.
6531. gbvrt108.seq - Other vertebrate sequence entries, part 108.
6532. gbvrt109.seq - Other vertebrate sequence entries, part 109.
6533. gbvrt11.seq - Other vertebrate sequence entries, part 11.
6534. gbvrt110.seq - Other vertebrate sequence entries, part 110.
6535. gbvrt111.seq - Other vertebrate sequence entries, part 111.
6536. gbvrt112.seq - Other vertebrate sequence entries, part 112.
6537. gbvrt113.seq - Other vertebrate sequence entries, part 113.
6538. gbvrt114.seq - Other vertebrate sequence entries, part 114.
6539. gbvrt115.seq - Other vertebrate sequence entries, part 115.
6540. gbvrt116.seq - Other vertebrate sequence entries, part 116.
6541. gbvrt117.seq - Other vertebrate sequence entries, part 117.
6542. gbvrt118.seq - Other vertebrate sequence entries, part 118.
6543. gbvrt119.seq - Other vertebrate sequence entries, part 119.
6544. gbvrt12.seq - Other vertebrate sequence entries, part 12.
6545. gbvrt120.seq - Other vertebrate sequence entries, part 120.
6546. gbvrt121.seq - Other vertebrate sequence entries, part 121.
6547. gbvrt122.seq - Other vertebrate sequence entries, part 122.
6548. gbvrt123.seq - Other vertebrate sequence entries, part 123.
6549. gbvrt124.seq - Other vertebrate sequence entries, part 124.
6550. gbvrt125.seq - Other vertebrate sequence entries, part 125.
6551. gbvrt126.seq - Other vertebrate sequence entries, part 126.
6552. gbvrt127.seq - Other vertebrate sequence entries, part 127.
6553. gbvrt128.seq - Other vertebrate sequence entries, part 128.
6554. gbvrt129.seq - Other vertebrate sequence entries, part 129.
6555. gbvrt13.seq - Other vertebrate sequence entries, part 13.
6556. gbvrt130.seq - Other vertebrate sequence entries, part 130.
6557. gbvrt131.seq - Other vertebrate sequence entries, part 131.
6558. gbvrt132.seq - Other vertebrate sequence entries, part 132.
6559. gbvrt133.seq - Other vertebrate sequence entries, part 133.
6560. gbvrt134.seq - Other vertebrate sequence entries, part 134.
6561. gbvrt135.seq - Other vertebrate sequence entries, part 135.
6562. gbvrt136.seq - Other vertebrate sequence entries, part 136.
6563. gbvrt137.seq - Other vertebrate sequence entries, part 137.
6564. gbvrt138.seq - Other vertebrate sequence entries, part 138.
6565. gbvrt139.seq - Other vertebrate sequence entries, part 139.
6566. gbvrt14.seq - Other vertebrate sequence entries, part 14.
6567. gbvrt140.seq - Other vertebrate sequence entries, part 140.
6568. gbvrt141.seq - Other vertebrate sequence entries, part 141.
6569. gbvrt142.seq - Other vertebrate sequence entries, part 142.
6570. gbvrt143.seq - Other vertebrate sequence entries, part 143.
6571. gbvrt144.seq - Other vertebrate sequence entries, part 144.
6572. gbvrt145.seq - Other vertebrate sequence entries, part 145.
6573. gbvrt146.seq - Other vertebrate sequence entries, part 146.
6574. gbvrt147.seq - Other vertebrate sequence entries, part 147.
6575. gbvrt148.seq - Other vertebrate sequence entries, part 148.
6576. gbvrt149.seq - Other vertebrate sequence entries, part 149.
6577. gbvrt15.seq - Other vertebrate sequence entries, part 15.
6578. gbvrt150.seq - Other vertebrate sequence entries, part 150.
6579. gbvrt151.seq - Other vertebrate sequence entries, part 151.
6580. gbvrt152.seq - Other vertebrate sequence entries, part 152.
6581. gbvrt153.seq - Other vertebrate sequence entries, part 153.
6582. gbvrt154.seq - Other vertebrate sequence entries, part 154.
6583. gbvrt155.seq - Other vertebrate sequence entries, part 155.
6584. gbvrt156.seq - Other vertebrate sequence entries, part 156.
6585. gbvrt157.seq - Other vertebrate sequence entries, part 157.
6586. gbvrt158.seq - Other vertebrate sequence entries, part 158.
6587. gbvrt159.seq - Other vertebrate sequence entries, part 159.
6588. gbvrt16.seq - Other vertebrate sequence entries, part 16.
6589. gbvrt160.seq - Other vertebrate sequence entries, part 160.
6590. gbvrt161.seq - Other vertebrate sequence entries, part 161.
6591. gbvrt162.seq - Other vertebrate sequence entries, part 162.
6592. gbvrt163.seq - Other vertebrate sequence entries, part 163.
6593. gbvrt164.seq - Other vertebrate sequence entries, part 164.
6594. gbvrt165.seq - Other vertebrate sequence entries, part 165.
6595. gbvrt166.seq - Other vertebrate sequence entries, part 166.
6596. gbvrt167.seq - Other vertebrate sequence entries, part 167.
6597. gbvrt168.seq - Other vertebrate sequence entries, part 168.
6598. gbvrt169.seq - Other vertebrate sequence entries, part 169.
6599. gbvrt17.seq - Other vertebrate sequence entries, part 17.
6600. gbvrt170.seq - Other vertebrate sequence entries, part 170.
6601. gbvrt171.seq - Other vertebrate sequence entries, part 171.
6602. gbvrt172.seq - Other vertebrate sequence entries, part 172.
6603. gbvrt173.seq - Other vertebrate sequence entries, part 173.
6604. gbvrt174.seq - Other vertebrate sequence entries, part 174.
6605. gbvrt175.seq - Other vertebrate sequence entries, part 175.
6606. gbvrt176.seq - Other vertebrate sequence entries, part 176.
6607. gbvrt177.seq - Other vertebrate sequence entries, part 177.
6608. gbvrt178.seq - Other vertebrate sequence entries, part 178.
6609. gbvrt179.seq - Other vertebrate sequence entries, part 179.
6610. gbvrt18.seq - Other vertebrate sequence entries, part 18.
6611. gbvrt180.seq - Other vertebrate sequence entries, part 180.
6612. gbvrt181.seq - Other vertebrate sequence entries, part 181.
6613. gbvrt182.seq - Other vertebrate sequence entries, part 182.
6614. gbvrt183.seq - Other vertebrate sequence entries, part 183.
6615. gbvrt184.seq - Other vertebrate sequence entries, part 184.
6616. gbvrt185.seq - Other vertebrate sequence entries, part 185.
6617. gbvrt186.seq - Other vertebrate sequence entries, part 186.
6618. gbvrt187.seq - Other vertebrate sequence entries, part 187.
6619. gbvrt188.seq - Other vertebrate sequence entries, part 188.
6620. gbvrt189.seq - Other vertebrate sequence entries, part 189.
6621. gbvrt19.seq - Other vertebrate sequence entries, part 19.
6622. gbvrt190.seq - Other vertebrate sequence entries, part 190.
6623. gbvrt191.seq - Other vertebrate sequence entries, part 191.
6624. gbvrt192.seq - Other vertebrate sequence entries, part 192.
6625. gbvrt193.seq - Other vertebrate sequence entries, part 193.
6626. gbvrt194.seq - Other vertebrate sequence entries, part 194.
6627. gbvrt195.seq - Other vertebrate sequence entries, part 195.
6628. gbvrt196.seq - Other vertebrate sequence entries, part 196.
6629. gbvrt197.seq - Other vertebrate sequence entries, part 197.
6630. gbvrt198.seq - Other vertebrate sequence entries, part 198.
6631. gbvrt199.seq - Other vertebrate sequence entries, part 199.
6632. gbvrt2.seq - Other vertebrate sequence entries, part 2.
6633. gbvrt20.seq - Other vertebrate sequence entries, part 20.
6634. gbvrt200.seq - Other vertebrate sequence entries, part 200.
6635. gbvrt201.seq - Other vertebrate sequence entries, part 201.
6636. gbvrt202.seq - Other vertebrate sequence entries, part 202.
6637. gbvrt203.seq - Other vertebrate sequence entries, part 203.
6638. gbvrt204.seq - Other vertebrate sequence entries, part 204.
6639. gbvrt205.seq - Other vertebrate sequence entries, part 205.
6640. gbvrt206.seq - Other vertebrate sequence entries, part 206.
6641. gbvrt207.seq - Other vertebrate sequence entries, part 207.
6642. gbvrt208.seq - Other vertebrate sequence entries, part 208.
6643. gbvrt209.seq - Other vertebrate sequence entries, part 209.
6644. gbvrt21.seq - Other vertebrate sequence entries, part 21.
6645. gbvrt210.seq - Other vertebrate sequence entries, part 210.
6646. gbvrt211.seq - Other vertebrate sequence entries, part 211.
6647. gbvrt212.seq - Other vertebrate sequence entries, part 212.
6648. gbvrt213.seq - Other vertebrate sequence entries, part 213.
6649. gbvrt214.seq - Other vertebrate sequence entries, part 214.
6650. gbvrt215.seq - Other vertebrate sequence entries, part 215.
6651. gbvrt216.seq - Other vertebrate sequence entries, part 216.
6652. gbvrt217.seq - Other vertebrate sequence entries, part 217.
6653. gbvrt218.seq - Other vertebrate sequence entries, part 218.
6654. gbvrt219.seq - Other vertebrate sequence entries, part 219.
6655. gbvrt22.seq - Other vertebrate sequence entries, part 22.
6656. gbvrt220.seq - Other vertebrate sequence entries, part 220.
6657. gbvrt221.seq - Other vertebrate sequence entries, part 221.
6658. gbvrt222.seq - Other vertebrate sequence entries, part 222.
6659. gbvrt223.seq - Other vertebrate sequence entries, part 223.
6660. gbvrt224.seq - Other vertebrate sequence entries, part 224.
6661. gbvrt225.seq - Other vertebrate sequence entries, part 225.
6662. gbvrt226.seq - Other vertebrate sequence entries, part 226.
6663. gbvrt227.seq - Other vertebrate sequence entries, part 227.
6664. gbvrt228.seq - Other vertebrate sequence entries, part 228.
6665. gbvrt229.seq - Other vertebrate sequence entries, part 229.
6666. gbvrt23.seq - Other vertebrate sequence entries, part 23.
6667. gbvrt230.seq - Other vertebrate sequence entries, part 230.
6668. gbvrt231.seq - Other vertebrate sequence entries, part 231.
6669. gbvrt232.seq - Other vertebrate sequence entries, part 232.
6670. gbvrt233.seq - Other vertebrate sequence entries, part 233.
6671. gbvrt234.seq - Other vertebrate sequence entries, part 234.
6672. gbvrt235.seq - Other vertebrate sequence entries, part 235.
6673. gbvrt236.seq - Other vertebrate sequence entries, part 236.
6674. gbvrt237.seq - Other vertebrate sequence entries, part 237.
6675. gbvrt238.seq - Other vertebrate sequence entries, part 238.
6676. gbvrt239.seq - Other vertebrate sequence entries, part 239.
6677. gbvrt24.seq - Other vertebrate sequence entries, part 24.
6678. gbvrt240.seq - Other vertebrate sequence entries, part 240.
6679. gbvrt241.seq - Other vertebrate sequence entries, part 241.
6680. gbvrt242.seq - Other vertebrate sequence entries, part 242.
6681. gbvrt243.seq - Other vertebrate sequence entries, part 243.
6682. gbvrt244.seq - Other vertebrate sequence entries, part 244.
6683. gbvrt245.seq - Other vertebrate sequence entries, part 245.
6684. gbvrt246.seq - Other vertebrate sequence entries, part 246.
6685. gbvrt247.seq - Other vertebrate sequence entries, part 247.
6686. gbvrt248.seq - Other vertebrate sequence entries, part 248.
6687. gbvrt249.seq - Other vertebrate sequence entries, part 249.
6688. gbvrt25.seq - Other vertebrate sequence entries, part 25.
6689. gbvrt250.seq - Other vertebrate sequence entries, part 250.
6690. gbvrt251.seq - Other vertebrate sequence entries, part 251.
6691. gbvrt252.seq - Other vertebrate sequence entries, part 252.
6692. gbvrt253.seq - Other vertebrate sequence entries, part 253.
6693. gbvrt254.seq - Other vertebrate sequence entries, part 254.
6694. gbvrt255.seq - Other vertebrate sequence entries, part 255.
6695. gbvrt256.seq - Other vertebrate sequence entries, part 256.
6696. gbvrt257.seq - Other vertebrate sequence entries, part 257.
6697. gbvrt258.seq - Other vertebrate sequence entries, part 258.
6698. gbvrt259.seq - Other vertebrate sequence entries, part 259.
6699. gbvrt26.seq - Other vertebrate sequence entries, part 26.
6700. gbvrt260.seq - Other vertebrate sequence entries, part 260.
6701. gbvrt261.seq - Other vertebrate sequence entries, part 261.
6702. gbvrt262.seq - Other vertebrate sequence entries, part 262.
6703. gbvrt263.seq - Other vertebrate sequence entries, part 263.
6704. gbvrt264.seq - Other vertebrate sequence entries, part 264.
6705. gbvrt265.seq - Other vertebrate sequence entries, part 265.
6706. gbvrt266.seq - Other vertebrate sequence entries, part 266.
6707. gbvrt267.seq - Other vertebrate sequence entries, part 267.
6708. gbvrt268.seq - Other vertebrate sequence entries, part 268.
6709. gbvrt269.seq - Other vertebrate sequence entries, part 269.
6710. gbvrt27.seq - Other vertebrate sequence entries, part 27.
6711. gbvrt270.seq - Other vertebrate sequence entries, part 270.
6712. gbvrt271.seq - Other vertebrate sequence entries, part 271.
6713. gbvrt272.seq - Other vertebrate sequence entries, part 272.
6714. gbvrt273.seq - Other vertebrate sequence entries, part 273.
6715. gbvrt274.seq - Other vertebrate sequence entries, part 274.
6716. gbvrt275.seq - Other vertebrate sequence entries, part 275.
6717. gbvrt276.seq - Other vertebrate sequence entries, part 276.
6718. gbvrt277.seq - Other vertebrate sequence entries, part 277.
6719. gbvrt278.seq - Other vertebrate sequence entries, part 278.
6720. gbvrt279.seq - Other vertebrate sequence entries, part 279.
6721. gbvrt28.seq - Other vertebrate sequence entries, part 28.
6722. gbvrt280.seq - Other vertebrate sequence entries, part 280.
6723. gbvrt281.seq - Other vertebrate sequence entries, part 281.
6724. gbvrt282.seq - Other vertebrate sequence entries, part 282.
6725. gbvrt283.seq - Other vertebrate sequence entries, part 283.
6726. gbvrt284.seq - Other vertebrate sequence entries, part 284.
6727. gbvrt285.seq - Other vertebrate sequence entries, part 285.
6728. gbvrt286.seq - Other vertebrate sequence entries, part 286.
6729. gbvrt287.seq - Other vertebrate sequence entries, part 287.
6730. gbvrt288.seq - Other vertebrate sequence entries, part 288.
6731. gbvrt289.seq - Other vertebrate sequence entries, part 289.
6732. gbvrt29.seq - Other vertebrate sequence entries, part 29.
6733. gbvrt290.seq - Other vertebrate sequence entries, part 290.
6734. gbvrt291.seq - Other vertebrate sequence entries, part 291.
6735. gbvrt292.seq - Other vertebrate sequence entries, part 292.
6736. gbvrt293.seq - Other vertebrate sequence entries, part 293.
6737. gbvrt294.seq - Other vertebrate sequence entries, part 294.
6738. gbvrt295.seq - Other vertebrate sequence entries, part 295.
6739. gbvrt296.seq - Other vertebrate sequence entries, part 296.
6740. gbvrt297.seq - Other vertebrate sequence entries, part 297.
6741. gbvrt298.seq - Other vertebrate sequence entries, part 298.
6742. gbvrt299.seq - Other vertebrate sequence entries, part 299.
6743. gbvrt3.seq - Other vertebrate sequence entries, part 3.
6744. gbvrt30.seq - Other vertebrate sequence entries, part 30.
6745. gbvrt300.seq - Other vertebrate sequence entries, part 300.
6746. gbvrt301.seq - Other vertebrate sequence entries, part 301.
6747. gbvrt302.seq - Other vertebrate sequence entries, part 302.
6748. gbvrt303.seq - Other vertebrate sequence entries, part 303.
6749. gbvrt304.seq - Other vertebrate sequence entries, part 304.
6750. gbvrt305.seq - Other vertebrate sequence entries, part 305.
6751. gbvrt306.seq - Other vertebrate sequence entries, part 306.
6752. gbvrt307.seq - Other vertebrate sequence entries, part 307.
6753. gbvrt308.seq - Other vertebrate sequence entries, part 308.
6754. gbvrt309.seq - Other vertebrate sequence entries, part 309.
6755. gbvrt31.seq - Other vertebrate sequence entries, part 31.
6756. gbvrt310.seq - Other vertebrate sequence entries, part 310.
6757. gbvrt311.seq - Other vertebrate sequence entries, part 311.
6758. gbvrt312.seq - Other vertebrate sequence entries, part 312.
6759. gbvrt313.seq - Other vertebrate sequence entries, part 313.
6760. gbvrt314.seq - Other vertebrate sequence entries, part 314.
6761. gbvrt315.seq - Other vertebrate sequence entries, part 315.
6762. gbvrt316.seq - Other vertebrate sequence entries, part 316.
6763. gbvrt317.seq - Other vertebrate sequence entries, part 317.
6764. gbvrt318.seq - Other vertebrate sequence entries, part 318.
6765. gbvrt319.seq - Other vertebrate sequence entries, part 319.
6766. gbvrt32.seq - Other vertebrate sequence entries, part 32.
6767. gbvrt320.seq - Other vertebrate sequence entries, part 320.
6768. gbvrt321.seq - Other vertebrate sequence entries, part 321.
6769. gbvrt322.seq - Other vertebrate sequence entries, part 322.
6770. gbvrt323.seq - Other vertebrate sequence entries, part 323.
6771. gbvrt324.seq - Other vertebrate sequence entries, part 324.
6772. gbvrt325.seq - Other vertebrate sequence entries, part 325.
6773. gbvrt326.seq - Other vertebrate sequence entries, part 326.
6774. gbvrt327.seq - Other vertebrate sequence entries, part 327.
6775. gbvrt328.seq - Other vertebrate sequence entries, part 328.
6776. gbvrt329.seq - Other vertebrate sequence entries, part 329.
6777. gbvrt33.seq - Other vertebrate sequence entries, part 33.
6778. gbvrt330.seq - Other vertebrate sequence entries, part 330.
6779. gbvrt331.seq - Other vertebrate sequence entries, part 331.
6780. gbvrt332.seq - Other vertebrate sequence entries, part 332.
6781. gbvrt333.seq - Other vertebrate sequence entries, part 333.
6782. gbvrt334.seq - Other vertebrate sequence entries, part 334.
6783. gbvrt335.seq - Other vertebrate sequence entries, part 335.
6784. gbvrt336.seq - Other vertebrate sequence entries, part 336.
6785. gbvrt337.seq - Other vertebrate sequence entries, part 337.
6786. gbvrt338.seq - Other vertebrate sequence entries, part 338.
6787. gbvrt339.seq - Other vertebrate sequence entries, part 339.
6788. gbvrt34.seq - Other vertebrate sequence entries, part 34.
6789. gbvrt340.seq - Other vertebrate sequence entries, part 340.
6790. gbvrt341.seq - Other vertebrate sequence entries, part 341.
6791. gbvrt342.seq - Other vertebrate sequence entries, part 342.
6792. gbvrt343.seq - Other vertebrate sequence entries, part 343.
6793. gbvrt344.seq - Other vertebrate sequence entries, part 344.
6794. gbvrt345.seq - Other vertebrate sequence entries, part 345.
6795. gbvrt346.seq - Other vertebrate sequence entries, part 346.
6796. gbvrt347.seq - Other vertebrate sequence entries, part 347.
6797. gbvrt348.seq - Other vertebrate sequence entries, part 348.
6798. gbvrt349.seq - Other vertebrate sequence entries, part 349.
6799. gbvrt35.seq - Other vertebrate sequence entries, part 35.
6800. gbvrt350.seq - Other vertebrate sequence entries, part 350.
6801. gbvrt351.seq - Other vertebrate sequence entries, part 351.
6802. gbvrt352.seq - Other vertebrate sequence entries, part 352.
6803. gbvrt353.seq - Other vertebrate sequence entries, part 353.
6804. gbvrt354.seq - Other vertebrate sequence entries, part 354.
6805. gbvrt355.seq - Other vertebrate sequence entries, part 355.
6806. gbvrt356.seq - Other vertebrate sequence entries, part 356.
6807. gbvrt357.seq - Other vertebrate sequence entries, part 357.
6808. gbvrt36.seq - Other vertebrate sequence entries, part 36.
6809. gbvrt37.seq - Other vertebrate sequence entries, part 37.
6810. gbvrt38.seq - Other vertebrate sequence entries, part 38.
6811. gbvrt39.seq - Other vertebrate sequence entries, part 39.
6812. gbvrt4.seq - Other vertebrate sequence entries, part 4.
6813. gbvrt40.seq - Other vertebrate sequence entries, part 40.
6814. gbvrt41.seq - Other vertebrate sequence entries, part 41.
6815. gbvrt42.seq - Other vertebrate sequence entries, part 42.
6816. gbvrt43.seq - Other vertebrate sequence entries, part 43.
6817. gbvrt44.seq - Other vertebrate sequence entries, part 44.
6818. gbvrt45.seq - Other vertebrate sequence entries, part 45.
6819. gbvrt46.seq - Other vertebrate sequence entries, part 46.
6820. gbvrt47.seq - Other vertebrate sequence entries, part 47.
6821. gbvrt48.seq - Other vertebrate sequence entries, part 48.
6822. gbvrt49.seq - Other vertebrate sequence entries, part 49.
6823. gbvrt5.seq - Other vertebrate sequence entries, part 5.
6824. gbvrt50.seq - Other vertebrate sequence entries, part 50.
6825. gbvrt51.seq - Other vertebrate sequence entries, part 51.
6826. gbvrt52.seq - Other vertebrate sequence entries, part 52.
6827. gbvrt53.seq - Other vertebrate sequence entries, part 53.
6828. gbvrt54.seq - Other vertebrate sequence entries, part 54.
6829. gbvrt55.seq - Other vertebrate sequence entries, part 55.
6830. gbvrt56.seq - Other vertebrate sequence entries, part 56.
6831. gbvrt57.seq - Other vertebrate sequence entries, part 57.
6832. gbvrt58.seq - Other vertebrate sequence entries, part 58.
6833. gbvrt59.seq - Other vertebrate sequence entries, part 59.
6834. gbvrt6.seq - Other vertebrate sequence entries, part 6.
6835. gbvrt60.seq - Other vertebrate sequence entries, part 60.
6836. gbvrt61.seq - Other vertebrate sequence entries, part 61.
6837. gbvrt62.seq - Other vertebrate sequence entries, part 62.
6838. gbvrt63.seq - Other vertebrate sequence entries, part 63.
6839. gbvrt64.seq - Other vertebrate sequence entries, part 64.
6840. gbvrt65.seq - Other vertebrate sequence entries, part 65.
6841. gbvrt66.seq - Other vertebrate sequence entries, part 66.
6842. gbvrt67.seq - Other vertebrate sequence entries, part 67.
6843. gbvrt68.seq - Other vertebrate sequence entries, part 68.
6844. gbvrt69.seq - Other vertebrate sequence entries, part 69.
6845. gbvrt7.seq - Other vertebrate sequence entries, part 7.
6846. gbvrt70.seq - Other vertebrate sequence entries, part 70.
6847. gbvrt71.seq - Other vertebrate sequence entries, part 71.
6848. gbvrt72.seq - Other vertebrate sequence entries, part 72.
6849. gbvrt73.seq - Other vertebrate sequence entries, part 73.
6850. gbvrt74.seq - Other vertebrate sequence entries, part 74.
6851. gbvrt75.seq - Other vertebrate sequence entries, part 75.
6852. gbvrt76.seq - Other vertebrate sequence entries, part 76.
6853. gbvrt77.seq - Other vertebrate sequence entries, part 77.
6854. gbvrt78.seq - Other vertebrate sequence entries, part 78.
6855. gbvrt79.seq - Other vertebrate sequence entries, part 79.
6856. gbvrt8.seq - Other vertebrate sequence entries, part 8.
6857. gbvrt80.seq - Other vertebrate sequence entries, part 80.
6858. gbvrt81.seq - Other vertebrate sequence entries, part 81.
6859. gbvrt82.seq - Other vertebrate sequence entries, part 82.
6860. gbvrt83.seq - Other vertebrate sequence entries, part 83.
6861. gbvrt84.seq - Other vertebrate sequence entries, part 84.
6862. gbvrt85.seq - Other vertebrate sequence entries, part 85.
6863. gbvrt86.seq - Other vertebrate sequence entries, part 86.
6864. gbvrt87.seq - Other vertebrate sequence entries, part 87.
6865. gbvrt88.seq - Other vertebrate sequence entries, part 88.
6866. gbvrt89.seq - Other vertebrate sequence entries, part 89.
6867. gbvrt9.seq - Other vertebrate sequence entries, part 9.
6868. gbvrt90.seq - Other vertebrate sequence entries, part 90.
6869. gbvrt91.seq - Other vertebrate sequence entries, part 91.
6870. gbvrt92.seq - Other vertebrate sequence entries, part 92.
6871. gbvrt93.seq - Other vertebrate sequence entries, part 93.
6872. gbvrt94.seq - Other vertebrate sequence entries, part 94.
6873. gbvrt95.seq - Other vertebrate sequence entries, part 95.
6874. gbvrt96.seq - Other vertebrate sequence entries, part 96.
6875. gbvrt97.seq - Other vertebrate sequence entries, part 97.
6876. gbvrt98.seq - Other vertebrate sequence entries, part 98.
6877. gbvrt99.seq - Other vertebrate sequence entries, part 99.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 255.0 flatfiles require roughly 3184 GB, including the sequence files and the *.txt files.
The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
496231168 gbbct1.seq
494251980 gbbct10.seq
498963442 gbbct100.seq
488108603 gbbct101.seq
397950750 gbbct102.seq
498261614 gbbct103.seq
492775885 gbbct104.seq
495523592 gbbct105.seq
300972567 gbbct106.seq
491271704 gbbct107.seq
498541527 gbbct108.seq
498106214 gbbct109.seq
498490131 gbbct11.seq
92795132 gbbct110.seq
489628464 gbbct111.seq
499324230 gbbct112.seq
499931736 gbbct113.seq
389028534 gbbct114.seq
499874269 gbbct115.seq
499836580 gbbct116.seq
499886211 gbbct117.seq
499926763 gbbct118.seq
13835705 gbbct119.seq
497844475 gbbct12.seq
493589466 gbbct120.seq
494743924 gbbct121.seq
495417064 gbbct122.seq
491069782 gbbct123.seq
195549944 gbbct124.seq
494137325 gbbct125.seq
492532713 gbbct126.seq
493222696 gbbct127.seq
497234652 gbbct128.seq
99480571 gbbct129.seq
33498510 gbbct13.seq
499011110 gbbct130.seq
494100520 gbbct131.seq
498830214 gbbct132.seq
333294148 gbbct133.seq
490710401 gbbct134.seq
498618665 gbbct135.seq
488692929 gbbct136.seq
494287749 gbbct137.seq
18986455 gbbct138.seq
495984015 gbbct139.seq
487419646 gbbct14.seq
489083690 gbbct140.seq
487156705 gbbct141.seq
496236407 gbbct142.seq
497104631 gbbct143.seq
488626816 gbbct144.seq
425698526 gbbct145.seq
498287386 gbbct146.seq
489448267 gbbct147.seq
499735001 gbbct148.seq
461302578 gbbct149.seq
487741973 gbbct15.seq
495776236 gbbct150.seq
493829919 gbbct151.seq
491661245 gbbct152.seq
498685717 gbbct153.seq
499806228 gbbct154.seq
147979388 gbbct155.seq
497197642 gbbct156.seq
494838868 gbbct157.seq
493252149 gbbct158.seq
494938546 gbbct159.seq
494172994 gbbct16.seq
404787642 gbbct160.seq
489367719 gbbct161.seq
490447247 gbbct162.seq
488202089 gbbct163.seq
496590180 gbbct164.seq
499835633 gbbct165.seq
474459580 gbbct166.seq
497656213 gbbct167.seq
494967761 gbbct168.seq
496941681 gbbct169.seq
494426565 gbbct17.seq
490479873 gbbct170.seq
495542723 gbbct171.seq
490156879 gbbct172.seq
192990871 gbbct173.seq
494733452 gbbct174.seq
491514361 gbbct175.seq
499168756 gbbct176.seq
486267948 gbbct177.seq
497456534 gbbct178.seq
491062036 gbbct179.seq
128500932 gbbct18.seq
495175628 gbbct180.seq
498913498 gbbct181.seq
23086762 gbbct182.seq
493968493 gbbct183.seq
491061938 gbbct184.seq
494910867 gbbct185.seq
495985799 gbbct186.seq
204649716 gbbct187.seq
493675899 gbbct188.seq
491173639 gbbct189.seq
494541162 gbbct19.seq
499375502 gbbct190.seq
273476043 gbbct191.seq
495005792 gbbct192.seq
495932756 gbbct193.seq
489789976 gbbct194.seq
303707270 gbbct195.seq
499226200 gbbct196.seq
499996866 gbbct197.seq
495765195 gbbct198.seq
496021888 gbbct199.seq
496211469 gbbct2.seq
496123386 gbbct20.seq
78326746 gbbct200.seq
498036931 gbbct201.seq
499411211 gbbct202.seq
492695528 gbbct203.seq
498015765 gbbct204.seq
490659469 gbbct205.seq
223651035 gbbct206.seq
498767435 gbbct207.seq
497238743 gbbct208.seq
494572462 gbbct209.seq
490072401 gbbct21.seq
497330392 gbbct210.seq
275862694 gbbct211.seq
495095400 gbbct212.seq
495971821 gbbct213.seq
496465165 gbbct214.seq
499477177 gbbct215.seq
258503230 gbbct216.seq
499816819 gbbct217.seq
497425893 gbbct218.seq
497029407 gbbct219.seq
499143021 gbbct22.seq
497534357 gbbct220.seq
440229906 gbbct221.seq
499335068 gbbct222.seq
499194801 gbbct223.seq
491641917 gbbct224.seq
492379063 gbbct225.seq
499896235 gbbct226.seq
493328722 gbbct227.seq
411207278 gbbct228.seq
497109684 gbbct229.seq
147824787 gbbct23.seq
493797230 gbbct230.seq
496714946 gbbct231.seq
378276833 gbbct232.seq
484833375 gbbct233.seq
495933660 gbbct234.seq
496841588 gbbct235.seq
499799700 gbbct236.seq
241101614 gbbct237.seq
494551922 gbbct238.seq
490932398 gbbct239.seq
492480110 gbbct24.seq
491178264 gbbct240.seq
207236568 gbbct241.seq
493892730 gbbct242.seq
496233179 gbbct243.seq
499658512 gbbct244.seq
495112805 gbbct245.seq
184138816 gbbct246.seq
494063188 gbbct247.seq
488281790 gbbct248.seq
489824751 gbbct249.seq
490124725 gbbct25.seq
488530275 gbbct250.seq
157432032 gbbct251.seq
483160902 gbbct252.seq
493212872 gbbct253.seq
489922692 gbbct254.seq
495741984 gbbct255.seq
65305181 gbbct256.seq
492193975 gbbct257.seq
487559489 gbbct258.seq
492444546 gbbct259.seq
498215112 gbbct26.seq
467375865 gbbct260.seq
498159017 gbbct261.seq
490705586 gbbct262.seq
496101764 gbbct263.seq
494853071 gbbct264.seq
496630909 gbbct265.seq
145951585 gbbct266.seq
492036277 gbbct267.seq
498468936 gbbct268.seq
484960307 gbbct269.seq
492065480 gbbct27.seq
462509857 gbbct270.seq
497610334 gbbct271.seq
496248013 gbbct272.seq
496577439 gbbct273.seq
492200318 gbbct274.seq
79411871 gbbct275.seq
496061714 gbbct276.seq
492890776 gbbct277.seq
496405538 gbbct278.seq
492437155 gbbct279.seq
484403268 gbbct28.seq
491980814 gbbct280.seq
499779517 gbbct281.seq
493162864 gbbct282.seq
301876939 gbbct283.seq
491163407 gbbct284.seq
488410892 gbbct285.seq
499068841 gbbct286.seq
423342833 gbbct287.seq
497188760 gbbct288.seq
496648115 gbbct289.seq
60915698 gbbct29.seq
496913431 gbbct290.seq
469193847 gbbct291.seq
495339097 gbbct292.seq
499421355 gbbct293.seq
499643473 gbbct294.seq
499684801 gbbct295.seq
41768798 gbbct296.seq
496934169 gbbct297.seq
495160463 gbbct298.seq
499828705 gbbct299.seq
306956635 gbbct3.seq
490496969 gbbct30.seq
494345225 gbbct300.seq
96357788 gbbct301.seq
498905666 gbbct302.seq
490839627 gbbct303.seq
495726070 gbbct304.seq
488834247 gbbct305.seq
498497263 gbbct306.seq
491972158 gbbct307.seq
379872740 gbbct308.seq
489922851 gbbct309.seq
493807118 gbbct31.seq
490787280 gbbct310.seq
493826685 gbbct311.seq
499495303 gbbct312.seq
419419915 gbbct313.seq
493089434 gbbct314.seq
494093373 gbbct315.seq
489966741 gbbct316.seq
493459402 gbbct317.seq
449948014 gbbct318.seq
498703691 gbbct319.seq
480651846 gbbct32.seq
497743953 gbbct320.seq
489574821 gbbct321.seq
495982538 gbbct322.seq
498393188 gbbct323.seq
23849985 gbbct324.seq
498785675 gbbct325.seq
497116300 gbbct326.seq
497441848 gbbct327.seq
497888944 gbbct328.seq
404381496 gbbct329.seq
497455838 gbbct33.seq
491217193 gbbct330.seq
490815802 gbbct331.seq
491231605 gbbct332.seq
495603062 gbbct333.seq
499559330 gbbct334.seq
172565080 gbbct335.seq
495562425 gbbct336.seq
494438770 gbbct337.seq
495091432 gbbct338.seq
498263581 gbbct339.seq
156444887 gbbct34.seq
263588539 gbbct340.seq
498444518 gbbct341.seq
488346394 gbbct342.seq
490825772 gbbct343.seq
490001722 gbbct344.seq
498583905 gbbct345.seq
34513818 gbbct346.seq
494290507 gbbct347.seq
495630215 gbbct348.seq
490121977 gbbct349.seq
489377654 gbbct35.seq
493908636 gbbct350.seq
497270006 gbbct351.seq
499423404 gbbct352.seq
492661875 gbbct353.seq
315247322 gbbct354.seq
499432889 gbbct355.seq
496212576 gbbct356.seq
498764257 gbbct357.seq
493797425 gbbct358.seq
494403890 gbbct359.seq
495704547 gbbct36.seq
495987097 gbbct360.seq
283727179 gbbct361.seq
493830711 gbbct362.seq
499921346 gbbct363.seq
490339070 gbbct364.seq
494485661 gbbct365.seq
438606992 gbbct366.seq
499660237 gbbct367.seq
499503191 gbbct368.seq
480042565 gbbct369.seq
490609435 gbbct37.seq
497026793 gbbct370.seq
494534754 gbbct371.seq
499546320 gbbct372.seq
498187647 gbbct373.seq
35006477 gbbct374.seq
488618104 gbbct375.seq
499584041 gbbct376.seq
499869850 gbbct377.seq
499277670 gbbct378.seq
227268532 gbbct379.seq
495848151 gbbct38.seq
498252616 gbbct380.seq
490199157 gbbct381.seq
491454197 gbbct382.seq
499237446 gbbct383.seq
169554493 gbbct384.seq
497759841 gbbct385.seq
496982352 gbbct386.seq
498637351 gbbct387.seq
496711697 gbbct388.seq
494470537 gbbct389.seq
315409825 gbbct39.seq
497718998 gbbct390.seq
499215801 gbbct391.seq
6068780 gbbct392.seq
497028059 gbbct393.seq
489398082 gbbct394.seq
486980634 gbbct395.seq
490129819 gbbct396.seq
492334481 gbbct397.seq
491937068 gbbct398.seq
460743397 gbbct399.seq
394612573 gbbct4.seq
494751853 gbbct40.seq
489741626 gbbct400.seq
489855451 gbbct401.seq
487046951 gbbct402.seq
487809474 gbbct403.seq
489424692 gbbct404.seq
285123552 gbbct405.seq
496006126 gbbct406.seq
495676568 gbbct407.seq
497183157 gbbct408.seq
495130760 gbbct409.seq
499340934 gbbct41.seq
497895956 gbbct410.seq
498338255 gbbct411.seq
135630960 gbbct412.seq
499085706 gbbct413.seq
493285380 gbbct414.seq
498290604 gbbct415.seq
494015827 gbbct416.seq
498705663 gbbct417.seq
498946698 gbbct418.seq
492971210 gbbct419.seq
494710091 gbbct42.seq
73544299 gbbct420.seq
497624050 gbbct421.seq
499092538 gbbct422.seq
495168504 gbbct423.seq
498411623 gbbct424.seq
494851599 gbbct425.seq
97103164 gbbct426.seq
484011186 gbbct427.seq
499765651 gbbct428.seq
496608341 gbbct429.seq
468381998 gbbct43.seq
492466550 gbbct430.seq
492815902 gbbct431.seq
499135070 gbbct432.seq
497268003 gbbct433.seq
495502235 gbbct434.seq
495882578 gbbct435.seq
278806486 gbbct436.seq
495477408 gbbct437.seq
488018478 gbbct438.seq
495948735 gbbct439.seq
499427339 gbbct44.seq
499573089 gbbct440.seq
376550284 gbbct441.seq
492341455 gbbct442.seq
496407771 gbbct443.seq
493158602 gbbct444.seq
488758804 gbbct445.seq
164173209 gbbct446.seq
494159514 gbbct447.seq
494444974 gbbct448.seq
493700863 gbbct449.seq
489001589 gbbct45.seq
499969675 gbbct450.seq
27014882 gbbct451.seq
493433738 gbbct452.seq
492700729 gbbct453.seq
497334211 gbbct454.seq
497146734 gbbct455.seq
497594285 gbbct456.seq
328581930 gbbct457.seq
498313481 gbbct458.seq
498681342 gbbct459.seq
493929875 gbbct46.seq
499281114 gbbct460.seq
489146172 gbbct461.seq
496938154 gbbct462.seq
497700245 gbbct463.seq
326142728 gbbct464.seq
497824572 gbbct465.seq
494208947 gbbct466.seq
493182743 gbbct467.seq
494255642 gbbct468.seq
86825163 gbbct469.seq
496597276 gbbct47.seq
485664252 gbbct470.seq
492762413 gbbct471.seq
493976820 gbbct472.seq
498624920 gbbct473.seq
495051074 gbbct474.seq
483776187 gbbct475.seq
492628986 gbbct476.seq
497575580 gbbct477.seq
491147927 gbbct478.seq
495372480 gbbct479.seq
497389487 gbbct48.seq
172098631 gbbct480.seq
488399361 gbbct481.seq
497609771 gbbct482.seq
493602123 gbbct483.seq
499477169 gbbct484.seq
490837891 gbbct485.seq
457708752 gbbct486.seq
494383928 gbbct487.seq
493402330 gbbct488.seq
495774412 gbbct489.seq
229137973 gbbct49.seq
498340162 gbbct490.seq
207101524 gbbct491.seq
498888146 gbbct492.seq
497119456 gbbct493.seq
495529246 gbbct494.seq
488783758 gbbct495.seq
29360100 gbbct496.seq
499644869 gbbct497.seq
497721086 gbbct498.seq
499705912 gbbct499.seq
440879202 gbbct5.seq
21422937 gbbct50.seq
497292785 gbbct500.seq
147178693 gbbct501.seq
490781428 gbbct502.seq
491825412 gbbct503.seq
497965024 gbbct504.seq
493465752 gbbct505.seq
495756445 gbbct506.seq
489030593 gbbct507.seq
324241257 gbbct508.seq
496815387 gbbct509.seq
38665432 gbbct51.seq
489218910 gbbct510.seq
496959977 gbbct511.seq
499518254 gbbct512.seq
495983473 gbbct513.seq
490026626 gbbct514.seq
493847968 gbbct515.seq
20072397 gbbct516.seq
496504166 gbbct517.seq
494196865 gbbct518.seq
491425834 gbbct519.seq
499529301 gbbct52.seq
493795133 gbbct520.seq
120147859 gbbct521.seq
495729566 gbbct522.seq
499951839 gbbct523.seq
491684752 gbbct524.seq
493977412 gbbct525.seq
156474296 gbbct526.seq
489613743 gbbct527.seq
496013526 gbbct528.seq
493634181 gbbct529.seq
484404405 gbbct53.seq
490519109 gbbct530.seq
495495700 gbbct531.seq
495938176 gbbct532.seq
499820654 gbbct533.seq
167664955 gbbct534.seq
490091495 gbbct535.seq
489093193 gbbct536.seq
498249511 gbbct537.seq
491840902 gbbct538.seq
499254538 gbbct539.seq
495470153 gbbct54.seq
282904129 gbbct540.seq
498599992 gbbct541.seq
499966912 gbbct542.seq
498301065 gbbct543.seq
495968907 gbbct544.seq
494387593 gbbct545.seq
168582861 gbbct546.seq
493113630 gbbct547.seq
498039044 gbbct548.seq
496856871 gbbct549.seq
480119600 gbbct55.seq
498627879 gbbct550.seq
496408566 gbbct551.seq
493203112 gbbct552.seq
200087934 gbbct553.seq
489360452 gbbct554.seq
496232132 gbbct555.seq
499644022 gbbct556.seq
499053517 gbbct557.seq
344398916 gbbct558.seq
497056676 gbbct559.seq
497462846 gbbct56.seq
498846279 gbbct560.seq
493179162 gbbct561.seq
496827136 gbbct562.seq
496170253 gbbct563.seq
430243436 gbbct564.seq
499932651 gbbct565.seq
492753771 gbbct566.seq
490407067 gbbct567.seq
497293274 gbbct568.seq
496005405 gbbct569.seq
491185015 gbbct57.seq
65191689 gbbct570.seq
491480368 gbbct571.seq
498016828 gbbct572.seq
496801881 gbbct573.seq
499998011 gbbct574.seq
492895223 gbbct575.seq
84038456 gbbct576.seq
498299128 gbbct577.seq
497665413 gbbct578.seq
495788990 gbbct579.seq
489161809 gbbct58.seq
488271521 gbbct580.seq
490232308 gbbct581.seq
496367213 gbbct582.seq
277932409 gbbct583.seq
499291931 gbbct584.seq
496184725 gbbct585.seq
497683783 gbbct586.seq
495556267 gbbct587.seq
498411913 gbbct588.seq
316924727 gbbct589.seq
497807623 gbbct59.seq
494981973 gbbct590.seq
498821993 gbbct591.seq
496302740 gbbct592.seq
498679305 gbbct593.seq
495063429 gbbct594.seq
494556626 gbbct595.seq
333820396 gbbct596.seq
491952337 gbbct597.seq
489654826 gbbct598.seq
491054702 gbbct599.seq
102229098 gbbct6.seq
498887697 gbbct60.seq
497706434 gbbct600.seq
496583924 gbbct601.seq
433905257 gbbct602.seq
496057863 gbbct603.seq
497615194 gbbct604.seq
499072165 gbbct605.seq
495270905 gbbct606.seq
288449281 gbbct607.seq
494009509 gbbct608.seq
494634341 gbbct609.seq
301819154 gbbct61.seq
493680575 gbbct610.seq
495249560 gbbct611.seq
336973590 gbbct612.seq
489923355 gbbct613.seq
496078994 gbbct614.seq
489866756 gbbct615.seq
491095822 gbbct616.seq
494996804 gbbct617.seq
490953063 gbbct618.seq
490294926 gbbct619.seq
496358999 gbbct62.seq
97589066 gbbct620.seq
494539289 gbbct621.seq
499651126 gbbct622.seq
499706018 gbbct623.seq
492279746 gbbct624.seq
495041088 gbbct625.seq
498690364 gbbct626.seq
343354425 gbbct627.seq
495613924 gbbct628.seq
499638486 gbbct629.seq
491310643 gbbct63.seq
497662636 gbbct630.seq
499056657 gbbct631.seq
490556366 gbbct632.seq
172222174 gbbct633.seq
489896711 gbbct634.seq
496817146 gbbct635.seq
499135525 gbbct636.seq
498163061 gbbct637.seq
51855972 gbbct638.seq
498990372 gbbct639.seq
499896861 gbbct64.seq
499059047 gbbct640.seq
489679022 gbbct641.seq
496827195 gbbct642.seq
146996930 gbbct643.seq
497325381 gbbct644.seq
494763519 gbbct645.seq
490601484 gbbct646.seq
499623027 gbbct647.seq
425912676 gbbct648.seq
494999630 gbbct649.seq
492176815 gbbct65.seq
499490044 gbbct650.seq
499133952 gbbct651.seq
492174780 gbbct652.seq
59927786 gbbct653.seq
492648965 gbbct654.seq
490980127 gbbct655.seq
489246348 gbbct656.seq
494834519 gbbct657.seq
420406296 gbbct658.seq
499345536 gbbct659.seq
495817495 gbbct66.seq
491652349 gbbct660.seq
492805360 gbbct661.seq
491180673 gbbct662.seq
248977229 gbbct663.seq
498700861 gbbct664.seq
499543065 gbbct665.seq
494841481 gbbct666.seq
494347345 gbbct667.seq
496624512 gbbct668.seq
328372586 gbbct669.seq
356563216 gbbct67.seq
498573429 gbbct670.seq
497874492 gbbct671.seq
488404550 gbbct672.seq
494091530 gbbct673.seq
428215516 gbbct674.seq
495687860 gbbct675.seq
499894727 gbbct676.seq
495926565 gbbct677.seq
490536807 gbbct678.seq
499953682 gbbct679.seq
499974757 gbbct68.seq
496711584 gbbct680.seq
488365493 gbbct681.seq
75456970 gbbct682.seq
489500479 gbbct683.seq
499400864 gbbct684.seq
497154681 gbbct685.seq
491680324 gbbct686.seq
497888039 gbbct687.seq
111474896 gbbct688.seq
489374489 gbbct689.seq
492293295 gbbct69.seq
497451108 gbbct690.seq
496646071 gbbct691.seq
493494360 gbbct692.seq
374432608 gbbct693.seq
497698356 gbbct694.seq
488772771 gbbct695.seq
489764539 gbbct696.seq
496352055 gbbct697.seq
498313353 gbbct698.seq
498674974 gbbct699.seq
282572021 gbbct7.seq
489450326 gbbct70.seq
16940854 gbbct700.seq
499130286 gbbct701.seq
496018987 gbbct702.seq
494876442 gbbct703.seq
498112926 gbbct704.seq
167262843 gbbct705.seq
495669275 gbbct706.seq
496736764 gbbct707.seq
497827402 gbbct708.seq
491235709 gbbct709.seq
497371624 gbbct71.seq
265602948 gbbct710.seq
489238459 gbbct711.seq
493640511 gbbct712.seq
492372448 gbbct713.seq
495568595 gbbct714.seq
498771085 gbbct715.seq
493758068 gbbct716.seq
109374504 gbbct717.seq
491645336 gbbct718.seq
498239909 gbbct719.seq
499930534 gbbct72.seq
498917468 gbbct720.seq
495338869 gbbct721.seq
499756906 gbbct722.seq
357528203 gbbct723.seq
497164384 gbbct724.seq
479171509 gbbct725.seq
496853252 gbbct726.seq
496520809 gbbct727.seq
499174574 gbbct728.seq
489351136 gbbct729.seq
495180622 gbbct73.seq
117291749 gbbct730.seq
493214296 gbbct731.seq
497755111 gbbct732.seq
494063566 gbbct733.seq
495660266 gbbct734.seq
488401809 gbbct735.seq
219306649 gbbct736.seq
492979265 gbbct737.seq
494702554 gbbct738.seq
499963185 gbbct739.seq
112142536 gbbct74.seq
497878063 gbbct740.seq
491150070 gbbct741.seq
498547121 gbbct742.seq
60891567 gbbct743.seq
495368280 gbbct744.seq
497577471 gbbct745.seq
494740078 gbbct746.seq
497053738 gbbct747.seq
499816559 gbbct748.seq
329322798 gbbct749.seq
498097262 gbbct75.seq
495797081 gbbct750.seq
495112135 gbbct751.seq
493988105 gbbct752.seq
494859610 gbbct753.seq
492113463 gbbct754.seq
499556629 gbbct755.seq
61946538 gbbct756.seq
492290882 gbbct757.seq
498176684 gbbct758.seq
486522057 gbbct759.seq
499071354 gbbct76.seq
491750941 gbbct760.seq
498188167 gbbct761.seq
358598425 gbbct762.seq
488237036 gbbct763.seq
497952741 gbbct764.seq
498608451 gbbct765.seq
491625434 gbbct766.seq
22350641 gbbct767.seq
487958129 gbbct768.seq
497133299 gbbct769.seq
496564068 gbbct77.seq
490428503 gbbct770.seq
492471713 gbbct771.seq
73505571 gbbct772.seq
495181148 gbbct773.seq
499983744 gbbct774.seq
499992164 gbbct775.seq
497620055 gbbct776.seq
118340553 gbbct777.seq
495637220 gbbct778.seq
490456958 gbbct779.seq
497567986 gbbct78.seq
498245985 gbbct780.seq
492331379 gbbct781.seq
252822532 gbbct782.seq
489979001 gbbct783.seq
494617963 gbbct784.seq
495850754 gbbct785.seq
492527743 gbbct786.seq
187572837 gbbct787.seq
483790949 gbbct788.seq
499813374 gbbct789.seq
499752675 gbbct79.seq
498748366 gbbct790.seq
494410227 gbbct791.seq
167539987 gbbct792.seq
495800676 gbbct793.seq
490713525 gbbct794.seq
493587854 gbbct795.seq
495133214 gbbct796.seq
499530083 gbbct797.seq
210020414 gbbct798.seq
485015917 gbbct799.seq
493056974 gbbct8.seq
490382166 gbbct80.seq
495072799 gbbct800.seq
493273422 gbbct801.seq
499779324 gbbct802.seq
457214314 gbbct803.seq
489975982 gbbct804.seq
498547386 gbbct805.seq
499313792 gbbct806.seq
494671329 gbbct807.seq
481827999 gbbct808.seq
493392289 gbbct809.seq
257413040 gbbct81.seq
493377549 gbbct810.seq
487418881 gbbct811.seq
491394070 gbbct812.seq
174913291 gbbct813.seq
495800385 gbbct814.seq
496852778 gbbct815.seq
492002345 gbbct816.seq
494736214 gbbct817.seq
292279380 gbbct818.seq
499674247 gbbct819.seq
499969487 gbbct82.seq
488102834 gbbct820.seq
499177495 gbbct821.seq
492223406 gbbct822.seq
208445972 gbbct823.seq
496474540 gbbct824.seq
495270200 gbbct825.seq
496892512 gbbct826.seq
498716785 gbbct827.seq
64492607 gbbct828.seq
492634175 gbbct829.seq
495193976 gbbct83.seq
497829577 gbbct830.seq
499637417 gbbct831.seq
491573001 gbbct832.seq
72854158 gbbct833.seq
497385481 gbbct834.seq
499713614 gbbct835.seq
496600511 gbbct836.seq
494585864 gbbct837.seq
495486738 gbbct838.seq
494880443 gbbct839.seq
486287671 gbbct84.seq
409082805 gbbct840.seq
305795466 gbbct841.seq
6890459 gbbct842.seq
14163390 gbbct843.seq
22793554 gbbct844.seq
44488053 gbbct845.seq
86606813 gbbct846.seq
168482899 gbbct847.seq
499999189 gbbct848.seq
492567480 gbbct849.seq
493211142 gbbct85.seq
499518461 gbbct850.seq
499991061 gbbct851.seq
498143942 gbbct852.seq
499998524 gbbct853.seq
131022662 gbbct854.seq
499999164 gbbct855.seq
492642285 gbbct856.seq
492636999 gbbct857.seq
499957777 gbbct858.seq
208731793 gbbct859.seq
464468094 gbbct86.seq
499998626 gbbct860.seq
290418464 gbbct861.seq
499996998 gbbct862.seq
85270089 gbbct863.seq
499963650 gbbct864.seq
125211667 gbbct865.seq
499998104 gbbct866.seq
43500527 gbbct867.seq
148305016 gbbct868.seq
492062983 gbbct869.seq
490192791 gbbct87.seq
496959030 gbbct870.seq
91325445 gbbct871.seq
497083364 gbbct872.seq
489917348 gbbct873.seq
494007567 gbbct874.seq
497933106 gbbct875.seq
497254622 gbbct876.seq
488464409 gbbct877.seq
305471125 gbbct878.seq
495496652 gbbct879.seq
489868611 gbbct88.seq
498006188 gbbct880.seq
498178053 gbbct881.seq
168612703 gbbct882.seq
472461256 gbbct883.seq
498353077 gbbct884.seq
494354808 gbbct885.seq
496897053 gbbct886.seq
150527797 gbbct887.seq
487524044 gbbct888.seq
499385071 gbbct889.seq
497985073 gbbct89.seq
499022760 gbbct890.seq
267916234 gbbct891.seq
498499361 gbbct892.seq
497461802 gbbct893.seq
480796819 gbbct894.seq
497715134 gbbct895.seq
50153913 gbbct896.seq
496306943 gbbct897.seq
497542056 gbbct898.seq
499038770 gbbct899.seq
493341809 gbbct9.seq
498936947 gbbct90.seq
243471318 gbbct900.seq
492627254 gbbct901.seq
496920861 gbbct902.seq
498726004 gbbct903.seq
498558094 gbbct904.seq
105681493 gbbct905.seq
499379807 gbbct906.seq
499045535 gbbct907.seq
496138201 gbbct908.seq
480916960 gbbct909.seq
306897241 gbbct91.seq
51239505 gbbct910.seq
107865706 gbbct911.seq
499999390 gbbct912.seq
499998728 gbbct913.seq
417656230 gbbct914.seq
499998440 gbbct915.seq
498882408 gbbct916.seq
499997969 gbbct917.seq
495781743 gbbct918.seq
348562697 gbbct919.seq
491474485 gbbct92.seq
498037042 gbbct920.seq
488004987 gbbct921.seq
499037415 gbbct922.seq
495294846 gbbct923.seq
495698372 gbbct924.seq
490397691 gbbct925.seq
162744757 gbbct926.seq
498338738 gbbct927.seq
498433840 gbbct928.seq
495474042 gbbct929.seq
494310549 gbbct93.seq
497231915 gbbct930.seq
122463869 gbbct931.seq
499023842 gbbct932.seq
489325804 gbbct933.seq
498625583 gbbct934.seq
489618672 gbbct935.seq
499997780 gbbct936.seq
79158397 gbbct937.seq
495814627 gbbct94.seq
498718686 gbbct95.seq
499103802 gbbct96.seq
261686725 gbbct97.seq
498131286 gbbct98.seq
499519597 gbbct99.seq
2744700 gbchg.txt
499822055 gbcon1.seq
499936780 gbcon10.seq
499997939 gbcon100.seq
266679352 gbcon101.seq
499999207 gbcon102.seq
499999760 gbcon103.seq
169651221 gbcon104.seq
498619715 gbcon105.seq
497622218 gbcon106.seq
499996912 gbcon107.seq
499957642 gbcon108.seq
298259760 gbcon109.seq
498641836 gbcon11.seq
499974110 gbcon110.seq
499998492 gbcon111.seq
301832536 gbcon112.seq
499998485 gbcon113.seq
499999425 gbcon114.seq
132525864 gbcon115.seq
499854148 gbcon116.seq
499999639 gbcon117.seq
499836704 gbcon118.seq
277072431 gbcon119.seq
499918621 gbcon12.seq
499999876 gbcon120.seq
499999395 gbcon121.seq
222253215 gbcon122.seq
45836617 gbcon123.seq
499997550 gbcon124.seq
499997048 gbcon125.seq
447038623 gbcon126.seq
499998645 gbcon127.seq
499998907 gbcon128.seq
499997576 gbcon129.seq
498804924 gbcon13.seq
195923220 gbcon130.seq
499995599 gbcon131.seq
499999036 gbcon132.seq
238748401 gbcon133.seq
499999517 gbcon134.seq
467648640 gbcon135.seq
499998711 gbcon136.seq
499998953 gbcon137.seq
260268367 gbcon138.seq
499999886 gbcon139.seq
498718931 gbcon14.seq
499999247 gbcon140.seq
498207713 gbcon141.seq
499999536 gbcon142.seq
499996334 gbcon143.seq
179609408 gbcon144.seq
499998259 gbcon145.seq
499998534 gbcon146.seq
23267891 gbcon147.seq
499895508 gbcon148.seq
499998608 gbcon149.seq
497489318 gbcon15.seq
410312685 gbcon150.seq
499990000 gbcon151.seq
499984769 gbcon152.seq
378760506 gbcon153.seq
499995981 gbcon154.seq
499995750 gbcon155.seq
265279867 gbcon156.seq
499999808 gbcon157.seq
499998096 gbcon158.seq
78092623 gbcon159.seq
170068320 gbcon16.seq
500000141 gbcon160.seq
499765495 gbcon161.seq
499997753 gbcon162.seq
143068669 gbcon163.seq
499889851 gbcon164.seq
499989134 gbcon165.seq
499985012 gbcon166.seq
336382811 gbcon167.seq
499997937 gbcon168.seq
499999333 gbcon169.seq
494951546 gbcon17.seq
188471741 gbcon170.seq
499998956 gbcon171.seq
499999672 gbcon172.seq
499999538 gbcon173.seq
271922024 gbcon174.seq
499999711 gbcon175.seq
499998667 gbcon176.seq
499614792 gbcon177.seq
499997938 gbcon178.seq
146641660 gbcon179.seq
498724990 gbcon18.seq
499999870 gbcon180.seq
499997467 gbcon181.seq
135137207 gbcon182.seq
499997676 gbcon183.seq
499996990 gbcon184.seq
499999297 gbcon185.seq
299155059 gbcon186.seq
499996511 gbcon187.seq
499995094 gbcon188.seq
474632479 gbcon189.seq
497063036 gbcon19.seq
499997792 gbcon190.seq
499997308 gbcon191.seq
380651166 gbcon192.seq
499914217 gbcon193.seq
499999252 gbcon194.seq
499993655 gbcon195.seq
139298938 gbcon196.seq
499998392 gbcon197.seq
499997881 gbcon198.seq
38637152 gbcon199.seq
499999513 gbcon2.seq
498478436 gbcon20.seq
499998672 gbcon200.seq
499998964 gbcon201.seq
499991855 gbcon202.seq
499999336 gbcon203.seq
499993734 gbcon204.seq
277678959 gbcon205.seq
499999940 gbcon206.seq
484917287 gbcon207.seq
499989750 gbcon208.seq
499922342 gbcon209.seq
483591570 gbcon21.seq
499996461 gbcon210.seq
4070436 gbcon211.seq
499999703 gbcon212.seq
499999223 gbcon213.seq
499998505 gbcon214.seq
13882960 gbcon215.seq
499819848 gbcon216.seq
499976545 gbcon217.seq
499998549 gbcon218.seq
276951509 gbcon219.seq
499998788 gbcon22.seq
499898553 gbcon220.seq
499856643 gbcon221.seq
499991808 gbcon222.seq
290882757 gbcon223.seq
499887467 gbcon224.seq
499999255 gbcon225.seq
499685282 gbcon226.seq
345759611 gbcon227.seq
499678868 gbcon228.seq
499918621 gbcon229.seq
499998935 gbcon23.seq
499998721 gbcon230.seq
149584141 gbcon231.seq
499755037 gbcon232.seq
499999155 gbcon233.seq
499996999 gbcon234.seq
481777100 gbcon235.seq
499999534 gbcon24.seq
84517707 gbcon25.seq
499999901 gbcon26.seq
499494513 gbcon27.seq
498850599 gbcon28.seq
318196954 gbcon29.seq
499992923 gbcon3.seq
499998397 gbcon30.seq
135784709 gbcon31.seq
126581536 gbcon32.seq
499918920 gbcon33.seq
499998468 gbcon34.seq
27859502 gbcon35.seq
499999414 gbcon36.seq
499998297 gbcon37.seq
444067663 gbcon38.seq
499999754 gbcon39.seq
106579732 gbcon4.seq
499996186 gbcon40.seq
499996876 gbcon41.seq
43314086 gbcon42.seq
499997302 gbcon43.seq
499996762 gbcon44.seq
278164332 gbcon45.seq
499999359 gbcon46.seq
499996983 gbcon47.seq
271759840 gbcon48.seq
499993774 gbcon49.seq
499940282 gbcon5.seq
499997972 gbcon50.seq
386626626 gbcon51.seq
499998746 gbcon52.seq
499998567 gbcon53.seq
177827600 gbcon54.seq
499999775 gbcon55.seq
499998019 gbcon56.seq
240103744 gbcon57.seq
499999949 gbcon58.seq
499999067 gbcon59.seq
494454587 gbcon6.seq
337031547 gbcon60.seq
499998864 gbcon61.seq
499994811 gbcon62.seq
299682797 gbcon63.seq
500000005 gbcon64.seq
499997545 gbcon65.seq
261117917 gbcon66.seq
499995467 gbcon67.seq
499999403 gbcon68.seq
188551188 gbcon69.seq
494751662 gbcon7.seq
499996910 gbcon70.seq
499996842 gbcon71.seq
365761631 gbcon72.seq
499997884 gbcon73.seq
499996070 gbcon74.seq
387269601 gbcon75.seq
499993101 gbcon76.seq
473419617 gbcon77.seq
174082386 gbcon78.seq
499962637 gbcon79.seq
499999375 gbcon8.seq
23946021 gbcon80.seq
499991546 gbcon81.seq
205225187 gbcon82.seq
199581426 gbcon83.seq
499973462 gbcon84.seq
499997159 gbcon85.seq
338361276 gbcon86.seq
499532057 gbcon87.seq
495874812 gbcon88.seq
499849773 gbcon89.seq
61944694 gbcon9.seq
205299811 gbcon90.seq
499984694 gbcon91.seq
499999487 gbcon92.seq
499467401 gbcon93.seq
167922790 gbcon94.seq
499999681 gbcon95.seq
499999194 gbcon96.seq
131842859 gbcon97.seq
499990588 gbcon98.seq
499997926 gbcon99.seq
153820 gbdel.txt
499998738 gbenv1.seq
489563294 gbenv10.seq
493535478 gbenv11.seq
497577758 gbenv12.seq
499998865 gbenv13.seq
234154107 gbenv14.seq
499999037 gbenv15.seq
499999142 gbenv16.seq
53917967 gbenv17.seq
500000010 gbenv18.seq
499999317 gbenv19.seq
499998480 gbenv2.seq
499998910 gbenv20.seq
499998163 gbenv21.seq
5213481 gbenv22.seq
499999725 gbenv23.seq
499999759 gbenv24.seq
190623249 gbenv25.seq
499980072 gbenv26.seq
499998915 gbenv27.seq
499997996 gbenv28.seq
84235590 gbenv29.seq
451559950 gbenv3.seq
499998788 gbenv30.seq
499997559 gbenv31.seq
177741579 gbenv32.seq
499999650 gbenv33.seq
500000081 gbenv34.seq
499999378 gbenv35.seq
46464008 gbenv36.seq
500000181 gbenv37.seq
499998713 gbenv38.seq
192864335 gbenv39.seq
498295047 gbenv4.seq
499997503 gbenv40.seq
499999649 gbenv41.seq
334976079 gbenv42.seq
499998953 gbenv43.seq
499997555 gbenv44.seq
471531248 gbenv45.seq
499997654 gbenv46.seq
499998185 gbenv47.seq
338688534 gbenv48.seq
499999960 gbenv49.seq
497343821 gbenv5.seq
499999206 gbenv50.seq
394550720 gbenv51.seq
499999162 gbenv52.seq
499998358 gbenv53.seq
345569702 gbenv54.seq
499999518 gbenv55.seq
499998110 gbenv56.seq
237997470 gbenv57.seq
499999901 gbenv58.seq
499997482 gbenv59.seq
495389338 gbenv6.seq
391425898 gbenv60.seq
499998322 gbenv61.seq
499991843 gbenv62.seq
499999470 gbenv63.seq
144569470 gbenv64.seq
499997508 gbenv65.seq
499998818 gbenv66.seq
499999781 gbenv67.seq
222936134 gbenv68.seq
499997628 gbenv69.seq
499147378 gbenv7.seq
499979641 gbenv70.seq
314716785 gbenv71.seq
499957638 gbenv72.seq
499999290 gbenv73.seq
499945036 gbenv74.seq
498109775 gbenv75.seq
499999063 gbenv76.seq
169795562 gbenv77.seq
102354062 gbenv8.seq
497122399 gbenv9.seq
499999886 gbest1.seq
499999635 gbest10.seq
499997424 gbest100.seq
500000102 gbest101.seq
499997928 gbest102.seq
499999586 gbest103.seq
27058254 gbest104.seq
499996554 gbest105.seq
499997290 gbest106.seq
499999575 gbest107.seq
499999528 gbest108.seq
9862063 gbest109.seq
499997770 gbest11.seq
500000213 gbest110.seq
499997713 gbest111.seq
499998641 gbest112.seq
499999145 gbest113.seq
21766373 gbest114.seq
500000014 gbest115.seq
499999751 gbest116.seq
499996861 gbest117.seq
18205696 gbest118.seq
499998016 gbest119.seq
475347609 gbest12.seq
499998546 gbest120.seq
499997661 gbest121.seq
69242600 gbest122.seq
499997996 gbest123.seq
499996364 gbest124.seq
223780385 gbest125.seq
499997461 gbest126.seq
499998633 gbest127.seq
195307357 gbest128.seq
499997173 gbest129.seq
499999099 gbest13.seq
499998792 gbest130.seq
499995025 gbest131.seq
499996839 gbest132.seq
85321549 gbest133.seq
499999011 gbest134.seq
500000103 gbest135.seq
499997620 gbest136.seq
499998847 gbest137.seq
103557175 gbest138.seq
499999885 gbest139.seq
249985067 gbest14.seq
499996904 gbest140.seq
500000218 gbest141.seq
499998495 gbest142.seq
28439876 gbest143.seq
499998590 gbest144.seq
499995866 gbest145.seq
499996642 gbest146.seq
499997627 gbest147.seq
30830682 gbest148.seq
499998615 gbest149.seq
499998470 gbest15.seq
500000160 gbest150.seq
499997750 gbest151.seq
324374809 gbest152.seq
499997344 gbest153.seq
499999008 gbest154.seq
499996792 gbest155.seq
499998093 gbest156.seq
26483164 gbest157.seq
500000031 gbest158.seq
499999571 gbest159.seq
499998407 gbest16.seq
499998740 gbest160.seq
499999772 gbest161.seq
11191143 gbest162.seq
499999738 gbest163.seq
499999333 gbest164.seq
499999792 gbest165.seq
499998234 gbest166.seq
86376407 gbest167.seq
500000180 gbest168.seq
499996624 gbest169.seq
421197303 gbest17.seq
499997982 gbest170.seq
499996832 gbest171.seq
120388331 gbest172.seq
499998796 gbest173.seq
499999076 gbest174.seq
500000124 gbest175.seq
500000114 gbest176.seq
65991139 gbest177.seq
499999609 gbest178.seq
403619645 gbest179.seq
500000212 gbest18.seq
500000063 gbest180.seq
500000137 gbest181.seq
499998032 gbest182.seq
499996516 gbest183.seq
42970207 gbest184.seq
499999115 gbest185.seq
499997688 gbest186.seq
499998302 gbest187.seq
499999590 gbest188.seq
42185730 gbest189.seq
499997392 gbest19.seq
499998700 gbest190.seq
499999296 gbest191.seq
499999092 gbest192.seq
500000084 gbest193.seq
11591845 gbest194.seq
499996962 gbest195.seq
499998729 gbest196.seq
499997401 gbest197.seq
499998525 gbest198.seq
28665019 gbest199.seq
499997555 gbest2.seq
262827667 gbest20.seq
499998890 gbest200.seq
499999939 gbest201.seq
499999086 gbest202.seq
500000002 gbest203.seq
34243051 gbest204.seq
13610371 gbest205.seq
499997133 gbest206.seq
499998950 gbest207.seq
329518743 gbest208.seq
499997954 gbest209.seq
499995775 gbest21.seq
500000064 gbest210.seq
321738245 gbest211.seq
499999454 gbest212.seq
499997334 gbest213.seq
267676365 gbest214.seq
499997450 gbest215.seq
499999542 gbest216.seq
270148029 gbest217.seq
499996173 gbest218.seq
499998682 gbest219.seq
499998545 gbest22.seq
499996701 gbest220.seq
500000034 gbest221.seq
52041103 gbest222.seq
499999123 gbest223.seq
499996186 gbest224.seq
499998911 gbest225.seq
499997023 gbest226.seq
47688177 gbest227.seq
499998310 gbest228.seq
499999275 gbest229.seq
244441333 gbest23.seq
176584566 gbest230.seq
500000143 gbest231.seq
499999766 gbest232.seq
499999388 gbest233.seq
478350574 gbest234.seq
499997785 gbest235.seq
499999603 gbest236.seq
499997429 gbest237.seq
462328784 gbest238.seq
499999067 gbest239.seq
499997973 gbest24.seq
499999466 gbest240.seq
499999246 gbest241.seq
495323447 gbest242.seq
499999965 gbest243.seq
499998071 gbest244.seq
499999534 gbest245.seq
499997094 gbest246.seq
25247852 gbest247.seq
499999885 gbest248.seq
499998834 gbest249.seq
500000249 gbest25.seq
497204590 gbest250.seq
499999018 gbest251.seq
499998363 gbest252.seq
499998003 gbest253.seq
499998663 gbest254.seq
21635727 gbest255.seq
499997327 gbest256.seq
499995735 gbest257.seq
499995987 gbest258.seq
499999920 gbest259.seq
499999489 gbest26.seq
76725347 gbest260.seq
499998298 gbest261.seq
499998862 gbest262.seq
499999795 gbest263.seq
499999748 gbest264.seq
15153140 gbest265.seq
499999709 gbest266.seq
499999528 gbest267.seq
499996240 gbest268.seq
499999976 gbest269.seq
500000205 gbest27.seq
61175538 gbest270.seq
499998700 gbest271.seq
499999812 gbest272.seq
499998613 gbest273.seq
122786557 gbest274.seq
499996420 gbest275.seq
499996347 gbest276.seq
499996697 gbest277.seq
499997998 gbest278.seq
54096018 gbest279.seq
49054642 gbest28.seq
499997300 gbest280.seq
499998093 gbest281.seq
499999161 gbest282.seq
499999370 gbest283.seq
57206038 gbest284.seq
499999206 gbest285.seq
499999297 gbest286.seq
499995779 gbest287.seq
499998776 gbest288.seq
12647131 gbest289.seq
499998393 gbest29.seq
500000262 gbest290.seq
499999019 gbest291.seq
499998375 gbest292.seq
499998356 gbest293.seq
25130664 gbest294.seq
499999905 gbest295.seq
499999169 gbest296.seq
485346130 gbest297.seq
499998242 gbest298.seq
499997484 gbest299.seq
499998861 gbest3.seq
499999804 gbest30.seq
499998758 gbest300.seq
499998362 gbest301.seq
5991711 gbest302.seq
500000028 gbest303.seq
499998191 gbest304.seq
499999698 gbest305.seq
499997534 gbest306.seq
8698825 gbest307.seq
499999082 gbest308.seq
499999747 gbest309.seq
499997642 gbest31.seq
499997747 gbest310.seq
425300390 gbest311.seq
499998617 gbest312.seq
499998547 gbest313.seq
499997281 gbest314.seq
499998682 gbest315.seq
2054700 gbest316.seq
499999089 gbest317.seq
499998027 gbest318.seq
469362314 gbest319.seq
487083596 gbest32.seq
499999477 gbest320.seq
499998262 gbest321.seq
499999719 gbest322.seq
499998371 gbest323.seq
40423642 gbest324.seq
499997688 gbest325.seq
499998667 gbest326.seq
499998240 gbest327.seq
494428850 gbest328.seq
499998307 gbest329.seq
499997462 gbest33.seq
499998827 gbest330.seq
499998018 gbest331.seq
499996913 gbest332.seq
57561412 gbest333.seq
500000164 gbest334.seq
500000124 gbest335.seq
499998630 gbest336.seq
469710586 gbest337.seq
499996848 gbest338.seq
499997496 gbest339.seq
499997137 gbest34.seq
499999839 gbest340.seq
499998210 gbest341.seq
19772602 gbest342.seq
499999924 gbest343.seq
492965228 gbest344.seq
499997344 gbest345.seq
499998393 gbest346.seq
500000034 gbest347.seq
500000073 gbest348.seq
7042931 gbest349.seq
499997824 gbest35.seq
499998252 gbest350.seq
499999811 gbest351.seq
499998096 gbest352.seq
445141787 gbest353.seq
499999670 gbest354.seq
499999568 gbest355.seq
500000244 gbest356.seq
385830792 gbest357.seq
499999372 gbest358.seq
499999677 gbest359.seq
465841411 gbest36.seq
500000261 gbest360.seq
499998192 gbest361.seq
23512019 gbest362.seq
499999898 gbest363.seq
499999146 gbest364.seq
499998699 gbest365.seq
500000175 gbest366.seq
60455485 gbest367.seq
166258344 gbest368.seq
500000179 gbest369.seq
500000209 gbest37.seq
499999522 gbest370.seq
499998109 gbest371.seq
500000025 gbest372.seq
87774641 gbest373.seq
499997252 gbest374.seq
499999865 gbest375.seq
499999625 gbest376.seq
499998195 gbest377.seq
167172696 gbest378.seq
499996810 gbest379.seq
499998451 gbest38.seq
499998009 gbest380.seq
499999556 gbest381.seq
499999566 gbest382.seq
155202666 gbest383.seq
499997530 gbest384.seq
499998520 gbest385.seq
499999295 gbest386.seq
496942011 gbest387.seq
499998244 gbest388.seq
499997393 gbest389.seq
499999976 gbest39.seq
499997868 gbest390.seq
68565600 gbest391.seq
499998199 gbest392.seq
499995697 gbest393.seq
499997473 gbest394.seq
499998850 gbest395.seq
84720974 gbest396.seq
499996726 gbest397.seq
499997638 gbest398.seq
499999194 gbest399.seq
434902865 gbest4.seq
499997651 gbest40.seq
499999980 gbest400.seq
88024158 gbest401.seq
499997789 gbest402.seq
499998566 gbest403.seq
499999548 gbest404.seq
499998233 gbest405.seq
49239860 gbest406.seq
499999872 gbest407.seq
499999311 gbest408.seq
499998914 gbest409.seq
191428295 gbest41.seq
499999031 gbest410.seq
89169665 gbest411.seq
499999602 gbest412.seq
499998388 gbest413.seq
499996769 gbest414.seq
499993591 gbest415.seq
124887049 gbest416.seq
499997121 gbest417.seq
328041859 gbest418.seq
499997537 gbest419.seq
499997364 gbest42.seq
499999392 gbest420.seq
499999368 gbest421.seq
499999290 gbest422.seq
60418424 gbest423.seq
499999712 gbest424.seq
499999639 gbest425.seq
499997596 gbest426.seq
410464048 gbest427.seq
499997260 gbest428.seq
499999283 gbest429.seq
499997237 gbest43.seq
335979604 gbest430.seq
499997520 gbest431.seq
500000055 gbest432.seq
261735757 gbest433.seq
499999142 gbest434.seq
499999639 gbest435.seq
456676576 gbest436.seq
499997677 gbest437.seq
499997592 gbest438.seq
305631978 gbest439.seq
499997245 gbest44.seq
499996212 gbest440.seq
499998106 gbest441.seq
336207493 gbest442.seq
499998798 gbest443.seq
499999337 gbest444.seq
188594473 gbest445.seq
499999759 gbest446.seq
499999483 gbest447.seq
121142819 gbest448.seq
499997938 gbest449.seq
499996431 gbest45.seq
499998378 gbest450.seq
144958145 gbest451.seq
499997877 gbest452.seq
499999922 gbest453.seq
146697887 gbest454.seq
499998626 gbest455.seq
499997991 gbest456.seq
499998447 gbest457.seq
499999530 gbest458.seq
619778 gbest459.seq
189558363 gbest46.seq
499999523 gbest460.seq
499997491 gbest461.seq
499998787 gbest462.seq
499998418 gbest463.seq
23481118 gbest464.seq
170019681 gbest465.seq
499998234 gbest466.seq
499997948 gbest467.seq
499998330 gbest468.seq
499998840 gbest469.seq
499999360 gbest47.seq
28589640 gbest470.seq
499999508 gbest471.seq
499999012 gbest472.seq
499999538 gbest473.seq
499999595 gbest474.seq
66478188 gbest475.seq
499997202 gbest476.seq
499997120 gbest477.seq
499997133 gbest478.seq
499996553 gbest479.seq
499998265 gbest48.seq
58819344 gbest480.seq
499997522 gbest481.seq
499997564 gbest482.seq
499997692 gbest483.seq
499998314 gbest484.seq
36875050 gbest485.seq
499997365 gbest486.seq
499997555 gbest487.seq
499999090 gbest488.seq
499999990 gbest489.seq
499997971 gbest49.seq
74693787 gbest490.seq
499999195 gbest491.seq
499999368 gbest492.seq
499998525 gbest493.seq
208394234 gbest494.seq
499996334 gbest495.seq
499999918 gbest496.seq
499998482 gbest497.seq
500000213 gbest498.seq
93340381 gbest499.seq
499999604 gbest5.seq
477020055 gbest50.seq
499998191 gbest500.seq
499999698 gbest501.seq
500000177 gbest502.seq
499994989 gbest503.seq
57588142 gbest504.seq
499995678 gbest505.seq
499998789 gbest506.seq
499992702 gbest507.seq
499999124 gbest508.seq
144017177 gbest509.seq
499999137 gbest51.seq
499998165 gbest510.seq
499996677 gbest511.seq
499997275 gbest512.seq
499999746 gbest513.seq
144811567 gbest514.seq
499998357 gbest515.seq
499999868 gbest516.seq
499998435 gbest517.seq
499999014 gbest518.seq
20677346 gbest519.seq
356399962 gbest52.seq
174271459 gbest520.seq
499998578 gbest521.seq
499998754 gbest522.seq
86430383 gbest523.seq
499998243 gbest524.seq
499999107 gbest525.seq
76884582 gbest526.seq
499999644 gbest527.seq
499999397 gbest528.seq
499997123 gbest529.seq
499999044 gbest53.seq
499996576 gbest530.seq
101183181 gbest531.seq
499998563 gbest532.seq
499999862 gbest533.seq
499998938 gbest534.seq
499997739 gbest535.seq
11156072 gbest536.seq
499998167 gbest537.seq
499999317 gbest538.seq
499999417 gbest539.seq
499999947 gbest54.seq
477043712 gbest540.seq
499999064 gbest541.seq
499999847 gbest542.seq
499998764 gbest543.seq
418278031 gbest544.seq
499999742 gbest545.seq
500000106 gbest546.seq
499999793 gbest547.seq
499998376 gbest548.seq
83233267 gbest549.seq
499997712 gbest55.seq
499999613 gbest550.seq
499999398 gbest551.seq
499999882 gbest552.seq
499997233 gbest553.seq
32975971 gbest554.seq
499996586 gbest555.seq
499997837 gbest556.seq
499997535 gbest557.seq
499999417 gbest558.seq
44533458 gbest559.seq
483687528 gbest56.seq
499996659 gbest560.seq
499997307 gbest561.seq
499999984 gbest562.seq
499999162 gbest563.seq
12018574 gbest564.seq
499999633 gbest565.seq
499999982 gbest566.seq
393272940 gbest567.seq
499999845 gbest568.seq
499999107 gbest569.seq
500000017 gbest57.seq
107293153 gbest570.seq
499998740 gbest571.seq
499998382 gbest572.seq
50523126 gbest573.seq
499999830 gbest574.seq
499997898 gbest575.seq
499999399 gbest576.seq
499998593 gbest577.seq
294338068 gbest578.seq
499999533 gbest58.seq
500000156 gbest59.seq
499998716 gbest6.seq
464399310 gbest60.seq
499997769 gbest61.seq
499998690 gbest62.seq
499998613 gbest63.seq
500000006 gbest64.seq
7795899 gbest65.seq
499997879 gbest66.seq
499997947 gbest67.seq
499999722 gbest68.seq
484302223 gbest69.seq
499996324 gbest7.seq
499999502 gbest70.seq
499998104 gbest71.seq
499998013 gbest72.seq
499999141 gbest73.seq
10082947 gbest74.seq
123413300 gbest75.seq
499999298 gbest76.seq
499998245 gbest77.seq
499998907 gbest78.seq
499999038 gbest79.seq
469442002 gbest8.seq
6590015 gbest80.seq
499998041 gbest81.seq
499997773 gbest82.seq
499998733 gbest83.seq
499998417 gbest84.seq
47018586 gbest85.seq
500000165 gbest86.seq
499999018 gbest87.seq
499996860 gbest88.seq
499998671 gbest89.seq
499998427 gbest9.seq
53783169 gbest90.seq
499998173 gbest91.seq
499999170 gbest92.seq
499997913 gbest93.seq
472228455 gbest94.seq
499998516 gbest95.seq
499998370 gbest96.seq
499997591 gbest97.seq
499890468 gbest98.seq
35244903 gbest99.seq
499999285 gbgss1.seq
55726731 gbgss10.seq
499997670 gbgss100.seq
45810173 gbgss101.seq
499998092 gbgss102.seq
499998065 gbgss103.seq
499997907 gbgss104.seq
468721568 gbgss105.seq
499997879 gbgss106.seq
499999105 gbgss107.seq
499998583 gbgss108.seq
499999879 gbgss109.seq
499999685 gbgss11.seq
42543282 gbgss110.seq
499997770 gbgss111.seq
499999226 gbgss112.seq
499999399 gbgss113.seq
319587306 gbgss114.seq
499999367 gbgss115.seq
499999051 gbgss116.seq
499997978 gbgss117.seq
500000209 gbgss118.seq
105483274 gbgss119.seq
499999265 gbgss12.seq
499997351 gbgss120.seq
499997815 gbgss121.seq
499997392 gbgss122.seq
499998819 gbgss123.seq
8930221 gbgss124.seq
499999907 gbgss125.seq
499998685 gbgss126.seq
499999539 gbgss127.seq
451766712 gbgss128.seq
499998345 gbgss129.seq
499999682 gbgss13.seq
499999211 gbgss130.seq
499997711 gbgss131.seq
499998622 gbgss132.seq
29785783 gbgss133.seq
499997877 gbgss134.seq
209679641 gbgss135.seq
500000110 gbgss136.seq
499999602 gbgss137.seq
499997969 gbgss138.seq
500000125 gbgss139.seq
499999062 gbgss14.seq
14831686 gbgss140.seq
499996726 gbgss141.seq
499997951 gbgss142.seq
499999528 gbgss143.seq
499997001 gbgss144.seq
16786266 gbgss145.seq
499997786 gbgss146.seq
499996974 gbgss147.seq
499999546 gbgss148.seq
499996547 gbgss149.seq
4919745 gbgss15.seq
2045398 gbgss150.seq
499997382 gbgss151.seq
499998165 gbgss152.seq
499998480 gbgss153.seq
499997367 gbgss154.seq
6835799 gbgss155.seq
373333029 gbgss156.seq
500000248 gbgss157.seq
499998076 gbgss158.seq
499998945 gbgss159.seq
499997800 gbgss16.seq
456471839 gbgss160.seq
499999836 gbgss161.seq
499999876 gbgss162.seq
499997705 gbgss163.seq
458288348 gbgss164.seq
499997998 gbgss165.seq
499999955 gbgss166.seq
499998714 gbgss167.seq
456858700 gbgss168.seq
499996207 gbgss169.seq
499999691 gbgss17.seq
499998104 gbgss170.seq
499998398 gbgss171.seq
364091904 gbgss172.seq
500000047 gbgss173.seq
499997174 gbgss174.seq
215800781 gbgss175.seq
500000172 gbgss176.seq
499997918 gbgss177.seq
68464120 gbgss178.seq
499999079 gbgss179.seq
500000078 gbgss18.seq
499999336 gbgss180.seq
499998518 gbgss181.seq
499999975 gbgss182.seq
49671428 gbgss183.seq
500000207 gbgss184.seq
499998668 gbgss185.seq
499998448 gbgss186.seq
500000134 gbgss187.seq
41156795 gbgss188.seq
499999015 gbgss189.seq
483120869 gbgss19.seq
499999977 gbgss190.seq
57632314 gbgss191.seq
499998791 gbgss192.seq
499996639 gbgss193.seq
499997685 gbgss194.seq
496087090 gbgss195.seq
499999000 gbgss196.seq
499999717 gbgss197.seq
499997473 gbgss198.seq
499997724 gbgss199.seq
499998406 gbgss2.seq
500000074 gbgss20.seq
55766098 gbgss200.seq
499998432 gbgss201.seq
499999372 gbgss202.seq
499999044 gbgss203.seq
480794721 gbgss204.seq
499999696 gbgss205.seq
499998040 gbgss206.seq
55217889 gbgss207.seq
499999671 gbgss208.seq
499999336 gbgss209.seq
326435210 gbgss21.seq
499999851 gbgss210.seq
483131912 gbgss211.seq
499997691 gbgss212.seq
499998553 gbgss213.seq
499999817 gbgss214.seq
487680353 gbgss215.seq
499998512 gbgss216.seq
499999622 gbgss217.seq
499998482 gbgss218.seq
475203494 gbgss219.seq
499996936 gbgss22.seq
499999842 gbgss220.seq
499997438 gbgss221.seq
499998669 gbgss222.seq
6150907 gbgss223.seq
499999723 gbgss224.seq
499999684 gbgss225.seq
499998774 gbgss226.seq
264586823 gbgss227.seq
499998669 gbgss228.seq
500000259 gbgss229.seq
499999113 gbgss23.seq
499998395 gbgss230.seq
429771848 gbgss231.seq
499998680 gbgss232.seq
499997883 gbgss233.seq
499999992 gbgss234.seq
471956638 gbgss235.seq
499999119 gbgss236.seq
500000046 gbgss237.seq
499997749 gbgss238.seq
419219562 gbgss239.seq
499998818 gbgss24.seq
499999020 gbgss240.seq
499999603 gbgss241.seq
500000129 gbgss242.seq
499997618 gbgss243.seq
18225276 gbgss244.seq
315572447 gbgss245.seq
499997744 gbgss246.seq
499999389 gbgss247.seq
499998492 gbgss248.seq
467298948 gbgss249.seq
499999064 gbgss25.seq
499998875 gbgss250.seq
499999602 gbgss251.seq
499999685 gbgss252.seq
499998436 gbgss253.seq
36127414 gbgss254.seq
499998608 gbgss255.seq
499999218 gbgss256.seq
499998113 gbgss257.seq
499998912 gbgss258.seq
22042461 gbgss259.seq
49836535 gbgss26.seq
499997682 gbgss260.seq
499999162 gbgss261.seq
499997831 gbgss262.seq
1933504 gbgss263.seq
500000132 gbgss264.seq
499998920 gbgss265.seq
499998061 gbgss266.seq
499491070 gbgss267.seq
499999723 gbgss268.seq
499998484 gbgss269.seq
499996335 gbgss27.seq
476820066 gbgss270.seq
499996842 gbgss28.seq
499996582 gbgss29.seq
499999721 gbgss3.seq
499999793 gbgss30.seq
31342385 gbgss31.seq
499998298 gbgss32.seq
499999440 gbgss33.seq
499999719 gbgss34.seq
475298509 gbgss35.seq
499997988 gbgss36.seq
499998016 gbgss37.seq
499999097 gbgss38.seq
499998525 gbgss39.seq
499999033 gbgss4.seq
12514272 gbgss40.seq
499998729 gbgss41.seq
499997515 gbgss42.seq
168546271 gbgss43.seq
499997525 gbgss44.seq
499997753 gbgss45.seq
499999140 gbgss46.seq
486883580 gbgss47.seq
499998195 gbgss48.seq
499997635 gbgss49.seq
41473958 gbgss5.seq
499997904 gbgss50.seq
443945964 gbgss51.seq
499998446 gbgss52.seq
500000163 gbgss53.seq
499998431 gbgss54.seq
421055741 gbgss55.seq
499998235 gbgss56.seq
499999740 gbgss57.seq
500000154 gbgss58.seq
427947401 gbgss59.seq
499999218 gbgss6.seq
67665344 gbgss60.seq
499997014 gbgss61.seq
499998970 gbgss62.seq
499999072 gbgss63.seq
492396804 gbgss64.seq
499999868 gbgss65.seq
499998563 gbgss66.seq
499998282 gbgss67.seq
499998811 gbgss68.seq
2280772 gbgss69.seq
499997502 gbgss7.seq
500000229 gbgss70.seq
499999619 gbgss71.seq
500000260 gbgss72.seq
419366282 gbgss73.seq
500000010 gbgss74.seq
499997041 gbgss75.seq
499997295 gbgss76.seq
34859199 gbgss77.seq
499997046 gbgss78.seq
499999706 gbgss79.seq
499998527 gbgss8.seq
499999172 gbgss80.seq
490143115 gbgss81.seq
499999721 gbgss82.seq
500000164 gbgss83.seq
499998945 gbgss84.seq
499998992 gbgss85.seq
4092019 gbgss86.seq
499998541 gbgss87.seq
499997719 gbgss88.seq
499999151 gbgss89.seq
499998470 gbgss9.seq
499996902 gbgss90.seq
34174279 gbgss91.seq
499998289 gbgss92.seq
499998886 gbgss93.seq
499998172 gbgss94.seq
465185709 gbgss95.seq
244248654 gbgss96.seq
499999492 gbgss97.seq
499998457 gbgss98.seq
500000176 gbgss99.seq
499999046 gbhtc1.seq
499988632 gbhtc2.seq
499995070 gbhtc3.seq
331480491 gbhtc4.seq
499997830 gbhtc5.seq
439766720 gbhtc6.seq
499998938 gbhtc7.seq
214286201 gbhtc8.seq
499949323 gbhtg1.seq
499980488 gbhtg10.seq
485100216 gbhtg11.seq
499977040 gbhtg12.seq
499847878 gbhtg13.seq
499963905 gbhtg14.seq
499701543 gbhtg15.seq
474637795 gbhtg16.seq
499709797 gbhtg17.seq
499810685 gbhtg18.seq
499965491 gbhtg19.seq
499847286 gbhtg2.seq
499990701 gbhtg20.seq
473198726 gbhtg21.seq
499919006 gbhtg22.seq
499967882 gbhtg23.seq
499100457 gbhtg24.seq
499962926 gbhtg25.seq
484453569 gbhtg26.seq
499959716 gbhtg27.seq
499868029 gbhtg28.seq
268058563 gbhtg29.seq
499869352 gbhtg3.seq
499922791 gbhtg30.seq
499807238 gbhtg31.seq
224934479 gbhtg32.seq
499945539 gbhtg33.seq
499927151 gbhtg34.seq
265477063 gbhtg35.seq
499867320 gbhtg36.seq
499972802 gbhtg37.seq
223152146 gbhtg38.seq
499806592 gbhtg39.seq
499846790 gbhtg4.seq
499974839 gbhtg40.seq
234952918 gbhtg41.seq
499825905 gbhtg42.seq
499886151 gbhtg43.seq
202125817 gbhtg44.seq
499805593 gbhtg45.seq
499927302 gbhtg46.seq
205797145 gbhtg47.seq
499976951 gbhtg48.seq
499932272 gbhtg49.seq
499934597 gbhtg5.seq
193865096 gbhtg50.seq
499927926 gbhtg51.seq
499933183 gbhtg52.seq
161356215 gbhtg53.seq
499991294 gbhtg54.seq
499991025 gbhtg55.seq
252731163 gbhtg56.seq
499944125 gbhtg57.seq
499990303 gbhtg58.seq
499843154 gbhtg59.seq
507366 gbhtg6.seq
167235083 gbhtg60.seq
499934810 gbhtg61.seq
499926029 gbhtg62.seq
499881302 gbhtg63.seq
468570824 gbhtg64.seq
499882387 gbhtg65.seq
499975194 gbhtg66.seq
499952537 gbhtg67.seq
499955759 gbhtg68.seq
499868574 gbhtg69.seq
499821927 gbhtg7.seq
417842665 gbhtg70.seq
499731470 gbhtg71.seq
499823072 gbhtg72.seq
385408676 gbhtg73.seq
499947980 gbhtg74.seq
499966538 gbhtg75.seq
383565105 gbhtg76.seq
499960780 gbhtg77.seq
499985181 gbhtg78.seq
499783878 gbhtg79.seq
499933840 gbhtg8.seq
499757763 gbhtg80.seq
499912988 gbhtg81.seq
307071595 gbhtg82.seq
499899726 gbhtg9.seq
499981672 gbinv1.seq
460975353 gbinv10.seq
498322008 gbinv100.seq
443778631 gbinv1000.se
437109989 gbinv1001.se
476924489 gbinv1002.se
491135272 gbinv1003.se
490968147 gbinv1004.se
346229865 gbinv1005.se
496167133 gbinv1006.se
491556009 gbinv1007.se
497588780 gbinv1008.se
487095100 gbinv1009.se
483551083 gbinv101.seq
487204794 gbinv1010.se
476212892 gbinv1011.se
485178369 gbinv1012.se
488737807 gbinv1013.se
156107032 gbinv1014.se
497392167 gbinv1015.se
482749954 gbinv1016.se
496261622 gbinv1017.se
494251519 gbinv1018.se
53213160 gbinv1019.se
444451735 gbinv102.seq
442918226 gbinv1020.se
496050726 gbinv1021.se
497897538 gbinv1022.se
481565834 gbinv1023.se
75736927 gbinv1024.se
496194879 gbinv1025.se
464036016 gbinv1026.se
428298459 gbinv1027.se
382943578 gbinv1028.se
379596877 gbinv1029.se
483770018 gbinv103.seq
342671608 gbinv1030.se
493967462 gbinv1031.se
478563134 gbinv1032.se
148303346 gbinv1033.se
480732928 gbinv1034.se
469448865 gbinv1035.se
488160790 gbinv1036.se
392890907 gbinv1037.se
481357065 gbinv1038.se
493413425 gbinv1039.se
493575936 gbinv104.seq
487451909 gbinv1040.se
394846711 gbinv1041.se
488239358 gbinv1042.se
483834908 gbinv1043.se
490561398 gbinv1044.se
316655906 gbinv1045.se
464946114 gbinv1046.se
492014258 gbinv1047.se
471770137 gbinv1048.se
461978252 gbinv1049.se
498159917 gbinv105.seq
379959406 gbinv1050.se
408768843 gbinv1051.se
472794533 gbinv1052.se
321062867 gbinv1053.se
353308729 gbinv1054.se
483874842 gbinv1055.se
484350001 gbinv1056.se
489067895 gbinv1057.se
329008329 gbinv1058.se
476668232 gbinv1059.se
461241055 gbinv106.seq
480994325 gbinv1060.se
495891814 gbinv1061.se
483360160 gbinv1062.se
132911965 gbinv1063.se
487210140 gbinv1064.se
448992266 gbinv1065.se
498695833 gbinv1066.se
444078900 gbinv1067.se
215956096 gbinv1068.se
487811170 gbinv1069.se
429126369 gbinv107.seq
482286892 gbinv1070.se
497441252 gbinv1071.se
467821328 gbinv1072.se
154246756 gbinv1073.se
466393483 gbinv1074.se
489416936 gbinv1075.se
498094362 gbinv1076.se
484048889 gbinv1077.se
107559872 gbinv1078.se
496101873 gbinv1079.se
472245770 gbinv108.seq
486677933 gbinv1080.se
491324260 gbinv1081.se
473165407 gbinv1082.se
140712569 gbinv1083.se
498375180 gbinv1084.se
479763923 gbinv1085.se
484976323 gbinv1086.se
482273285 gbinv1087.se
478828590 gbinv1088.se
491989005 gbinv1089.se
487388602 gbinv109.seq
447463190 gbinv1090.se
487986285 gbinv1091.se
346424265 gbinv1092.se
460874738 gbinv1093.se
470352434 gbinv1094.se
496569150 gbinv1095.se
495212210 gbinv1096.se
443889162 gbinv1097.se
496692637 gbinv1098.se
473301815 gbinv1099.se
400432368 gbinv11.seq
488621000 gbinv110.seq
493531126 gbinv1100.se
483258684 gbinv1101.se
403143105 gbinv1102.se
492287961 gbinv1103.se
492993389 gbinv1104.se
329034299 gbinv1105.se
461827784 gbinv1106.se
482686927 gbinv1107.se
99362650 gbinv1108.se
443724048 gbinv1109.se
492386442 gbinv111.seq
367763998 gbinv1110.se
353268604 gbinv1111.se
350260612 gbinv1112.se
341599132 gbinv1113.se
461028723 gbinv1114.se
495674250 gbinv1115.se
283813945 gbinv1116.se
495723890 gbinv1117.se
495292964 gbinv1118.se
476664181 gbinv1119.se
410012642 gbinv112.seq
446428554 gbinv1120.se
382810689 gbinv1121.se
448082904 gbinv1122.se
453192209 gbinv1123.se
484511115 gbinv1124.se
284284487 gbinv1125.se
476862131 gbinv1126.se
464518126 gbinv1127.se
496023268 gbinv1128.se
484057968 gbinv1129.se
489753782 gbinv113.seq
64752815 gbinv1130.se
453621523 gbinv1131.se
477654378 gbinv1132.se
484267949 gbinv1133.se
455437646 gbinv1134.se
89115533 gbinv1135.se
483404516 gbinv1136.se
390899518 gbinv1137.se
452325242 gbinv1138.se
384613513 gbinv1139.se
486907887 gbinv114.seq
229526122 gbinv1140.se
486921431 gbinv1141.se
496712223 gbinv1142.se
435108594 gbinv1143.se
287148864 gbinv1144.se
277496405 gbinv1145.se
488197542 gbinv1146.se
493608297 gbinv1147.se
489917099 gbinv1148.se
468604289 gbinv1149.se
475277294 gbinv115.seq
78075814 gbinv1150.se
463954346 gbinv1151.se
444065721 gbinv1152.se
463448466 gbinv1153.se
479934750 gbinv1154.se
498786146 gbinv1155.se
472901111 gbinv1156.se
163240230 gbinv1157.se
487102736 gbinv1158.se
492609813 gbinv1159.se
499301159 gbinv116.seq
481436962 gbinv1160.se
460938379 gbinv1161.se
478440248 gbinv1162.se
498750906 gbinv1163.se
164930006 gbinv1164.se
492943115 gbinv1165.se
490618893 gbinv1166.se
492915933 gbinv1167.se
480868563 gbinv1168.se
489548617 gbinv1169.se
356777678 gbinv117.seq
493048930 gbinv1170.se
481728938 gbinv1171.se
491050133 gbinv1172.se
497816391 gbinv1173.se
349702792 gbinv1174.se
480059395 gbinv1175.se
384338991 gbinv1176.se
495415147 gbinv1177.se
494914864 gbinv1178.se
464264813 gbinv1179.se
461771503 gbinv118.seq
412697818 gbinv1180.se
493232928 gbinv1181.se
486605755 gbinv1182.se
476585175 gbinv1183.se
199064605 gbinv1184.se
490754089 gbinv1185.se
472244532 gbinv1186.se
489706010 gbinv1187.se
464236921 gbinv1188.se
467204993 gbinv1189.se
479426529 gbinv119.seq
499827123 gbinv1190.se
345613253 gbinv1191.se
483921508 gbinv1192.se
478586227 gbinv1193.se
94225785 gbinv1194.se
472428904 gbinv1195.se
497885447 gbinv1196.se
457902545 gbinv1197.se
498796484 gbinv1198.se
467125389 gbinv1199.se
497342665 gbinv12.seq
494640587 gbinv120.seq
497244361 gbinv1200.se
487538660 gbinv1201.se
499913920 gbinv1202.se
406549774 gbinv1203.se
430451685 gbinv1204.se
472260007 gbinv1205.se
475352175 gbinv1206.se
452223380 gbinv1207.se
497325130 gbinv1208.se
494398316 gbinv1209.se
328489973 gbinv121.seq
54910173 gbinv1210.se
492423538 gbinv1211.se
491678341 gbinv1212.se
467975788 gbinv1213.se
477888370 gbinv1214.se
439149787 gbinv1215.se
107820209 gbinv1216.se
491773954 gbinv1217.se
479110373 gbinv1218.se
496707613 gbinv1219.se
484117251 gbinv122.seq
498528229 gbinv1220.se
462735347 gbinv1221.se
402849455 gbinv1222.se
491032865 gbinv1223.se
476073140 gbinv1224.se
456931139 gbinv1225.se
478083309 gbinv1226.se
457571010 gbinv1227.se
490220501 gbinv1228.se
26121678 gbinv1229.se
499998217 gbinv123.seq
481108642 gbinv1230.se
343565210 gbinv1231.se
496752688 gbinv1232.se
480731694 gbinv1233.se
478492919 gbinv1234.se
487731779 gbinv1235.se
76362062 gbinv1236.se
436222895 gbinv1237.se
469121536 gbinv1238.se
488318181 gbinv1239.se
499998055 gbinv124.seq
457907158 gbinv1240.se
288589895 gbinv1241.se
413758380 gbinv1242.se
227750852 gbinv1243.se
499653408 gbinv1244.se
263948525 gbinv1245.se
490736102 gbinv1246.se
499126557 gbinv1247.se
490773865 gbinv1248.se
480867825 gbinv1249.se
116057199 gbinv125.seq
488870121 gbinv1250.se
158318713 gbinv1251.se
494916186 gbinv1252.se
471135774 gbinv1253.se
484279868 gbinv1254.se
469898457 gbinv1255.se
461055681 gbinv1256.se
273724334 gbinv1257.se
281877201 gbinv1258.se
479356622 gbinv1259.se
499996813 gbinv126.seq
463004773 gbinv1260.se
225686207 gbinv1261.se
489637921 gbinv1262.se
496465279 gbinv1263.se
484561817 gbinv1264.se
477308789 gbinv1265.se
258133115 gbinv1266.se
493072880 gbinv1267.se
490208988 gbinv1268.se
492809523 gbinv1269.se
499998221 gbinv127.seq
474012633 gbinv1270.se
200353570 gbinv1271.se
477986454 gbinv1272.se
491870466 gbinv1273.se
472046257 gbinv1274.se
484787948 gbinv1275.se
240176778 gbinv1276.se
481405748 gbinv1277.se
492731277 gbinv1278.se
480851291 gbinv1279.se
404629854 gbinv128.seq
381859195 gbinv1280.se
479236800 gbinv1281.se
489743792 gbinv1282.se
497574828 gbinv1283.se
381267248 gbinv1284.se
450448665 gbinv1285.se
484530441 gbinv1286.se
394299446 gbinv1287.se
425501799 gbinv1288.se
115618359 gbinv1289.se
499999264 gbinv129.seq
431451977 gbinv1290.se
498054878 gbinv1291.se
479298950 gbinv1292.se
467089340 gbinv1293.se
70651447 gbinv1294.se
278258267 gbinv1295.se
440773903 gbinv1296.se
470493499 gbinv1297.se
476778459 gbinv1298.se
486736873 gbinv1299.se
476460093 gbinv13.seq
499996814 gbinv130.seq
223420398 gbinv1300.se
471322661 gbinv1301.se
489692789 gbinv1302.se
493687885 gbinv1303.se
389895514 gbinv1304.se
489637158 gbinv1305.se
35793777 gbinv1306.se
115154320 gbinv1307.se
615537581 gbinv1308.se
272202298 gbinv1309.se
181483765 gbinv131.seq
480149302 gbinv1310.se
476834871 gbinv1311.se
477105553 gbinv1312.se
491640835 gbinv1313.se
403386359 gbinv1314.se
297511488 gbinv1315.se
400332784 gbinv1316.se
498823027 gbinv1317.se
483203009 gbinv1318.se
482735960 gbinv1319.se
499998333 gbinv132.seq
489718628 gbinv1320.se
494917649 gbinv1321.se
464038534 gbinv1322.se
489339776 gbinv1323.se
491072844 gbinv1324.se
485393366 gbinv1325.se
485744132 gbinv1326.se
436679593 gbinv1327.se
104870652 gbinv1328.se
487890253 gbinv1329.se
499998910 gbinv133.seq
491469693 gbinv1330.se
492207810 gbinv1331.se
277662520 gbinv1332.se
465038797 gbinv1333.se
484906173 gbinv1334.se
455274642 gbinv1335.se
319919307 gbinv1336.se
441284320 gbinv1337.se
415113809 gbinv1338.se
401299897 gbinv1339.se
124678839 gbinv134.seq
395865604 gbinv1340.se
258909090 gbinv1341.se
514655388 gbinv1342.se
393855324 gbinv1343.se
492709181 gbinv1344.se
187722486 gbinv1345.se
316437995 gbinv1346.se
404935920 gbinv1347.se
377535768 gbinv1348.se
357065535 gbinv1349.se
499997177 gbinv135.seq
306211988 gbinv1350.se
475517285 gbinv1351.se
487075677 gbinv1352.se
416387225 gbinv1353.se
134695954 gbinv1354.se
430211421 gbinv1355.se
468408575 gbinv1356.se
436825552 gbinv1357.se
499430139 gbinv1358.se
151862240 gbinv1359.se
499997252 gbinv136.seq
462552718 gbinv1360.se
491611432 gbinv1361.se
498143107 gbinv1362.se
338205053 gbinv1363.se
497160898 gbinv1364.se
493529280 gbinv1365.se
490583969 gbinv1366.se
296798816 gbinv1367.se
327269135 gbinv1368.se
374578168 gbinv1369.se
151130184 gbinv137.seq
464846984 gbinv1370.se
483112113 gbinv1371.se
134997033 gbinv1372.se
435630019 gbinv1373.se
484610659 gbinv1374.se
421495202 gbinv1375.se
397549582 gbinv1376.se
481528936 gbinv1377.se
458589607 gbinv1378.se
472513592 gbinv1379.se
499996598 gbinv138.seq
304993911 gbinv1380.se
499998919 gbinv139.seq
422534063 gbinv14.seq
154681852 gbinv140.seq
499996912 gbinv141.seq
499997387 gbinv142.seq
189041206 gbinv143.seq
499997554 gbinv144.seq
499997866 gbinv145.seq
245809243 gbinv146.seq
499997602 gbinv147.seq
499997821 gbinv148.seq
499999890 gbinv149.seq
173964304 gbinv15.seq
499998825 gbinv150.seq
128489776 gbinv151.seq
499999374 gbinv152.seq
455573372 gbinv153.seq
289058569 gbinv154.seq
54983087 gbinv155.seq
52942591 gbinv156.seq
157078400 gbinv157.seq
499999147 gbinv158.seq
268190266 gbinv159.seq
490451259 gbinv16.seq
499996088 gbinv160.seq
499997883 gbinv161.seq
182060786 gbinv162.seq
499192390 gbinv163.seq
499771501 gbinv164.seq
498733787 gbinv165.seq
135327866 gbinv166.seq
496659575 gbinv167.seq
51960557 gbinv168.seq
466568666 gbinv169.seq
491062219 gbinv17.seq
479577598 gbinv170.seq
450560283 gbinv171.seq
482003105 gbinv172.seq
121049467 gbinv173.seq
494590358 gbinv174.seq
499152073 gbinv175.seq
498729814 gbinv176.seq
491950300 gbinv177.seq
483597478 gbinv178.seq
493910409 gbinv179.seq
470215242 gbinv18.seq
305143352 gbinv180.seq
453012499 gbinv181.seq
480839037 gbinv182.seq
375796220 gbinv183.seq
499933662 gbinv184.seq
485464339 gbinv185.seq
485283938 gbinv186.seq
498294953 gbinv187.seq
414580638 gbinv188.seq
498679440 gbinv189.seq
485523455 gbinv19.seq
495007238 gbinv190.seq
486086193 gbinv191.seq
483986740 gbinv192.seq
479016567 gbinv193.seq
377180280 gbinv194.seq
491313703 gbinv195.seq
482991950 gbinv196.seq
495169229 gbinv197.seq
493741890 gbinv198.seq
495500028 gbinv199.seq
456904893 gbinv2.seq
174159504 gbinv20.seq
371035005 gbinv200.seq
470293000 gbinv201.seq
496253081 gbinv202.seq
496289838 gbinv203.seq
472378022 gbinv204.seq
493444357 gbinv205.seq
418569182 gbinv206.seq
493158119 gbinv207.seq
491119641 gbinv208.seq
465656312 gbinv209.seq
486730694 gbinv21.seq
490891118 gbinv210.seq
459581775 gbinv211.seq
406078142 gbinv212.seq
476900813 gbinv213.seq
481848691 gbinv214.seq
496747706 gbinv215.seq
492742184 gbinv216.seq
496271174 gbinv217.seq
392139815 gbinv218.seq
496951694 gbinv219.seq
495353494 gbinv22.seq
492317100 gbinv220.seq
475961856 gbinv221.seq
498252048 gbinv222.seq
496664764 gbinv223.seq
351267284 gbinv224.seq
454438248 gbinv225.seq
490109816 gbinv226.seq
477836082 gbinv227.seq
497117087 gbinv228.seq
273421111 gbinv229.seq
471931517 gbinv23.seq
484546259 gbinv230.seq
486198248 gbinv231.seq
489013669 gbinv232.seq
499892182 gbinv233.seq
389960712 gbinv234.seq
230763287 gbinv235.seq
433765668 gbinv236.seq
341801067 gbinv237.seq
488714019 gbinv238.seq
442228068 gbinv239.seq
486628934 gbinv24.seq
498587747 gbinv240.seq
499228128 gbinv241.seq
194389053 gbinv242.seq
499998262 gbinv243.seq
499997440 gbinv244.seq
395685018 gbinv245.seq
499997358 gbinv246.seq
499998172 gbinv247.seq
232847057 gbinv248.seq
500000027 gbinv249.seq
497114880 gbinv25.seq
499999067 gbinv250.seq
284959631 gbinv251.seq
499998408 gbinv252.seq
499992137 gbinv253.seq
377189556 gbinv254.seq
499998617 gbinv255.seq
500000045 gbinv256.seq
499633766 gbinv257.seq
499887654 gbinv258.seq
325903599 gbinv259.seq
488719896 gbinv26.seq
499999353 gbinv260.seq
499954513 gbinv261.seq
394312187 gbinv262.seq
499998973 gbinv263.seq
499768151 gbinv264.seq
499935390 gbinv265.seq
262394318 gbinv266.seq
499489044 gbinv267.seq
499984461 gbinv268.seq
499999178 gbinv269.seq
319196831 gbinv27.seq
219010924 gbinv270.seq
499665286 gbinv271.seq
499954794 gbinv272.seq
499986274 gbinv273.seq
349517342 gbinv274.seq
500000137 gbinv275.seq
499979428 gbinv276.seq
499915813 gbinv277.seq
499990759 gbinv278.seq
499998437 gbinv279.seq
305989097 gbinv28.seq
7826534 gbinv280.seq
499999636 gbinv281.seq
499704487 gbinv282.seq
499897338 gbinv283.seq
499999895 gbinv284.seq
68002970 gbinv285.seq
499977802 gbinv286.seq
499904157 gbinv287.seq
499970007 gbinv288.seq
499999529 gbinv289.seq
499447601 gbinv29.seq
499940074 gbinv290.seq
122380920 gbinv291.seq
500000224 gbinv292.seq
499999552 gbinv293.seq
468683478 gbinv294.seq
499670167 gbinv295.seq
499934229 gbinv296.seq
499999149 gbinv297.seq
90103424 gbinv298.seq
500000110 gbinv299.seq
499998695 gbinv3.seq
331575178 gbinv30.seq
499999696 gbinv300.seq
477691968 gbinv301.seq
387812348 gbinv302.seq
481046566 gbinv303.seq
450037592 gbinv304.seq
303709120 gbinv305.seq
293451879 gbinv306.seq
280090292 gbinv307.seq
279807655 gbinv308.seq
274554291 gbinv309.seq
409329256 gbinv31.seq
266890013 gbinv310.seq
491295680 gbinv311.seq
418047621 gbinv312.seq
383074342 gbinv313.seq
489267216 gbinv314.seq
393039463 gbinv315.seq
484538449 gbinv316.seq
482310364 gbinv317.seq
491415359 gbinv318.seq
495004950 gbinv319.seq
337324220 gbinv32.seq
484038665 gbinv320.seq
495670320 gbinv321.seq
40846857 gbinv322.seq
492571202 gbinv323.seq
490206006 gbinv324.seq
445709424 gbinv325.seq
207302902 gbinv326.seq
370283947 gbinv327.seq
207800719 gbinv328.seq
403111025 gbinv329.seq
416902989 gbinv33.seq
496966573 gbinv330.seq
495208718 gbinv331.seq
486338081 gbinv332.seq
491887863 gbinv333.seq
62682558 gbinv334.seq
487684874 gbinv335.seq
495915356 gbinv336.seq
497117994 gbinv337.seq
485878834 gbinv338.seq
336958408 gbinv339.seq
480340526 gbinv34.seq
470338855 gbinv340.seq
473857916 gbinv341.seq
488417194 gbinv342.seq
472996654 gbinv343.seq
444602917 gbinv344.seq
489109149 gbinv345.seq
489050792 gbinv346.seq
492906245 gbinv347.seq
464574997 gbinv348.seq
389650543 gbinv349.seq
470719972 gbinv35.seq
499026266 gbinv350.seq
459754874 gbinv351.seq
457336249 gbinv352.seq
468059538 gbinv353.seq
487547225 gbinv354.seq
494629437 gbinv355.seq
499369066 gbinv356.seq
425866045 gbinv357.seq
447703471 gbinv358.seq
471358720 gbinv359.seq
478012779 gbinv36.seq
106488590 gbinv360.seq
494438067 gbinv361.seq
499096313 gbinv362.seq
174717833 gbinv363.seq
439432672 gbinv364.seq
315017082 gbinv365.seq
247279447 gbinv366.seq
493106968 gbinv367.seq
482399453 gbinv368.seq
487563600 gbinv369.seq
372274412 gbinv37.seq
495047837 gbinv370.seq
345419513 gbinv371.seq
499133273 gbinv372.seq
496482189 gbinv373.seq
369581646 gbinv374.seq
456145557 gbinv375.seq
200285196 gbinv376.seq
495154413 gbinv377.seq
341654330 gbinv378.seq
336683654 gbinv379.seq
473605830 gbinv38.seq
493060580 gbinv380.seq
107491235 gbinv381.seq
487938479 gbinv382.seq
495763049 gbinv383.seq
481723089 gbinv384.seq
326171717 gbinv385.seq
485891711 gbinv386.seq
492821648 gbinv387.seq
471307712 gbinv388.seq
311911756 gbinv389.seq
476844427 gbinv39.seq
499380148 gbinv390.seq
482084817 gbinv391.seq
479662419 gbinv392.seq
363343706 gbinv393.seq
489746713 gbinv394.seq
499514774 gbinv395.seq
496438512 gbinv396.seq
492580046 gbinv397.seq
486835968 gbinv398.seq
496615514 gbinv399.seq
499126309 gbinv4.seq
486980011 gbinv40.seq
482720635 gbinv400.seq
134241704 gbinv401.seq
493089306 gbinv402.seq
490891004 gbinv403.seq
498098866 gbinv404.seq
498391590 gbinv405.seq
493309439 gbinv406.seq
324291471 gbinv407.seq
484493924 gbinv408.seq
491069771 gbinv409.seq
160013874 gbinv41.seq
494055574 gbinv410.seq
235593723 gbinv411.seq
319983008 gbinv412.seq
484241023 gbinv413.seq
216170369 gbinv414.seq
218804026 gbinv415.seq
336455655 gbinv416.seq
297857601 gbinv417.seq
477593708 gbinv418.seq
493171167 gbinv419.seq
493935222 gbinv42.seq
96653657 gbinv420.seq
401450903 gbinv421.seq
471214414 gbinv422.seq
478230772 gbinv423.seq
481554780 gbinv424.seq
119372855 gbinv425.seq
489114034 gbinv426.seq
418974457 gbinv427.seq
492119058 gbinv428.seq
488068826 gbinv429.seq
422099764 gbinv43.seq
86400276 gbinv430.seq
475977385 gbinv431.seq
479046357 gbinv432.seq
91925882 gbinv433.seq
498866242 gbinv434.seq
475446584 gbinv435.seq
492109157 gbinv436.seq
493644048 gbinv437.seq
450867996 gbinv438.seq
491759397 gbinv439.seq
466237117 gbinv44.seq
84745739 gbinv440.seq
423732674 gbinv441.seq
344360076 gbinv442.seq
487664553 gbinv443.seq
481798385 gbinv444.seq
419437489 gbinv445.seq
447480354 gbinv446.seq
458542150 gbinv447.seq
84187054 gbinv448.seq
476248749 gbinv449.seq
491203127 gbinv45.seq
482272438 gbinv450.seq
498234741 gbinv451.seq
471043224 gbinv452.seq
136592520 gbinv453.seq
495120952 gbinv454.seq
498047113 gbinv455.seq
493290837 gbinv456.seq
467611431 gbinv457.seq
464868282 gbinv458.seq
485108715 gbinv459.seq
421696585 gbinv46.seq
70627368 gbinv460.seq
444909488 gbinv461.seq
457689916 gbinv462.seq
485382078 gbinv463.seq
496105931 gbinv464.seq
484291323 gbinv465.seq
248438586 gbinv466.seq
413526452 gbinv467.seq
438000207 gbinv468.seq
487748206 gbinv469.seq
418053457 gbinv47.seq
497322827 gbinv470.seq
171187065 gbinv471.seq
404122148 gbinv472.seq
358274008 gbinv473.seq
352555230 gbinv474.seq
335719715 gbinv475.seq
334992684 gbinv476.seq
323934868 gbinv477.seq
323397124 gbinv478.seq
292340545 gbinv479.seq
99367747 gbinv48.seq
497373639 gbinv480.seq
451425634 gbinv481.seq
352564218 gbinv482.seq
457737190 gbinv483.seq
480925976 gbinv484.seq
482363288 gbinv485.seq
490058774 gbinv486.seq
457330992 gbinv487.seq
213313220 gbinv488.seq
475683221 gbinv489.seq
474204665 gbinv49.seq
475722382 gbinv490.seq
474818912 gbinv491.seq
463886713 gbinv492.seq
174479470 gbinv493.seq
467301426 gbinv494.seq
487596983 gbinv495.seq
466523941 gbinv496.seq
473849332 gbinv497.seq
271533425 gbinv498.seq
474315468 gbinv499.seq
401163082 gbinv5.seq
499406905 gbinv50.seq
422684936 gbinv500.seq
403437207 gbinv501.seq
460401414 gbinv502.seq
495684114 gbinv503.seq
496920059 gbinv504.seq
255707629 gbinv505.seq
488417645 gbinv506.seq
493391118 gbinv507.seq
430648881 gbinv508.seq
483962961 gbinv509.seq
493277930 gbinv51.seq
482614063 gbinv510.seq
466924368 gbinv511.seq
153705523 gbinv512.seq
469807657 gbinv513.seq
497173372 gbinv514.seq
486068129 gbinv515.seq
497761269 gbinv516.seq
483774021 gbinv517.seq
208975227 gbinv518.seq
482561048 gbinv519.seq
319188821 gbinv52.seq
489387386 gbinv520.seq
174750473 gbinv521.seq
520668510 gbinv522.seq
439679373 gbinv523.seq
76608705 gbinv524.seq
544459581 gbinv525.seq
291577990 gbinv526.seq
499183813 gbinv527.seq
449457434 gbinv528.seq
403099826 gbinv529.seq
491655073 gbinv53.seq
426341523 gbinv530.seq
452289588 gbinv531.seq
332054885 gbinv532.seq
216067261 gbinv533.seq
363589773 gbinv534.seq
349108604 gbinv535.seq
466080734 gbinv536.seq
433540835 gbinv537.seq
325349387 gbinv538.seq
414135977 gbinv539.seq
492219703 gbinv54.seq
443362325 gbinv540.seq
458656169 gbinv541.seq
469667434 gbinv542.seq
275644987 gbinv543.seq
446552014 gbinv544.seq
480169917 gbinv545.seq
474041236 gbinv546.seq
439739785 gbinv547.seq
415879695 gbinv548.seq
467640439 gbinv549.seq
478352982 gbinv55.seq
312202563 gbinv550.seq
476756795 gbinv551.seq
477061626 gbinv552.seq
483683490 gbinv553.seq
495487713 gbinv554.seq
69234679 gbinv555.seq
477792636 gbinv556.seq
492728468 gbinv557.seq
425135691 gbinv558.seq
353041445 gbinv559.seq
499997720 gbinv56.seq
470334960 gbinv560.seq
494601058 gbinv561.seq
481221711 gbinv562.seq
396473476 gbinv563.seq
483642314 gbinv564.seq
482127664 gbinv565.seq
470874419 gbinv566.seq
495029689 gbinv567.seq
99066263 gbinv568.seq
477955845 gbinv569.seq
402304225 gbinv57.seq
452660426 gbinv570.seq
467009813 gbinv571.seq
409211575 gbinv572.seq
281441527 gbinv573.seq
321243822 gbinv574.seq
272762615 gbinv575.seq
459220600 gbinv576.seq
380210496 gbinv577.seq
157861358 gbinv578.seq
496825048 gbinv579.seq
499996312 gbinv58.seq
457058797 gbinv580.seq
475749694 gbinv581.seq
458940745 gbinv582.seq
478290025 gbinv583.seq
201201186 gbinv584.seq
476458619 gbinv585.seq
472367844 gbinv586.seq
491956509 gbinv587.seq
445112980 gbinv588.seq
478727516 gbinv589.seq
406764629 gbinv59.seq
213103145 gbinv590.seq
426002666 gbinv591.seq
491306479 gbinv592.seq
485922068 gbinv593.seq
470774965 gbinv594.seq
259886438 gbinv595.seq
323358243 gbinv596.seq
292361181 gbinv597.seq
472027339 gbinv598.seq
394618639 gbinv599.seq
462608484 gbinv6.seq
497592841 gbinv60.seq
498685113 gbinv600.seq
252840705 gbinv601.seq
409818882 gbinv602.seq
483153478 gbinv603.seq
356373687 gbinv604.seq
382117771 gbinv605.seq
414986838 gbinv606.seq
358562967 gbinv607.seq
454612949 gbinv608.seq
397094236 gbinv609.seq
491623833 gbinv61.seq
472022816 gbinv610.seq
375604154 gbinv611.seq
260058125 gbinv612.seq
416870448 gbinv613.seq
337551656 gbinv614.seq
323476118 gbinv615.seq
316192878 gbinv616.seq
483033075 gbinv617.seq
484553056 gbinv618.seq
485400895 gbinv619.seq
468890973 gbinv62.seq
444237062 gbinv620.seq
115137081 gbinv621.seq
465061268 gbinv622.seq
450665417 gbinv623.seq
495339385 gbinv624.seq
358679242 gbinv625.seq
488909847 gbinv626.seq
494569731 gbinv627.seq
446419168 gbinv628.seq
393089050 gbinv629.seq
480496391 gbinv63.seq
119924885 gbinv630.seq
475723349 gbinv631.seq
418498253 gbinv632.seq
487729463 gbinv633.seq
442064966 gbinv634.seq
459399034 gbinv635.seq
476019529 gbinv636.seq
489445959 gbinv637.seq
488427181 gbinv638.seq
39113487 gbinv639.seq
96954549 gbinv64.seq
478318630 gbinv640.seq
485192704 gbinv641.seq
487924132 gbinv642.seq
367187723 gbinv643.seq
491253033 gbinv644.seq
492099884 gbinv645.seq
492318782 gbinv646.seq
490488560 gbinv647.seq
264709414 gbinv648.seq
498243322 gbinv649.seq
495716316 gbinv65.seq
461893097 gbinv650.seq
479536374 gbinv651.seq
498214872 gbinv652.seq
358503530 gbinv653.seq
497880059 gbinv654.seq
328840422 gbinv655.seq
388768319 gbinv656.seq
497514162 gbinv657.seq
102760609 gbinv658.seq
424365480 gbinv659.seq
459725126 gbinv66.seq
415464839 gbinv660.seq
468645236 gbinv661.seq
491418312 gbinv662.seq
422461178 gbinv663.seq
494059900 gbinv664.seq
492105201 gbinv665.seq
371680457 gbinv666.seq
418666111 gbinv667.seq
385203223 gbinv668.seq
490161407 gbinv669.seq
481987024 gbinv67.seq
462284226 gbinv670.seq
497343112 gbinv671.seq
483358775 gbinv672.seq
419495810 gbinv673.seq
495088992 gbinv674.seq
118039128 gbinv675.seq
460760613 gbinv676.seq
474795905 gbinv677.seq
448271770 gbinv678.seq
447953092 gbinv679.seq
494130818 gbinv68.seq
397698588 gbinv680.seq
412906977 gbinv681.seq
414039055 gbinv682.seq
373499990 gbinv683.seq
352095009 gbinv684.seq
171624580 gbinv685.seq
492880950 gbinv686.seq
496329611 gbinv687.seq
495293458 gbinv688.seq
326435281 gbinv689.seq
170883604 gbinv69.seq
478875133 gbinv690.seq
438224962 gbinv691.seq
474184048 gbinv692.seq
357686520 gbinv693.seq
465465357 gbinv694.seq
485209832 gbinv695.seq
427730310 gbinv696.seq
361113223 gbinv697.seq
482159714 gbinv698.seq
495382944 gbinv699.seq
446653334 gbinv7.seq
473739681 gbinv70.seq
299589099 gbinv700.seq
321246481 gbinv701.seq
309309582 gbinv702.seq
488604754 gbinv703.seq
410235494 gbinv704.seq
495922375 gbinv705.seq
434632204 gbinv706.seq
74348655 gbinv707.seq
541537247 gbinv708.seq
355690685 gbinv709.seq
489734097 gbinv71.seq
292909846 gbinv710.seq
463584322 gbinv711.seq
387676008 gbinv712.seq
372674865 gbinv713.seq
485847387 gbinv714.seq
484407673 gbinv715.seq
473708314 gbinv716.seq
352986490 gbinv717.seq
443627527 gbinv718.seq
434076487 gbinv719.seq
481853019 gbinv72.seq
478667921 gbinv720.seq
488478103 gbinv721.seq
306326401 gbinv722.seq
385565833 gbinv723.seq
482190195 gbinv724.seq
137160705 gbinv725.seq
490300743 gbinv726.seq
419187067 gbinv727.seq
398652960 gbinv728.seq
436288257 gbinv729.seq
480575064 gbinv73.seq
493888501 gbinv730.seq
447343866 gbinv731.seq
496950073 gbinv732.seq
68378185 gbinv733.seq
484369453 gbinv734.seq
474926486 gbinv735.seq
480605871 gbinv736.seq
489404026 gbinv737.seq
489850852 gbinv738.seq
483923401 gbinv739.seq
175803747 gbinv74.seq
195051546 gbinv740.seq
278317571 gbinv741.seq
405202233 gbinv742.seq
481613416 gbinv743.seq
483053144 gbinv744.seq
140617338 gbinv745.seq
480377160 gbinv746.seq
499100085 gbinv747.seq
495490578 gbinv748.seq
401267386 gbinv749.seq
495896540 gbinv75.seq
334138952 gbinv750.seq
475047240 gbinv751.seq
428648405 gbinv752.seq
378490165 gbinv753.seq
487837824 gbinv754.seq
491255029 gbinv755.seq
375538343 gbinv756.seq
353621722 gbinv757.seq
408852378 gbinv758.seq
494054422 gbinv759.seq
496714825 gbinv76.seq
437725967 gbinv760.seq
364183673 gbinv761.seq
466430597 gbinv762.seq
418516710 gbinv763.seq
347070086 gbinv764.seq
481701036 gbinv765.seq
453274315 gbinv766.seq
496564297 gbinv767.seq
467957545 gbinv768.seq
479873706 gbinv769.seq
484083642 gbinv77.seq
479944057 gbinv770.seq
154655407 gbinv771.seq
464570217 gbinv772.seq
498339612 gbinv773.seq
474586953 gbinv774.seq
481881129 gbinv775.seq
132360635 gbinv776.seq
377651382 gbinv777.seq
471908759 gbinv778.seq
346087536 gbinv779.seq
472142528 gbinv78.seq
221434062 gbinv780.seq
312336496 gbinv781.seq
482097146 gbinv782.seq
426274349 gbinv783.seq
491798282 gbinv784.seq
456244158 gbinv785.seq
498886557 gbinv786.seq
413523689 gbinv787.seq
494612053 gbinv788.seq
269134702 gbinv789.seq
487970520 gbinv79.seq
458119773 gbinv790.seq
492920478 gbinv791.seq
331278911 gbinv792.seq
237876308 gbinv793.seq
380568436 gbinv794.seq
323208797 gbinv795.seq
298483269 gbinv796.seq
296444100 gbinv797.seq
461753371 gbinv798.seq
66028693 gbinv799.seq
485749846 gbinv8.seq
473212643 gbinv80.seq
499911575 gbinv800.seq
471640101 gbinv801.seq
447745268 gbinv802.seq
441848406 gbinv803.seq
180180054 gbinv804.seq
470670718 gbinv805.seq
492815961 gbinv806.seq
498278063 gbinv807.seq
445601713 gbinv808.seq
469989934 gbinv809.seq
119585423 gbinv81.seq
478205479 gbinv810.seq
459587666 gbinv811.seq
272670030 gbinv812.seq
227990903 gbinv813.seq
413244998 gbinv814.seq
498213748 gbinv815.seq
449979827 gbinv816.seq
461330998 gbinv817.seq
294874640 gbinv818.seq
405670616 gbinv819.seq
483414567 gbinv82.seq
474471565 gbinv820.seq
439625427 gbinv821.seq
463229555 gbinv822.seq
464851338 gbinv823.seq
455511857 gbinv824.seq
439389009 gbinv825.seq
405283735 gbinv826.seq
419761690 gbinv827.seq
406996610 gbinv828.seq
442305653 gbinv829.seq
490356175 gbinv83.seq
479961209 gbinv830.seq
282852446 gbinv831.seq
494971745 gbinv832.seq
459071349 gbinv833.seq
457510304 gbinv834.seq
482562593 gbinv835.seq
413357535 gbinv836.seq
381806397 gbinv837.seq
357962786 gbinv838.seq
482830686 gbinv839.seq
487648025 gbinv84.seq
494826362 gbinv840.seq
370208813 gbinv841.seq
428586963 gbinv842.seq
123105615 gbinv843.seq
423910707 gbinv844.seq
460666534 gbinv845.seq
432539703 gbinv846.seq
384196500 gbinv847.seq
348330627 gbinv848.seq
449196792 gbinv849.seq
482729413 gbinv85.seq
388541575 gbinv850.seq
386427271 gbinv851.seq
495791066 gbinv852.seq
479478002 gbinv853.seq
80923082 gbinv854.seq
468644341 gbinv855.seq
487921873 gbinv856.seq
470328373 gbinv857.seq
468642645 gbinv858.seq
411136544 gbinv859.seq
499998094 gbinv86.seq
462696619 gbinv860.seq
493415138 gbinv861.seq
499955696 gbinv862.seq
484026075 gbinv863.seq
483632078 gbinv864.seq
496808153 gbinv865.seq
162547431 gbinv866.seq
455355382 gbinv867.seq
452744560 gbinv868.seq
457356752 gbinv869.seq
420702491 gbinv87.seq
492140801 gbinv870.seq
477236440 gbinv871.seq
440746130 gbinv872.seq
201920044 gbinv873.seq
351798642 gbinv874.seq
407318285 gbinv875.seq
497577312 gbinv876.seq
297816794 gbinv877.seq
465053752 gbinv878.seq
477543055 gbinv879.seq
485183869 gbinv88.seq
488522618 gbinv880.seq
485382482 gbinv881.seq
494197478 gbinv882.seq
492976606 gbinv883.seq
491252062 gbinv884.seq
485879488 gbinv885.seq
184862936 gbinv886.seq
490499065 gbinv887.seq
473434617 gbinv888.seq
491357576 gbinv889.seq
497640586 gbinv89.seq
482466282 gbinv890.seq
488062265 gbinv891.seq
207127102 gbinv892.seq
483701457 gbinv893.seq
474847426 gbinv894.seq
392959411 gbinv895.seq
283167653 gbinv896.seq
394326806 gbinv897.seq
386741280 gbinv898.seq
148537239 gbinv899.seq
448191280 gbinv9.seq
492273364 gbinv90.seq
412230439 gbinv900.seq
434620162 gbinv901.seq
494101468 gbinv902.seq
494548234 gbinv903.seq
436233527 gbinv904.seq
493245062 gbinv905.seq
474858921 gbinv906.seq
85346444 gbinv907.seq
449524998 gbinv908.seq
387985633 gbinv909.seq
493650304 gbinv91.seq
480105396 gbinv910.seq
468490165 gbinv911.seq
33888768 gbinv912.seq
316525209 gbinv913.seq
491028997 gbinv914.seq
492549691 gbinv915.seq
490858334 gbinv916.seq
480371330 gbinv917.seq
485115876 gbinv918.seq
185082058 gbinv919.seq
319412811 gbinv92.seq
468046278 gbinv920.seq
494868031 gbinv921.seq
494549890 gbinv922.seq
464492176 gbinv923.seq
479062193 gbinv924.seq
229136178 gbinv925.seq
496620898 gbinv926.seq
489401016 gbinv927.seq
473706349 gbinv928.seq
492517013 gbinv929.seq
495488979 gbinv93.seq
489752524 gbinv930.seq
424310426 gbinv931.seq
299174362 gbinv932.seq
422084647 gbinv933.seq
482494822 gbinv934.seq
365475369 gbinv935.seq
455578183 gbinv936.seq
349492811 gbinv937.seq
476634596 gbinv938.seq
468337101 gbinv939.seq
496723738 gbinv94.seq
479253876 gbinv940.seq
466281231 gbinv941.seq
169424716 gbinv942.seq
491880344 gbinv943.seq
480699421 gbinv944.seq
466860324 gbinv945.seq
499811191 gbinv946.seq
91086876 gbinv947.seq
468973767 gbinv948.seq
400459425 gbinv949.seq
492757167 gbinv95.seq
1256520955 gbinv950.seq
1265346884 gbinv951.seq
1255793322 gbinv952.seq
898357981 gbinv953.seq
708100992 gbinv954.seq
682259354 gbinv955.seq
603731787 gbinv956.seq
441414755 gbinv957.seq
420875371 gbinv958.seq
364087181 gbinv959.seq
483899600 gbinv96.seq
301245355 gbinv960.seq
281934908 gbinv961.seq
496008009 gbinv962.seq
465427120 gbinv963.seq
64629177 gbinv964.seq
464317097 gbinv965.seq
481015216 gbinv966.seq
495520062 gbinv967.seq
318684600 gbinv968.seq
481288701 gbinv969.seq
478256052 gbinv97.seq
485191238 gbinv970.seq
489426702 gbinv971.seq
448136761 gbinv972.seq
470740250 gbinv973.seq
459272446 gbinv974.seq
495221155 gbinv975.seq
293517224 gbinv976.seq
491531620 gbinv977.seq
484467221 gbinv978.seq
496616156 gbinv979.seq
492780856 gbinv98.seq
243887806 gbinv980.seq
442993411 gbinv981.seq
489594972 gbinv982.seq
473669852 gbinv983.seq
317058682 gbinv984.seq
496827831 gbinv985.seq
475806378 gbinv986.seq
483717478 gbinv987.seq
279303307 gbinv988.seq
442658447 gbinv989.seq
499976011 gbinv99.seq
154113443 gbinv990.seq
479808193 gbinv991.seq
344925104 gbinv992.seq
389948490 gbinv993.seq
495757111 gbinv994.seq
486177962 gbinv995.seq
474805895 gbinv996.seq
332242654 gbinv997.seq
470382099 gbinv998.seq
467266107 gbinv999.seq
499997804 gbmam1.seq
82797475 gbmam10.seq
483844712 gbmam100.seq
437064425 gbmam101.seq
223540742 gbmam102.seq
451994163 gbmam103.seq
449442494 gbmam104.seq
428332203 gbmam105.seq
499998841 gbmam106.seq
499979356 gbmam107.seq
361064049 gbmam108.seq
348089742 gbmam109.seq
71269271 gbmam11.seq
373183698 gbmam110.seq
467160879 gbmam111.seq
457054238 gbmam112.seq
483676806 gbmam113.seq
409916232 gbmam114.seq
398303012 gbmam115.seq
346344396 gbmam116.seq
274828976 gbmam117.seq
266926778 gbmam118.seq
442156596 gbmam119.seq
22560541 gbmam12.seq
394957791 gbmam120.seq
359859404 gbmam121.seq
441833934 gbmam122.seq
467877966 gbmam123.seq
460914208 gbmam124.seq
77886529 gbmam125.seq
384330786 gbmam126.seq
490312196 gbmam127.seq
385325611 gbmam128.seq
473911567 gbmam129.seq
1268288 gbmam13.seq
413152711 gbmam130.seq
479361008 gbmam131.seq
435411678 gbmam132.seq
197829175 gbmam133.seq
374823133 gbmam134.seq
463547765 gbmam135.seq
439985383 gbmam136.seq
408172038 gbmam137.seq
432812311 gbmam138.seq
459597410 gbmam139.seq
378312043 gbmam14.seq
495156885 gbmam140.seq
327564081 gbmam141.seq
422791489 gbmam142.seq
491401632 gbmam143.seq
449317136 gbmam144.seq
287465618 gbmam145.seq
394362643 gbmam146.seq
439407312 gbmam147.seq
453590059 gbmam148.seq
469351291 gbmam149.seq
338653928 gbmam15.seq
67268930 gbmam150.seq
483520870 gbmam151.seq
480679033 gbmam152.seq
410124870 gbmam153.seq
460089444 gbmam154.seq
273447476 gbmam155.seq
472899893 gbmam156.seq
469419756 gbmam157.seq
290267902 gbmam158.seq
453331085 gbmam159.seq
477859984 gbmam16.seq
187958881 gbmam160.seq
352138940 gbmam161.seq
440262201 gbmam162.seq
401683994 gbmam163.seq
455777749 gbmam164.seq
465167960 gbmam165.seq
71138985 gbmam166.seq
445458565 gbmam17.seq
122412952 gbmam18.seq
451114191 gbmam19.seq
399233036 gbmam2.seq
418062936 gbmam20.seq
499818179 gbmam21.seq
462376348 gbmam22.seq
370510647 gbmam23.seq
446296416 gbmam24.seq
431104435 gbmam25.seq
480602942 gbmam26.seq
479109855 gbmam27.seq
483903273 gbmam28.seq
483307002 gbmam29.seq
400559326 gbmam3.seq
48405032 gbmam30.seq
363174382 gbmam31.seq
437246747 gbmam32.seq
470828962 gbmam33.seq
402408906 gbmam34.seq
304109928 gbmam35.seq
452443739 gbmam36.seq
451303958 gbmam37.seq
495648598 gbmam38.seq
405636626 gbmam39.seq
477148353 gbmam4.seq
410457734 gbmam40.seq
441553748 gbmam41.seq
367146984 gbmam42.seq
478421809 gbmam43.seq
316388332 gbmam44.seq
352226884 gbmam45.seq
195247700 gbmam46.seq
474022452 gbmam47.seq
378020853 gbmam48.seq
450136561 gbmam49.seq
374653134 gbmam5.seq
450750944 gbmam50.seq
468132660 gbmam51.seq
494002437 gbmam52.seq
9943400 gbmam53.seq
43988539 gbmam54.seq
91321391 gbmam55.seq
88809391 gbmam56.seq
6363300 gbmam57.seq
20916815 gbmam58.seq
449444885 gbmam59.seq
487713568 gbmam6.seq
423547289 gbmam60.seq
453840584 gbmam61.seq
491149506 gbmam62.seq
425479852 gbmam63.seq
461110029 gbmam64.seq
385606603 gbmam65.seq
489901313 gbmam66.seq
499999966 gbmam67.seq
499998778 gbmam68.seq
23815809 gbmam69.seq
401181424 gbmam7.seq
907465328 gbmam70.seq
839494897 gbmam71.seq
774395849 gbmam72.seq
588873740 gbmam73.seq
364960392 gbmam74.seq
428298067 gbmam75.seq
283039896 gbmam76.seq
266822121 gbmam77.seq
255007049 gbmam78.seq
250435254 gbmam79.seq
435129139 gbmam8.seq
405637142 gbmam80.seq
372091504 gbmam81.seq
465555603 gbmam82.seq
444923782 gbmam83.seq
341582143 gbmam84.seq
257946240 gbmam85.seq
485829704 gbmam86.seq
486026993 gbmam87.seq
483298905 gbmam88.seq
494677523 gbmam89.seq
275778738 gbmam9.seq
335874920 gbmam90.seq
464872853 gbmam91.seq
468294587 gbmam92.seq
497569809 gbmam93.seq
377746247 gbmam94.seq
460747191 gbmam95.seq
150130543 gbmam96.seq
416665240 gbmam97.seq
456214449 gbmam98.seq
486132452 gbmam99.seq
11909180 gbnew.txt
499999570 gbpat1.seq
499999978 gbpat10.seq
499999036 gbpat100.seq
499999497 gbpat101.seq
499997525 gbpat102.seq
228719622 gbpat103.seq
500000251 gbpat104.seq
500000174 gbpat105.seq
499999692 gbpat106.seq
335512335 gbpat107.seq
499999350 gbpat108.seq
499998996 gbpat109.seq
499996310 gbpat11.seq
210371322 gbpat110.seq
499912428 gbpat111.seq
500000210 gbpat112.seq
174089502 gbpat113.seq
499999952 gbpat114.seq
499999743 gbpat115.seq
499994085 gbpat116.seq
8695606 gbpat117.seq
499716008 gbpat118.seq
382809272 gbpat119.seq
179013606 gbpat12.seq
499997773 gbpat120.seq
499994917 gbpat121.seq
499992686 gbpat122.seq
499999985 gbpat123.seq
56630679 gbpat124.seq
499968107 gbpat125.seq
499997783 gbpat126.seq
208440820 gbpat127.seq
499999470 gbpat128.seq
500000230 gbpat129.seq
499934083 gbpat13.seq
59320750 gbpat130.seq
499999857 gbpat131.seq
499999630 gbpat132.seq
488814351 gbpat133.seq
499998351 gbpat134.seq
499999862 gbpat135.seq
28424463 gbpat136.seq
499989451 gbpat137.seq
385112080 gbpat138.seq
499999325 gbpat139.seq
499999683 gbpat14.seq
500000185 gbpat140.seq
148509502 gbpat141.seq
499997036 gbpat142.seq
314541297 gbpat143.seq
499988381 gbpat144.seq
499980283 gbpat145.seq
409538104 gbpat146.seq
500000154 gbpat147.seq
499998625 gbpat148.seq
125964940 gbpat149.seq
62731079 gbpat15.seq
499989559 gbpat150.seq
499999634 gbpat151.seq
499998857 gbpat152.seq
499997730 gbpat153.seq
169872636 gbpat154.seq
499999883 gbpat155.seq
426335262 gbpat156.seq
499998908 gbpat157.seq
499999352 gbpat158.seq
499911989 gbpat159.seq
499999080 gbpat16.seq
353544315 gbpat160.seq
499999442 gbpat161.seq
499999138 gbpat162.seq
291199807 gbpat163.seq
499999789 gbpat164.seq
499999486 gbpat165.seq
499999598 gbpat166.seq
102910923 gbpat167.seq
499999645 gbpat168.seq
499997500 gbpat169.seq
499996570 gbpat17.seq
499998487 gbpat170.seq
499998725 gbpat171.seq
301680889 gbpat172.seq
499999132 gbpat173.seq
499998821 gbpat174.seq
499999449 gbpat175.seq
319804768 gbpat176.seq
499602751 gbpat177.seq
499999421 gbpat178.seq
499999721 gbpat179.seq
422037202 gbpat18.seq
13383401 gbpat180.seq
497266494 gbpat181.seq
499999757 gbpat182.seq
499999224 gbpat183.seq
86831503 gbpat184.seq
499929965 gbpat185.seq
499999973 gbpat186.seq
499997634 gbpat187.seq
39745949 gbpat188.seq
499259022 gbpat189.seq
499891839 gbpat19.seq
499998056 gbpat190.seq
499998939 gbpat191.seq
499999872 gbpat192.seq
96567217 gbpat193.seq
499880186 gbpat194.seq
500000044 gbpat195.seq
499999343 gbpat196.seq
499998987 gbpat197.seq
90164673 gbpat198.seq
499992850 gbpat199.seq
499999904 gbpat2.seq
499999904 gbpat20.seq
499994277 gbpat200.seq
499998512 gbpat201.seq
499999265 gbpat202.seq
4092526 gbpat203.seq
499999756 gbpat204.seq
499999459 gbpat205.seq
500000244 gbpat206.seq
478202129 gbpat207.seq
500000054 gbpat208.seq
499999577 gbpat209.seq
499989670 gbpat21.seq
321705067 gbpat210.seq
499991396 gbpat211.seq
499963719 gbpat212.seq
350635988 gbpat213.seq
497506292 gbpat214.seq
499869540 gbpat215.seq
421452571 gbpat216.seq
499425936 gbpat217.seq
499999361 gbpat218.seq
336263474 gbpat219.seq
347840529 gbpat22.seq
499998549 gbpat220.seq
499999807 gbpat221.seq
499999757 gbpat222.seq
361373412 gbpat223.seq
499999662 gbpat224.seq
494515367 gbpat225.seq
341868206 gbpat226.seq
499999744 gbpat227.seq
500000159 gbpat228.seq
366896749 gbpat229.seq
499975492 gbpat23.seq
499999946 gbpat230.seq
499335751 gbpat231.seq
389256092 gbpat232.seq
499996721 gbpat233.seq
500000056 gbpat234.seq
498671374 gbpat235.seq
499998420 gbpat236.seq
499999544 gbpat237.seq
21952712 gbpat238.seq
499999052 gbpat239.seq
500000094 gbpat24.seq
499999759 gbpat240.seq
499999737 gbpat241.seq
499999380 gbpat242.seq
488147786 gbpat243.seq
499999639 gbpat244.seq
499997091 gbpat245.seq
499999375 gbpat246.seq
187729792 gbpat247.seq
500000259 gbpat248.seq
499999167 gbpat249.seq
499999592 gbpat25.seq
499999121 gbpat250.seq
499996573 gbpat251.seq
413100971 gbpat252.seq
499934049 gbpat26.seq
165795106 gbpat27.seq
500000013 gbpat28.seq
499999901 gbpat29.seq
61230478 gbpat3.seq
213211253 gbpat30.seq
499999775 gbpat31.seq
406038606 gbpat32.seq
499996389 gbpat33.seq
500000029 gbpat34.seq
126486628 gbpat35.seq
499999253 gbpat36.seq
499998589 gbpat37.seq
500000154 gbpat38.seq
140147826 gbpat39.seq
500000032 gbpat4.seq
500000096 gbpat40.seq
493981635 gbpat41.seq
494767586 gbpat42.seq
499999483 gbpat43.seq
149222752 gbpat44.seq
499999126 gbpat45.seq
499999712 gbpat46.seq
499999200 gbpat47.seq
87865684 gbpat48.seq
499999450 gbpat49.seq
499999749 gbpat5.seq
499999218 gbpat50.seq
499999099 gbpat51.seq
130960400 gbpat52.seq
499999410 gbpat53.seq
499999084 gbpat54.seq
185001858 gbpat55.seq
499999726 gbpat56.seq
499999154 gbpat57.seq
137265710 gbpat58.seq
499998902 gbpat59.seq
419022735 gbpat6.seq
499638184 gbpat60.seq
429856934 gbpat61.seq
499999999 gbpat62.seq
321021784 gbpat63.seq
499999046 gbpat64.seq
500000111 gbpat65.seq
306219076 gbpat66.seq
499999595 gbpat67.seq
499997159 gbpat68.seq
144919043 gbpat69.seq
500000142 gbpat7.seq
499999495 gbpat70.seq
226235202 gbpat71.seq
499942763 gbpat72.seq
500000257 gbpat73.seq
309555677 gbpat74.seq
499990988 gbpat75.seq
499996904 gbpat76.seq
259606120 gbpat77.seq
499998418 gbpat78.seq
499997914 gbpat79.seq
499999878 gbpat8.seq
36785301 gbpat80.seq
500000256 gbpat81.seq
474123180 gbpat82.seq
500000082 gbpat83.seq
331723545 gbpat84.seq
499999924 gbpat85.seq
312031155 gbpat86.seq
499998241 gbpat87.seq
499999683 gbpat88.seq
499998070 gbpat89.seq
317269942 gbpat9.seq
205484674 gbpat90.seq
499999444 gbpat91.seq
455869832 gbpat92.seq
499961202 gbpat93.seq
252282964 gbpat94.seq
499999316 gbpat95.seq
499997665 gbpat96.seq
82982906 gbpat97.seq
499999689 gbpat98.seq
498236426 gbpat99.seq
499991275 gbphg1.seq
499939178 gbphg2.seq
499961480 gbphg3.seq
499999548 gbphg4.seq
499923947 gbphg5.seq
333625271 gbphg6.seq
500000029 gbpln1.seq
269118160 gbpln10.seq
286199717 gbpln100.seq
890952840 gbpln1000.se
721824595 gbpln1001.se
785634143 gbpln1002.se
909002041 gbpln1003.se
625532226 gbpln1004.se
945667285 gbpln1005.se
953425673 gbpln1006.se
821771932 gbpln1007.se
459016010 gbpln1008.se
304564514 gbpln1009.se
277716232 gbpln101.seq
571276484 gbpln1010.se
841140963 gbpln1011.se
813242081 gbpln1012.se
666749684 gbpln1013.se
786164670 gbpln1014.se
685610369 gbpln1015.se
780661607 gbpln1016.se
20764769 gbpln1017.se
494104735 gbpln1018.se
487719162 gbpln1019.se
499733064 gbpln102.seq
475203143 gbpln1020.se
481053138 gbpln1021.se
491971790 gbpln1022.se
174964113 gbpln1023.se
489989534 gbpln1024.se
498671512 gbpln1025.se
498654651 gbpln1026.se
472130628 gbpln1027.se
484783481 gbpln1028.se
174534000 gbpln1029.se
79413547 gbpln103.seq
458581762 gbpln1030.se
487249767 gbpln1031.se
488104602 gbpln1032.se
490993470 gbpln1033.se
458758162 gbpln1034.se
243752045 gbpln1035.se
496284751 gbpln1036.se
470894249 gbpln1037.se
456702113 gbpln1038.se
468851576 gbpln1039.se
391026516 gbpln104.seq
498668450 gbpln1040.se
246543998 gbpln1041.se
403648092 gbpln1042.se
420333785 gbpln1043.se
486138903 gbpln1044.se
461617634 gbpln1045.se
214014145 gbpln1046.se
461722879 gbpln1047.se
470401116 gbpln1048.se
494676807 gbpln1049.se
362500947 gbpln105.seq
492353397 gbpln1050.se
492231081 gbpln1051.se
345527633 gbpln1052.se
463862211 gbpln1053.se
494081914 gbpln1054.se
498159633 gbpln1055.se
430115650 gbpln1056.se
489133826 gbpln1057.se
408967072 gbpln1058.se
100679825 gbpln1059.se
390024685 gbpln106.seq
437115790 gbpln1060.se
441097064 gbpln1061.se
442410423 gbpln1062.se
451274488 gbpln1063.se
251536188 gbpln1064.se
422420084 gbpln1065.se
498624032 gbpln1066.se
493874495 gbpln1067.se
461365034 gbpln1068.se
368984003 gbpln1069.se
341773035 gbpln107.seq
327296104 gbpln1070.se
393553638 gbpln1071.se
494499660 gbpln1072.se
339690898 gbpln1073.se
442713467 gbpln1074.se
491685948 gbpln1075.se
363732401 gbpln1076.se
454836169 gbpln1077.se
473634452 gbpln1078.se
202150508 gbpln1079.se
199854531 gbpln108.seq
470919442 gbpln1080.se
485212352 gbpln1081.se
473559497 gbpln1082.se
436659501 gbpln1083.se
334468228 gbpln1084.se
1096228946 gbpln1085.se
1065747702 gbpln1086.se
978382754 gbpln1087.se
970377846 gbpln1088.se
932157798 gbpln1089.se
483137958 gbpln109.seq
878151181 gbpln1090.se
874085482 gbpln1091.se
829265283 gbpln1092.se
863296713 gbpln1093.se
823515697 gbpln1094.se
815413879 gbpln1095.se
693494316 gbpln1096.se
690790562 gbpln1097.se
669344399 gbpln1098.se
682118426 gbpln1099.se
499921678 gbpln11.seq
493810296 gbpln110.seq
617460029 gbpln1100.se
613278884 gbpln1101.se
540591172 gbpln1102.se
1122504 gbpln1103.se
2012725365 gbpln1104.se
1745413840 gbpln1105.se
1943630374 gbpln1106.se
482844875 gbpln1107.se
172025956 gbpln1108.se
477983665 gbpln1109.se
497201313 gbpln111.seq
479133534 gbpln1110.se
489619458 gbpln1111.se
483060400 gbpln1112.se
499996861 gbpln1113.se
124596043 gbpln1114.se
498939461 gbpln112.seq
172948890 gbpln113.seq
485439355 gbpln114.seq
339967820 gbpln115.seq
410604091 gbpln116.seq
459875355 gbpln117.seq
499126764 gbpln118.seq
182005254 gbpln119.seq
498718656 gbpln12.seq
498973363 gbpln120.seq
472540038 gbpln121.seq
453105795 gbpln122.seq
445429529 gbpln123.seq
387853287 gbpln124.seq
496158186 gbpln125.seq
499810789 gbpln126.seq
498685873 gbpln127.seq
312787398 gbpln128.seq
489314534 gbpln129.seq
469955827 gbpln13.seq
486163903 gbpln130.seq
495247318 gbpln131.seq
466228706 gbpln132.seq
493825919 gbpln133.seq
495559921 gbpln134.seq
496499973 gbpln135.seq
496138774 gbpln136.seq
445715407 gbpln137.seq
468986126 gbpln138.seq
474996855 gbpln139.seq
170594869 gbpln14.seq
477161896 gbpln140.seq
340348392 gbpln141.seq
484314104 gbpln142.seq
490914318 gbpln143.seq
499456730 gbpln144.seq
296665318 gbpln145.seq
496742537 gbpln146.seq
421717858 gbpln147.seq
460820205 gbpln148.seq
485737542 gbpln149.seq
496172925 gbpln15.seq
498612562 gbpln150.seq
495372236 gbpln151.seq
483146996 gbpln152.seq
415715970 gbpln153.seq
336937021 gbpln154.seq
481782456 gbpln155.seq
432553122 gbpln156.seq
462278275 gbpln157.seq
338514050 gbpln158.seq
478622058 gbpln159.seq
478637900 gbpln16.seq
276524733 gbpln160.seq
445190576 gbpln161.seq
357274162 gbpln162.seq
375890576 gbpln163.seq
349832882 gbpln164.seq
336189913 gbpln165.seq
463740200 gbpln166.seq
393476964 gbpln167.seq
114312500 gbpln168.seq
430007058 gbpln169.seq
335223965 gbpln17.seq
485882010 gbpln170.seq
403795990 gbpln171.seq
451516767 gbpln172.seq
382592005 gbpln173.seq
457726110 gbpln174.seq
493420618 gbpln175.seq
497715243 gbpln176.seq
494847899 gbpln177.seq
136024814 gbpln178.seq
497448381 gbpln179.seq
418823303 gbpln18.seq
473039932 gbpln180.seq
441177058 gbpln181.seq
411490587 gbpln182.seq
492939938 gbpln183.seq
379996333 gbpln184.seq
86418 gbpln185.seq
361751 gbpln186.seq
164981131 gbpln187.seq
40089516 gbpln188.seq
74918158 gbpln189.seq
496016838 gbpln19.seq
499997343 gbpln190.seq
358006951 gbpln191.seq
499998009 gbpln192.seq
499999207 gbpln193.seq
143993384 gbpln194.seq
499999335 gbpln195.seq
499587351 gbpln196.seq
499957790 gbpln197.seq
291010585 gbpln198.seq
298751395 gbpln199.seq
499928711 gbpln2.seq
441181335 gbpln20.seq
211415329 gbpln200.seq
248595959 gbpln201.seq
185672058 gbpln202.seq
997331398 gbpln203.seq
56516985 gbpln204.seq
487357652 gbpln205.seq
473525596 gbpln206.seq
473209473 gbpln207.seq
467870653 gbpln208.seq
168324953 gbpln209.seq
426926678 gbpln21.seq
442170645 gbpln210.seq
460425795 gbpln211.seq
479222672 gbpln212.seq
92564056 gbpln213.seq
609356119 gbpln214.seq
786074578 gbpln215.seq
733167229 gbpln216.seq
736239733 gbpln217.seq
691575746 gbpln218.seq
660133963 gbpln219.seq
224879017 gbpln22.seq
739031764 gbpln220.seq
457972471 gbpln221.seq
425775450 gbpln222.seq
499999364 gbpln223.seq
66351927 gbpln224.seq
499999080 gbpln225.seq
499999120 gbpln226.seq
272081259 gbpln227.seq
499997676 gbpln228.seq
499997580 gbpln229.seq
369920299 gbpln23.seq
93850961 gbpln230.seq
499999024 gbpln231.seq
484555862 gbpln232.seq
499998754 gbpln233.seq
421004080 gbpln234.seq
499998768 gbpln235.seq
389600613 gbpln236.seq
500000073 gbpln237.seq
499998411 gbpln238.seq
500000064 gbpln239.seq
320631792 gbpln24.seq
71863280 gbpln240.seq
499999375 gbpln241.seq
499972139 gbpln242.seq
422895790 gbpln243.seq
499998120 gbpln244.seq
499998113 gbpln245.seq
495081483 gbpln246.seq
476887580 gbpln247.seq
499832154 gbpln248.seq
491588632 gbpln249.seq
318185493 gbpln25.seq
402785639 gbpln250.seq
445924319 gbpln251.seq
499810562 gbpln252.seq
5650012 gbpln253.seq
492254275 gbpln254.seq
226945063 gbpln255.seq
315805316 gbpln256.seq
665291577 gbpln257.seq
860028189 gbpln258.seq
800605872 gbpln259.seq
320810750 gbpln26.seq
794469115 gbpln260.seq
762933697 gbpln261.seq
729969959 gbpln262.seq
808217924 gbpln263.seq
209360791 gbpln264.seq
924325157 gbpln265.seq
1201978654 gbpln266.seq
1227268207 gbpln267.seq
1152253241 gbpln268.seq
1115248374 gbpln269.seq
339200181 gbpln27.seq
1125506105 gbpln270.seq
1145303472 gbpln271.seq
695608615 gbpln272.seq
494749359 gbpln273.seq
460644363 gbpln274.seq
152680390 gbpln275.seq
462987114 gbpln276.seq
480457420 gbpln277.seq
494737040 gbpln278.seq
446441302 gbpln279.seq
222826757 gbpln28.seq
117077133 gbpln280.seq
485280656 gbpln281.seq
153318246 gbpln282.seq
689933987 gbpln283.seq
887561680 gbpln284.seq
834970472 gbpln285.seq
826391913 gbpln286.seq
792513917 gbpln287.seq
743209872 gbpln288.seq
833073712 gbpln289.seq
336947956 gbpln29.seq
562407 gbpln290.seq
665291577 gbpln291.seq
860028189 gbpln292.seq
800605872 gbpln293.seq
794469115 gbpln294.seq
762933697 gbpln295.seq
729969959 gbpln296.seq
808217924 gbpln297.seq
189171272 gbpln298.seq
663098252 gbpln299.seq
499979900 gbpln3.seq
309835203 gbpln30.seq
855592604 gbpln300.seq
807031053 gbpln301.seq
793905039 gbpln302.seq
773303164 gbpln303.seq
718153248 gbpln304.seq
804870210 gbpln305.seq
661762125 gbpln306.seq
840180304 gbpln307.seq
796430245 gbpln308.seq
779180715 gbpln309.seq
351268105 gbpln31.seq
761224530 gbpln310.seq
725380245 gbpln311.seq
792983451 gbpln312.seq
652402241 gbpln313.seq
831209396 gbpln314.seq
783682955 gbpln315.seq
775938782 gbpln316.seq
741958804 gbpln317.seq
700440901 gbpln318.seq
788705159 gbpln319.seq
450037264 gbpln32.seq
683172483 gbpln320.seq
872662143 gbpln321.seq
815663229 gbpln322.seq
813528167 gbpln323.seq
780491844 gbpln324.seq
734904793 gbpln325.seq
816941948 gbpln326.seq
635039454 gbpln327.seq
824184474 gbpln328.seq
768070182 gbpln329.seq
346116596 gbpln33.seq
758956882 gbpln330.seq
732189331 gbpln331.seq
706311232 gbpln332.seq
766293442 gbpln333.seq
651415133 gbpln334.seq
830082304 gbpln335.seq
783385752 gbpln336.seq
770520351 gbpln337.seq
753421970 gbpln338.seq
699441547 gbpln339.seq
384912193 gbpln34.seq
784443196 gbpln340.seq
4698 gbpln341.seq
702337808 gbpln342.seq
906907390 gbpln343.seq
844110716 gbpln344.seq
841780855 gbpln345.seq
805270043 gbpln346.seq
764396863 gbpln347.seq
841492595 gbpln348.seq
714482811 gbpln349.seq
205693142 gbpln35.seq
916127997 gbpln350.seq
858459407 gbpln351.seq
848936990 gbpln352.seq
813129213 gbpln353.seq
765593150 gbpln354.seq
862731158 gbpln355.seq
665885634 gbpln356.seq
854365265 gbpln357.seq
802776346 gbpln358.seq
793295912 gbpln359.seq
85942873 gbpln36.seq
769246240 gbpln360.seq
710912919 gbpln361.seq
799876815 gbpln362.seq
629668050 gbpln363.seq
814320946 gbpln364.seq
759349720 gbpln365.seq
762512207 gbpln366.seq
724647884 gbpln367.seq
679679449 gbpln368.seq
784312844 gbpln369.seq
477916829 gbpln37.seq
684180819 gbpln370.seq
873292213 gbpln371.seq
827422505 gbpln372.seq
815925825 gbpln373.seq
779009585 gbpln374.seq
739747654 gbpln375.seq
834950434 gbpln376.seq
663096073 gbpln377.seq
849628701 gbpln378.seq
803882830 gbpln379.seq
499904224 gbpln38.seq
794420470 gbpln380.seq
760127459 gbpln381.seq
714663802 gbpln382.seq
801095950 gbpln383.seq
668869887 gbpln384.seq
854770002 gbpln385.seq
805931576 gbpln386.seq
798923954 gbpln387.seq
766411223 gbpln388.seq
723133936 gbpln389.seq
498817817 gbpln39.seq
803351408 gbpln390.seq
664176987 gbpln391.seq
854339916 gbpln392.seq
803900400 gbpln393.seq
791449620 gbpln394.seq
761145205 gbpln395.seq
715062603 gbpln396.seq
806379176 gbpln397.seq
668964953 gbpln398.seq
870939392 gbpln399.seq
499941474 gbpln4.seq
323729344 gbpln40.seq
809408813 gbpln400.seq
801514137 gbpln401.seq
768794024 gbpln402.seq
723644689 gbpln403.seq
815153418 gbpln404.seq
661177159 gbpln405.seq
846934671 gbpln406.seq
794708793 gbpln407.seq
789781753 gbpln408.seq
764576068 gbpln409.seq
499081471 gbpln41.seq
711115451 gbpln410.seq
797517245 gbpln411.seq
691953899 gbpln412.seq
888406351 gbpln413.seq
835271741 gbpln414.seq
823533989 gbpln415.seq
787819193 gbpln416.seq
748786657 gbpln417.seq
838184652 gbpln418.seq
488802687 gbpln419.seq
497391852 gbpln42.seq
439661491 gbpln420.seq
155752105 gbpln421.seq
758806100 gbpln422.seq
898446949 gbpln423.seq
628489896 gbpln424.seq
1024113089 gbpln425.seq
1032878661 gbpln426.seq
858694781 gbpln427.seq
960391204 gbpln428.seq
1090094606 gbpln429.seq
499428080 gbpln43.seq
781959143 gbpln430.seq
946995961 gbpln431.seq
857542781 gbpln432.seq
656405285 gbpln433.seq
907889097 gbpln434.seq
896386890 gbpln435.seq
726432335 gbpln436.seq
798296822 gbpln437.seq
918393750 gbpln438.seq
584961784 gbpln439.seq
103294636 gbpln44.seq
948865971 gbpln440.seq
954536271 gbpln441.seq
819735731 gbpln442.seq
756588093 gbpln443.seq
876067119 gbpln444.seq
625446321 gbpln445.seq
977801494 gbpln446.seq
854357980 gbpln447.seq
807732556 gbpln448.seq
947696453 gbpln449.seq
496566630 gbpln45.seq
1067629605 gbpln450.seq
822222048 gbpln451.seq
950272996 gbpln452.seq
845138843 gbpln453.seq
643846993 gbpln454.seq
894745096 gbpln455.seq
893352134 gbpln456.seq
722578984 gbpln457.seq
776227316 gbpln458.seq
899750467 gbpln459.seq
478891333 gbpln46.seq
592059964 gbpln460.seq
933986451 gbpln461.seq
939527664 gbpln462.seq
810117922 gbpln463.seq
765938558 gbpln464.seq
886537018 gbpln465.seq
623519964 gbpln466.seq
996940649 gbpln467.seq
1030190034 gbpln468.seq
832828033 gbpln469.seq
383840485 gbpln47.seq
956342979 gbpln470.seq
1134286144 gbpln471.seq
790513299 gbpln472.seq
944161893 gbpln473.seq
860035788 gbpln474.seq
647268685 gbpln475.seq
902239623 gbpln476.seq
611029440 gbpln477.seq
734907577 gbpln478.seq
787834228 gbpln479.seq
454049207 gbpln48.seq
910724363 gbpln480.seq
606016896 gbpln481.seq
961485234 gbpln482.seq
1242775191 gbpln483.seq
816670128 gbpln484.seq
636658925 gbpln485.seq
818591771 gbpln486.seq
766580884 gbpln487.seq
752100829 gbpln488.seq
724519993 gbpln489.seq
495221947 gbpln49.seq
690955648 gbpln490.seq
769738288 gbpln491.seq
750738544 gbpln492.seq
872184389 gbpln493.seq
624480879 gbpln494.seq
995069022 gbpln495.seq
1012956234 gbpln496.seq
827074347 gbpln497.seq
940621783 gbpln498.seq
1079418810 gbpln499.seq
478062437 gbpln5.seq
486126470 gbpln50.seq
776922106 gbpln500.seq
938380968 gbpln501.seq
848757671 gbpln502.seq
643572913 gbpln503.seq
891714442 gbpln504.seq
878638403 gbpln505.seq
721632671 gbpln506.seq
779156122 gbpln507.seq
895553446 gbpln508.seq
604678568 gbpln509.seq
498663354 gbpln51.seq
931006295 gbpln510.seq
933660027 gbpln511.seq
810459540 gbpln512.seq
761872100 gbpln513.seq
878702815 gbpln514.seq
627081460 gbpln515.seq
994320235 gbpln516.seq
999434327 gbpln517.seq
823789349 gbpln518.seq
945629782 gbpln519.seq
471931520 gbpln52.seq
1062113821 gbpln520.seq
792298939 gbpln521.seq
941851700 gbpln522.seq
850142413 gbpln523.seq
656955691 gbpln524.seq
904094753 gbpln525.seq
900193903 gbpln526.seq
728906821 gbpln527.seq
741172650 gbpln528.seq
898719079 gbpln529.seq
497321530 gbpln53.seq
599002526 gbpln530.seq
937117048 gbpln531.seq
936021119 gbpln532.seq
812696702 gbpln533.seq
746628212 gbpln534.seq
897168807 gbpln535.seq
626698501 gbpln536.seq
1007072101 gbpln537.seq
1000831797 gbpln538.seq
841918855 gbpln539.seq
472649872 gbpln54.seq
963426816 gbpln540.seq
1093654114 gbpln541.seq
791118382 gbpln542.seq
959940756 gbpln543.seq
853263842 gbpln544.seq
648051398 gbpln545.seq
901282075 gbpln546.seq
923491092 gbpln547.seq
732477869 gbpln548.seq
789987733 gbpln549.seq
478648821 gbpln55.seq
926022053 gbpln550.seq
610840579 gbpln551.seq
949759032 gbpln552.seq
955444559 gbpln553.seq
818480442 gbpln554.seq
752251380 gbpln555.seq
897893149 gbpln556.seq
631111272 gbpln557.seq
1022032953 gbpln558.seq
1006306956 gbpln559.seq
83738365 gbpln56.seq
837035085 gbpln560.seq
966140819 gbpln561.seq
1090560006 gbpln562.seq
800164754 gbpln563.seq
959884028 gbpln564.seq
886916735 gbpln565.seq
641540050 gbpln566.seq
910168783 gbpln567.seq
908785549 gbpln568.seq
729527181 gbpln569.seq
494333293 gbpln57.seq
797552105 gbpln570.seq
910975470 gbpln571.seq
616026199 gbpln572.seq
945685366 gbpln573.seq
953145956 gbpln574.seq
820081609 gbpln575.seq
763165947 gbpln576.seq
870898266 gbpln577.seq
618200825 gbpln578.seq
1009123187 gbpln579.seq
475215142 gbpln58.seq
1016689515 gbpln580.seq
832912303 gbpln581.seq
952656374 gbpln582.seq
1065835283 gbpln583.seq
776075044 gbpln584.seq
935940025 gbpln585.seq
846831932 gbpln586.seq
641399988 gbpln587.seq
892709705 gbpln588.seq
594848385 gbpln589.seq
468208544 gbpln59.seq
720169483 gbpln590.seq
780564861 gbpln591.seq
888344689 gbpln592.seq
610800072 gbpln593.seq
934713391 gbpln594.seq
1233388213 gbpln595.seq
807523234 gbpln596.seq
19542 gbpln597.seq
757881986 gbpln598.seq
889760627 gbpln599.seq
499994605 gbpln6.seq
486858437 gbpln60.seq
635890046 gbpln600.seq
1007873898 gbpln601.seq
1015524558 gbpln602.seq
836625022 gbpln603.seq
959076059 gbpln604.seq
1077416379 gbpln605.seq
789416089 gbpln606.seq
958430056 gbpln607.seq
877922843 gbpln608.seq
648665455 gbpln609.seq
272302955 gbpln61.seq
907513209 gbpln610.seq
904978028 gbpln611.seq
727024880 gbpln612.seq
789120540 gbpln613.seq
898507915 gbpln614.seq
617229811 gbpln615.seq
942711764 gbpln616.seq
964780021 gbpln617.seq
818917331 gbpln618.seq
755294557 gbpln619.seq
172902191 gbpln62.seq
882064051 gbpln620.seq
627203691 gbpln621.seq
993595919 gbpln622.seq
1021497440 gbpln623.seq
827286497 gbpln624.seq
962451301 gbpln625.seq
1082256067 gbpln626.seq
781463827 gbpln627.seq
919665368 gbpln628.seq
852133929 gbpln629.seq
471233536 gbpln63.seq
645388382 gbpln630.seq
905574854 gbpln631.seq
906714977 gbpln632.seq
718743537 gbpln633.seq
787529633 gbpln634.seq
910251919 gbpln635.seq
608518276 gbpln636.seq
934541265 gbpln637.seq
954054955 gbpln638.seq
806443717 gbpln639.seq
455042321 gbpln64.seq
1009766480 gbpln640.seq
1318260463 gbpln641.seq
1253136609 gbpln642.seq
1066198175 gbpln643.seq
1119572655 gbpln644.seq
1040217505 gbpln645.seq
1310077288 gbpln646.seq
955690374 gbpln647.seq
1230684440 gbpln648.seq
1179787958 gbpln649.seq
488809223 gbpln65.seq
1125383520 gbpln650.seq
1051194518 gbpln651.seq
965656648 gbpln652.seq
1110281977 gbpln653.seq
32675 gbpln654.seq
253174573 gbpln655.seq
654245898 gbpln656.seq
843080362 gbpln657.seq
787261705 gbpln658.seq
773098599 gbpln659.seq
355272263 gbpln66.seq
745082094 gbpln660.seq
711612756 gbpln661.seq
801222610 gbpln662.seq
271156 gbpln663.seq
398651709 gbpln664.seq
315170317 gbpln665.seq
306732013 gbpln666.seq
319872292 gbpln667.seq
286450423 gbpln668.seq
220883441 gbpln669.seq
200538454 gbpln67.seq
470283415 gbpln670.seq
475876375 gbpln671.seq
499130345 gbpln672.seq
460644363 gbpln673.seq
359155255 gbpln674.seq
399402445 gbpln675.seq
501115666 gbpln676.seq
413826113 gbpln677.seq
367000227 gbpln678.seq
238050627 gbpln679.seq
377219536 gbpln68.seq
352241749 gbpln680.seq
298781185 gbpln681.seq
490716477 gbpln682.seq
86108082 gbpln683.seq
9838016 gbpln684.seq
10165787 gbpln685.seq
766528189 gbpln686.seq
422668510 gbpln687.seq
133575725 gbpln688.seq
756143249 gbpln689.seq
375192640 gbpln69.seq
878426054 gbpln690.seq
631056251 gbpln691.seq
993852367 gbpln692.seq
1020132695 gbpln693.seq
830166807 gbpln694.seq
955723315 gbpln695.seq
1057964328 gbpln696.seq
784007552 gbpln697.seq
947940191 gbpln698.seq
857511193 gbpln699.seq
499932104 gbpln7.seq
386441749 gbpln70.seq
649137171 gbpln700.seq
903393879 gbpln701.seq
908180396 gbpln702.seq
721135945 gbpln703.seq
786739709 gbpln704.seq
918070756 gbpln705.seq
603192844 gbpln706.seq
938102555 gbpln707.seq
955978436 gbpln708.seq
813787878 gbpln709.seq
475313842 gbpln71.seq
639701128 gbpln710.seq
468553773 gbpln711.seq
499475612 gbpln712.seq
498586568 gbpln713.seq
20795371 gbpln714.seq
768129678 gbpln715.seq
891209633 gbpln716.seq
1017177961 gbpln717.seq
1036708108 gbpln718.seq
980496603 gbpln719.seq
452882572 gbpln72.seq
1096870510 gbpln720.seq
964601805 gbpln721.seq
883690282 gbpln722.seq
879367269 gbpln723.seq
922136688 gbpln724.seq
805432021 gbpln725.seq
912345991 gbpln726.seq
954500353 gbpln727.seq
944560088 gbpln728.seq
29543025 gbpln729.seq
125944249 gbpln73.seq
404679684 gbpln730.seq
499998549 gbpln731.seq
499997743 gbpln732.seq
488937134 gbpln733.seq
499998003 gbpln734.seq
499901635 gbpln735.seq
499896237 gbpln736.seq
87100224 gbpln737.seq
499850983 gbpln738.seq
499974249 gbpln739.seq
476593700 gbpln74.seq
499997890 gbpln740.seq
303884321 gbpln741.seq
499966460 gbpln742.seq
499998801 gbpln743.seq
499838453 gbpln744.seq
20172350 gbpln745.seq
499970758 gbpln746.seq
499998315 gbpln747.seq
499886995 gbpln748.seq
152520378 gbpln749.seq
434249982 gbpln75.seq
499879970 gbpln750.seq
499539462 gbpln751.seq
499673566 gbpln752.seq
499999234 gbpln753.seq
499912065 gbpln754.seq
75931258 gbpln755.seq
499995647 gbpln756.seq
499999108 gbpln757.seq
499964915 gbpln758.seq
293285214 gbpln759.seq
440487400 gbpln76.seq
499996904 gbpln760.seq
499836808 gbpln761.seq
499998957 gbpln762.seq
499874487 gbpln763.seq
484373154 gbpln764.seq
453022433 gbpln765.seq
110261817 gbpln766.seq
674055631 gbpln767.seq
865045961 gbpln768.seq
815791689 gbpln769.seq
444203819 gbpln77.seq
802718902 gbpln770.seq
776304595 gbpln771.seq
721531499 gbpln772.seq
809857060 gbpln773.seq
679344023 gbpln774.seq
873797632 gbpln775.seq
820367220 gbpln776.seq
806296382 gbpln777.seq
775209384 gbpln778.seq
744231520 gbpln779.seq
189178941 gbpln78.seq
817156402 gbpln780.seq
771380170 gbpln781.seq
913253142 gbpln782.seq
634934982 gbpln783.seq
1019175188 gbpln784.seq
1023638564 gbpln785.seq
822225605 gbpln786.seq
961290952 gbpln787.seq
1090804562 gbpln788.seq
813694518 gbpln789.seq
460469415 gbpln79.seq
962545328 gbpln790.seq
873725319 gbpln791.seq
673190932 gbpln792.seq
905064826 gbpln793.seq
908590682 gbpln794.seq
742712720 gbpln795.seq
793279946 gbpln796.seq
934932909 gbpln797.seq
640700840 gbpln798.seq
961568346 gbpln799.seq
226151319 gbpln8.seq
440542307 gbpln80.seq
952066709 gbpln800.seq
827214105 gbpln801.seq
455119462 gbpln802.seq
225763299 gbpln803.seq
606043562 gbpln804.seq
672463179 gbpln805.seq
670817639 gbpln806.seq
780744112 gbpln807.seq
709786566 gbpln808.seq
699981616 gbpln809.seq
452992006 gbpln81.seq
605149309 gbpln810.seq
587850601 gbpln811.seq
521338174 gbpln812.seq
584041491 gbpln813.seq
586940642 gbpln814.seq
609718059 gbpln815.seq
520752754 gbpln816.seq
615367059 gbpln817.seq
678802710 gbpln818.seq
605705354 gbpln819.seq
497916786 gbpln82.seq
527901083 gbpln820.seq
594666478 gbpln821.seq
615720930 gbpln822.seq
576353841 gbpln823.seq
633125967 gbpln824.seq
548771038 gbpln825.seq
692441980 gbpln826.seq
738372777 gbpln827.seq
858786663 gbpln828.seq
737516179 gbpln829.seq
437323942 gbpln83.seq
745059844 gbpln830.seq
651602930 gbpln831.seq
604402506 gbpln832.seq
664905906 gbpln833.seq
584308833 gbpln834.seq
534160881 gbpln835.seq
630362065 gbpln836.seq
371796208 gbpln837.seq
630301723 gbpln838.seq
687847932 gbpln839.seq
158619558 gbpln84.seq
613107925 gbpln840.seq
667786022 gbpln841.seq
650171877 gbpln842.seq
580307352 gbpln843.seq
567733852 gbpln844.seq
731990320 gbpln845.seq
671427710 gbpln846.seq
677581065 gbpln847.seq
698173275 gbpln848.seq
745221978 gbpln849.seq
495372469 gbpln85.seq
582651724 gbpln850.seq
703621804 gbpln851.seq
577456793 gbpln852.seq
645348755 gbpln853.seq
738102834 gbpln854.seq
718402114 gbpln855.seq
581705855 gbpln856.seq
731196778 gbpln857.seq
559541977 gbpln858.seq
676833493 gbpln859.seq
472129613 gbpln86.seq
5774756 gbpln860.seq
777312364 gbpln861.seq
1006352199 gbpln862.seq
962815279 gbpln863.seq
975138624 gbpln864.seq
906550423 gbpln865.seq
790269619 gbpln866.seq
956926034 gbpln867.seq
908369814 gbpln868.seq
1035806383 gbpln869.seq
477884160 gbpln87.seq
1095241384 gbpln870.seq
889046375 gbpln871.seq
920177986 gbpln872.seq
934896187 gbpln873.seq
972756494 gbpln874.seq
639243888 gbpln875.seq
839211114 gbpln876.seq
802168717 gbpln877.seq
677231763 gbpln878.seq
740101369 gbpln879.seq
460004048 gbpln88.seq
642539818 gbpln880.seq
835613563 gbpln881.seq
284703679 gbpln882.seq
252385105 gbpln883.seq
408962039 gbpln884.seq
329779393 gbpln885.seq
332794404 gbpln886.seq
418495189 gbpln887.seq
443558619 gbpln888.seq
449429603 gbpln889.seq
430418757 gbpln89.seq
403262216 gbpln890.seq
477398793 gbpln891.seq
434382503 gbpln892.seq
443534393 gbpln893.seq
467736274 gbpln894.seq
495326106 gbpln895.seq
324417462 gbpln896.seq
434627247 gbpln897.seq
412605137 gbpln898.seq
487251002 gbpln899.seq
500000209 gbpln9.seq
457901320 gbpln90.seq
475655683 gbpln900.seq
480193090 gbpln901.seq
445118180 gbpln902.seq
94040671 gbpln903.seq
598056431 gbpln904.seq
774899230 gbpln905.seq
723495076 gbpln906.seq
714415062 gbpln907.seq
677999217 gbpln908.seq
629027473 gbpln909.seq
433637010 gbpln91.seq
732833308 gbpln910.seq
468600883 gbpln911.seq
493398867 gbpln912.seq
474782478 gbpln913.seq
380660145 gbpln914.seq
467902932 gbpln915.seq
216458898 gbpln916.seq
767568440 gbpln917.seq
890586335 gbpln918.seq
628166165 gbpln919.seq
498225038 gbpln92.seq
1008494769 gbpln920.seq
987228439 gbpln921.seq
843057145 gbpln922.seq
959088226 gbpln923.seq
1080118899 gbpln924.seq
790032688 gbpln925.seq
943744807 gbpln926.seq
858758922 gbpln927.seq
664109823 gbpln928.seq
920678547 gbpln929.seq
107502928 gbpln93.seq
888501596 gbpln930.seq
739915903 gbpln931.seq
788736235 gbpln932.seq
944601114 gbpln933.seq
621465898 gbpln934.seq
948555730 gbpln935.seq
954911742 gbpln936.seq
815610130 gbpln937.seq
39280851 gbpln938.seq
752395251 gbpln939.seq
449964742 gbpln94.seq
890282441 gbpln940.seq
626588937 gbpln941.seq
1004358313 gbpln942.seq
1028945402 gbpln943.seq
838465030 gbpln944.seq
950517847 gbpln945.seq
1082441570 gbpln946.seq
789583361 gbpln947.seq
950035125 gbpln948.seq
853507173 gbpln949.seq
422837725 gbpln95.seq
659807142 gbpln950.seq
902654821 gbpln951.seq
890952839 gbpln952.seq
721824594 gbpln953.seq
785634142 gbpln954.seq
909002040 gbpln955.seq
625532225 gbpln956.seq
945667284 gbpln957.seq
953425672 gbpln958.seq
821771931 gbpln959.seq
383453843 gbpln96.seq
49698386 gbpln960.seq
685150899 gbpln961.seq
568933027 gbpln962.seq
539200626 gbpln963.seq
586715337 gbpln964.seq
614749899 gbpln965.seq
568071234 gbpln966.seq
625152378 gbpln967.seq
586214092 gbpln968.seq
746226296 gbpln969.seq
376172115 gbpln97.seq
808684288 gbpln970.seq
907082737 gbpln971.seq
776688083 gbpln972.seq
793241145 gbpln973.seq
698856854 gbpln974.seq
613367840 gbpln975.seq
674018924 gbpln976.seq
609236553 gbpln977.seq
576790823 gbpln978.seq
632369034 gbpln979.seq
326317072 gbpln98.seq
377507387 gbpln980.seq
669127646 gbpln981.seq
466230785 gbpln982.seq
475319447 gbpln983.seq
488174614 gbpln984.seq
318504233 gbpln985.seq
198078967 gbpln986.seq
752395251 gbpln987.seq
890282441 gbpln988.seq
626588937 gbpln989.seq
320571252 gbpln99.seq
1004358313 gbpln990.seq
1028945402 gbpln991.seq
838465030 gbpln992.seq
950517847 gbpln993.seq
1082441570 gbpln994.seq
789583361 gbpln995.seq
950035125 gbpln996.seq
853507173 gbpln997.seq
659807142 gbpln998.seq
902654821 gbpln999.seq
148373644 gbpri1.seq
499825465 gbpri10.seq
499966274 gbpri11.seq
248882813 gbpri12.seq
499849548 gbpri13.seq
352976263 gbpri14.seq
162643090 gbpri15.seq
494713563 gbpri16.seq
499956353 gbpri17.seq
499952905 gbpri18.seq
499962231 gbpri19.seq
499849640 gbpri2.seq
254317986 gbpri20.seq
317623611 gbpri21.seq
301999314 gbpri22.seq
491210460 gbpri23.seq
445784960 gbpri24.seq
381564599 gbpri25.seq
343180411 gbpri26.seq
476587789 gbpri27.seq
474072403 gbpri28.seq
368094098 gbpri29.seq
499891275 gbpri3.seq
499998138 gbpri30.seq
73923753 gbpri31.seq
499936200 gbpri32.seq
445709575 gbpri33.seq
427947001 gbpri34.seq
376529642 gbpri35.seq
483909975 gbpri36.seq
361488390 gbpri37.seq
388660134 gbpri38.seq
448630862 gbpri39.seq
499855408 gbpri4.seq
499942041 gbpri40.seq
307422469 gbpri41.seq
314630532 gbpri42.seq
499799958 gbpri43.seq
499997873 gbpri44.seq
213880838 gbpri45.seq
499999780 gbpri46.seq
499997691 gbpri47.seq
316411730 gbpri48.seq
499989643 gbpri49.seq
499729176 gbpri5.seq
499990638 gbpri50.seq
327043735 gbpri51.seq
258775295 gbpri52.seq
499996624 gbpri53.seq
499998512 gbpri54.seq
499942384 gbpri55.seq
499997503 gbpri56.seq
357963220 gbpri57.seq
393528728 gbpri6.seq
499802910 gbpri7.seq
499984899 gbpri8.seq
499967070 gbpri9.seq
965286 gbrel.txt
499840263 gbrod1.seq
499998469 gbrod10.seq
413360146 gbrod100.seq
419878182 gbrod101.seq
403492494 gbrod102.seq
439526332 gbrod103.seq
248164111 gbrod104.seq
405939473 gbrod105.seq
384447340 gbrod106.seq
355679333 gbrod107.seq
497729616 gbrod108.seq
445498035 gbrod109.seq
6033902 gbrod11.seq
466416387 gbrod110.seq
384594494 gbrod111.seq
370764567 gbrod112.seq
352341932 gbrod113.seq
472534897 gbrod114.seq
442899850 gbrod115.seq
391247240 gbrod116.seq
302308728 gbrod117.seq
480858122 gbrod118.seq
424097302 gbrod119.seq
499806089 gbrod12.seq
389168953 gbrod120.seq
364557408 gbrod121.seq
496236266 gbrod122.seq
457035537 gbrod123.seq
397907216 gbrod124.seq
303919253 gbrod125.seq
472719372 gbrod126.seq
199611566 gbrod127.seq
379735208 gbrod128.seq
373874236 gbrod129.seq
203924668 gbrod13.seq
492612107 gbrod130.seq
455685049 gbrod131.seq
424015225 gbrod132.seq
422109961 gbrod133.seq
402489078 gbrod134.seq
150585215 gbrod135.seq
432875924 gbrod136.seq
473809988 gbrod137.seq
493341944 gbrod138.seq
369899434 gbrod139.seq
499995274 gbrod14.seq
352286248 gbrod140.seq
495134062 gbrod141.seq
469349893 gbrod142.seq
385134441 gbrod143.seq
370752989 gbrod144.seq
350782953 gbrod145.seq
472215298 gbrod146.seq
440418647 gbrod147.seq
390673256 gbrod148.seq
299732413 gbrod149.seq
499997002 gbrod15.seq
469102685 gbrod150.seq
389834819 gbrod151.seq
372942018 gbrod152.seq
357041751 gbrod153.seq
471802981 gbrod154.seq
442335356 gbrod155.seq
272062219 gbrod156.seq
421368094 gbrod157.seq
465159875 gbrod158.seq
385490257 gbrod159.seq
499997612 gbrod16.seq
365814425 gbrod160.seq
349038378 gbrod161.seq
318450016 gbrod162.seq
448518533 gbrod163.seq
413714740 gbrod164.seq
419290195 gbrod165.seq
466211866 gbrod166.seq
387893635 gbrod167.seq
186742583 gbrod168.seq
369103842 gbrod169.seq
296336537 gbrod17.seq
487915723 gbrod170.seq
450102561 gbrod171.seq
413892753 gbrod172.seq
419378521 gbrod173.seq
249506719 gbrod174.seq
431031986 gbrod175.seq
392811039 gbrod176.seq
374963024 gbrod177.seq
339853098 gbrod178.seq
465902366 gbrod179.seq
408596853 gbrod18.seq
448509046 gbrod180.seq
478088985 gbrod181.seq
74225189 gbrod182.seq
401026287 gbrod183.seq
438450513 gbrod184.seq
392223411 gbrod185.seq
298791488 gbrod186.seq
421037306 gbrod187.seq
377024222 gbrod188.seq
358182039 gbrod189.seq
485622431 gbrod19.seq
498127194 gbrod190.seq
395007403 gbrod191.seq
420940299 gbrod192.seq
420418108 gbrod193.seq
416033149 gbrod194.seq
371638158 gbrod195.seq
168940443 gbrod196.seq
344507393 gbrod197.seq
318954535 gbrod198.seq
344516821 gbrod199.seq
499801667 gbrod2.seq
447177606 gbrod20.seq
342695770 gbrod200.seq
464792186 gbrod201.seq
401018426 gbrod202.seq
244981400 gbrod203.seq
424020455 gbrod204.seq
445077763 gbrod205.seq
471066620 gbrod206.seq
463756029 gbrod207.seq
477523791 gbrod208.seq
429214893 gbrod209.seq
401874104 gbrod21.seq
482809898 gbrod210.seq
409881666 gbrod211.seq
499005744 gbrod212.seq
445425390 gbrod213.seq
453009972 gbrod214.seq
238222178 gbrod215.seq
433121687 gbrod216.seq
401444461 gbrod217.seq
355166120 gbrod218.seq
439733945 gbrod219.seq
366906621 gbrod22.seq
399262915 gbrod220.seq
343303814 gbrod221.seq
449604401 gbrod222.seq
373291356 gbrod223.seq
491021867 gbrod224.seq
411878942 gbrod225.seq
394783112 gbrod226.seq
354215147 gbrod227.seq
478827549 gbrod228.seq
464689320 gbrod229.seq
178573599 gbrod23.seq
496457781 gbrod230.seq
328639335 gbrod231.seq
429295912 gbrod232.seq
201904361 gbrod233.seq
381229576 gbrod234.seq
352252100 gbrod235.seq
483911001 gbrod236.seq
439271128 gbrod237.seq
432391884 gbrod238.seq
379422136 gbrod239.seq
488460696 gbrod24.seq
487314628 gbrod240.seq
424101431 gbrod241.seq
402251656 gbrod242.seq
377306384 gbrod243.seq
496030481 gbrod244.seq
476084602 gbrod245.seq
404173831 gbrod246.seq
121703297 gbrod247.seq
471718554 gbrod248.seq
429849644 gbrod249.seq
424418862 gbrod25.seq
369205357 gbrod250.seq
458471717 gbrod251.seq
410175604 gbrod252.seq
423146610 gbrod253.seq
172228268 gbrod254.seq
492401067 gbrod255.seq
487467397 gbrod256.seq
412574887 gbrod257.seq
371643290 gbrod258.seq
458445658 gbrod259.seq
451727059 gbrod26.seq
395932157 gbrod260.seq
429793810 gbrod261.seq
490297286 gbrod262.seq
410121996 gbrod263.seq
409184503 gbrod264.seq
367837774 gbrod265.seq
447381136 gbrod266.seq
223327565 gbrod267.seq
402425622 gbrod268.seq
448449857 gbrod269.seq
499112036 gbrod27.seq
461815006 gbrod270.seq
478700924 gbrod271.seq
408314221 gbrod272.seq
349093340 gbrod273.seq
455227074 gbrod274.seq
454883295 gbrod275.seq
483614724 gbrod276.seq
369373092 gbrod277.seq
442583968 gbrod278.seq
421061266 gbrod279.seq
467946548 gbrod28.seq
196273488 gbrod280.seq
350815101 gbrod281.seq
431195894 gbrod282.seq
436876327 gbrod283.seq
495700637 gbrod284.seq
383320388 gbrod285.seq
457101351 gbrod286.seq
410386577 gbrod287.seq
373894312 gbrod288.seq
447245565 gbrod289.seq
425428799 gbrod29.seq
442554857 gbrod290.seq
496529716 gbrod291.seq
438732151 gbrod292.seq
404017310 gbrod293.seq
417018539 gbrod294.seq
194574877 gbrod295.seq
493375331 gbrod296.seq
407058545 gbrod297.seq
420360712 gbrod298.seq
497137694 gbrod299.seq
499860799 gbrod3.seq
380509124 gbrod30.seq
453023593 gbrod300.seq
359291146 gbrod31.seq
441031541 gbrod32.seq
489661762 gbrod33.seq
301541840 gbrod34.seq
245696968 gbrod35.seq
444533522 gbrod36.seq
404901396 gbrod37.seq
350079181 gbrod38.seq
484303888 gbrod39.seq
499965631 gbrod4.seq
464197213 gbrod40.seq
311672321 gbrod41.seq
441713729 gbrod42.seq
398906813 gbrod43.seq
493373336 gbrod44.seq
407105696 gbrod45.seq
117842878 gbrod46.seq
488265022 gbrod47.seq
434197329 gbrod48.seq
412800312 gbrod49.seq
499960342 gbrod5.seq
454365663 gbrod50.seq
382748472 gbrod51.seq
428038719 gbrod52.seq
487918369 gbrod53.seq
440586747 gbrod54.seq
359290553 gbrod55.seq
497175412 gbrod56.seq
258123670 gbrod57.seq
390007635 gbrod58.seq
346418766 gbrod59.seq
80291490 gbrod6.seq
345548222 gbrod60.seq
465925928 gbrod61.seq
403537722 gbrod62.seq
386823577 gbrod63.seq
403462511 gbrod64.seq
391812927 gbrod65.seq
346719868 gbrod66.seq
491742089 gbrod67.seq
445010312 gbrod68.seq
493387550 gbrod69.seq
499846851 gbrod7.seq
300864949 gbrod70.seq
466768965 gbrod71.seq
374387663 gbrod72.seq
350248940 gbrod73.seq
470230178 gbrod74.seq
465917437 gbrod75.seq
493546372 gbrod76.seq
164945760 gbrod77.seq
403745653 gbrod78.seq
436915885 gbrod79.seq
499742719 gbrod8.seq
473498938 gbrod80.seq
494867130 gbrod81.seq
353125249 gbrod82.seq
339090141 gbrod83.seq
372648418 gbrod84.seq
304437664 gbrod85.seq
466850317 gbrod86.seq
387285794 gbrod87.seq
374061084 gbrod88.seq
353646449 gbrod89.seq
499945822 gbrod9.seq
160857005 gbrod90.seq
461956462 gbrod91.seq
433837684 gbrod92.seq
474478559 gbrod93.seq
316311284 gbrod94.seq
418985554 gbrod95.seq
371050540 gbrod96.seq
363244189 gbrod97.seq
482685615 gbrod98.seq
448001147 gbrod99.seq
499999210 gbsts1.seq
499999465 gbsts10.seq
433588179 gbsts11.seq
499995933 gbsts2.seq
38302306 gbsts3.seq
499998792 gbsts4.seq
499998127 gbsts5.seq
456725186 gbsts6.seq
499997583 gbsts7.seq
500000071 gbsts8.seq
21007264 gbsts9.seq
300842146 gbsyn1.seq
484840372 gbsyn10.seq
420813753 gbsyn11.seq
490139440 gbsyn12.seq
343340422 gbsyn13.seq
372527348 gbsyn14.seq
417861289 gbsyn15.seq
448312981 gbsyn16.seq
416378132 gbsyn17.seq
453065790 gbsyn18.seq
263307032 gbsyn19.seq
343340424 gbsyn2.seq
484840366 gbsyn20.seq
420813747 gbsyn21.seq
498979310 gbsyn22.seq
499997324 gbsyn23.seq
355478126 gbsyn24.seq
499993129 gbsyn25.seq
499996930 gbsyn26.seq
499994826 gbsyn27.seq
248288618 gbsyn28.seq
411842328 gbsyn29.seq
372527353 gbsyn3.seq
417861297 gbsyn4.seq
448312992 gbsyn5.seq
81377357 gbsyn6.seq
470781602 gbsyn7.seq
317285242 gbsyn8.seq
263307034 gbsyn9.seq
499999170 gbtsa1.seq
499999488 gbtsa10.seq
499997439 gbtsa100.seq
499999811 gbtsa101.seq
499996108 gbtsa102.seq
404671505 gbtsa103.seq
499996434 gbtsa104.seq
499998444 gbtsa105.seq
499998535 gbtsa106.seq
473627173 gbtsa107.seq
499999949 gbtsa108.seq
499998832 gbtsa109.seq
499998190 gbtsa11.seq
236669988 gbtsa110.seq
499991596 gbtsa111.seq
499999834 gbtsa112.seq
499999770 gbtsa113.seq
499998939 gbtsa114.seq
34150369 gbtsa115.seq
499995781 gbtsa116.seq
499999069 gbtsa117.seq
499994937 gbtsa118.seq
470659755 gbtsa119.seq
280433046 gbtsa12.seq
499998218 gbtsa120.seq
499998672 gbtsa121.seq
499999924 gbtsa122.seq
280313902 gbtsa123.seq
499999116 gbtsa124.seq
499998111 gbtsa125.seq
499999818 gbtsa126.seq
423256101 gbtsa127.seq
499996305 gbtsa13.seq
499999062 gbtsa14.seq
161780319 gbtsa15.seq
500000121 gbtsa16.seq
499997432 gbtsa17.seq
259479616 gbtsa18.seq
499997528 gbtsa19.seq
499999528 gbtsa2.seq
499999892 gbtsa20.seq
499999279 gbtsa21.seq
67906184 gbtsa22.seq
499999436 gbtsa23.seq
500000013 gbtsa24.seq
500000024 gbtsa25.seq
284374599 gbtsa26.seq
499999143 gbtsa27.seq
499999640 gbtsa28.seq
77188803 gbtsa29.seq
147857334 gbtsa3.seq
499999538 gbtsa30.seq
499999548 gbtsa31.seq
158361727 gbtsa32.seq
499997307 gbtsa33.seq
499998520 gbtsa34.seq
499999864 gbtsa35.seq
490728683 gbtsa36.seq
499999905 gbtsa37.seq
499998822 gbtsa38.seq
500000094 gbtsa39.seq
499998486 gbtsa4.seq
230839415 gbtsa40.seq
499998690 gbtsa41.seq
499998905 gbtsa42.seq
500000201 gbtsa43.seq
177161025 gbtsa44.seq
499998570 gbtsa45.seq
499998681 gbtsa46.seq
355874045 gbtsa47.seq
499999532 gbtsa48.seq
499999056 gbtsa49.seq
499998583 gbtsa5.seq
298479435 gbtsa50.seq
499997916 gbtsa51.seq
499995944 gbtsa52.seq
402535227 gbtsa53.seq
499999696 gbtsa54.seq
499997992 gbtsa55.seq
499998333 gbtsa56.seq
343934196 gbtsa57.seq
499999894 gbtsa58.seq
499999312 gbtsa59.seq
58524370 gbtsa6.seq
499996663 gbtsa60.seq
226713372 gbtsa61.seq
499999722 gbtsa62.seq
499999282 gbtsa63.seq
260001225 gbtsa64.seq
499999567 gbtsa65.seq
464262990 gbtsa66.seq
499998462 gbtsa67.seq
499999620 gbtsa68.seq
499998268 gbtsa69.seq
499998361 gbtsa7.seq
168770314 gbtsa70.seq
499997567 gbtsa71.seq
500000162 gbtsa72.seq
499998185 gbtsa73.seq
2512297 gbtsa74.seq
499998125 gbtsa75.seq
499999999 gbtsa76.seq
131338866 gbtsa77.seq
500000012 gbtsa78.seq
499999875 gbtsa79.seq
499999892 gbtsa8.seq
34997856 gbtsa80.seq
499999375 gbtsa81.seq
499997355 gbtsa82.seq
499996990 gbtsa83.seq
499997400 gbtsa84.seq
48843479 gbtsa85.seq
499997725 gbtsa86.seq
499999047 gbtsa87.seq
499998830 gbtsa88.seq
83128617 gbtsa89.seq
274523742 gbtsa9.seq
499998662 gbtsa90.seq
390370134 gbtsa91.seq
499998191 gbtsa92.seq
499994249 gbtsa93.seq
499998640 gbtsa94.seq
208350764 gbtsa95.seq
499999734 gbtsa96.seq
499998253 gbtsa97.seq
499996332 gbtsa98.seq
230879944 gbtsa99.seq
7047858 gbuna1.seq
499998024 gbvrl1.seq
499999541 gbvrl10.seq
499999493 gbvrl100.seq
196479349 gbvrl101.seq
499966798 gbvrl102.seq
499950769 gbvrl103.seq
499954784 gbvrl104.seq
247136499 gbvrl105.seq
499971946 gbvrl106.seq
499976238 gbvrl107.seq
499951234 gbvrl108.seq
444586577 gbvrl109.seq
499998942 gbvrl11.seq
499945125 gbvrl110.seq
499988943 gbvrl111.seq
499997408 gbvrl112.seq
145498512 gbvrl113.seq
499985878 gbvrl114.seq
499940794 gbvrl115.seq
499976702 gbvrl116.seq
499941021 gbvrl117.seq
8848480 gbvrl118.seq
499995041 gbvrl119.seq
499980799 gbvrl12.seq
499981765 gbvrl120.seq
499934315 gbvrl121.seq
259007033 gbvrl122.seq
499954289 gbvrl123.seq
499974106 gbvrl124.seq
499940379 gbvrl125.seq
499933528 gbvrl126.seq
8758435 gbvrl127.seq
499960243 gbvrl128.seq
499935952 gbvrl129.seq
163637829 gbvrl13.seq
499996041 gbvrl130.seq
499960881 gbvrl131.seq
314898335 gbvrl132.seq
499962058 gbvrl133.seq
499981138 gbvrl134.seq
499984933 gbvrl135.seq
499965259 gbvrl136.seq
499976578 gbvrl137.seq
225739938 gbvrl138.seq
499977611 gbvrl139.seq
499997372 gbvrl14.seq
499973738 gbvrl140.seq
499972748 gbvrl141.seq
322559158 gbvrl142.seq
499982106 gbvrl143.seq
499975547 gbvrl144.seq
499985975 gbvrl145.seq
298275132 gbvrl146.seq
499949846 gbvrl147.seq
499957531 gbvrl148.seq
499940698 gbvrl149.seq
499998185 gbvrl15.seq
184227171 gbvrl150.seq
499971194 gbvrl151.seq
499938705 gbvrl152.seq
499957266 gbvrl153.seq
499993194 gbvrl154.seq
261348031 gbvrl155.seq
499965324 gbvrl156.seq
499939370 gbvrl157.seq
499968448 gbvrl158.seq
238422410 gbvrl159.seq
133976190 gbvrl16.seq
499998344 gbvrl160.seq
499954453 gbvrl161.seq
499981519 gbvrl162.seq
499952605 gbvrl163.seq
266076402 gbvrl164.seq
499967672 gbvrl165.seq
499932963 gbvrl166.seq
499950301 gbvrl167.seq
499957010 gbvrl168.seq
227905545 gbvrl169.seq
499999839 gbvrl17.seq
499966325 gbvrl170.seq
499973376 gbvrl171.seq
499940956 gbvrl172.seq
336667595 gbvrl173.seq
499980273 gbvrl174.seq
499947913 gbvrl175.seq
499959950 gbvrl176.seq
134045898 gbvrl177.seq
499958613 gbvrl178.seq
499960804 gbvrl179.seq
499998985 gbvrl18.seq
499987154 gbvrl180.seq
152774280 gbvrl181.seq
499989579 gbvrl182.seq
499983455 gbvrl183.seq
499985524 gbvrl184.seq
490732962 gbvrl185.seq
499942504 gbvrl186.seq
499972323 gbvrl187.seq
499959059 gbvrl188.seq
499962039 gbvrl189.seq
315252095 gbvrl19.seq
5150801 gbvrl190.seq
499990413 gbvrl191.seq
499947567 gbvrl192.seq
499956010 gbvrl193.seq
175212001 gbvrl194.seq
499955138 gbvrl195.seq
499943102 gbvrl196.seq
499953251 gbvrl197.seq
499974955 gbvrl198.seq
266046673 gbvrl199.seq
499998888 gbvrl2.seq
499997753 gbvrl20.seq
499949125 gbvrl200.seq
499995400 gbvrl201.seq
499943777 gbvrl202.seq
499978288 gbvrl203.seq
278622186 gbvrl204.seq
499995509 gbvrl205.seq
499969619 gbvrl206.seq
499996760 gbvrl207.seq
499942690 gbvrl208.seq
310405032 gbvrl209.seq
499995731 gbvrl21.seq
499962299 gbvrl210.seq
499985519 gbvrl211.seq
499960303 gbvrl212.seq
499974442 gbvrl213.seq
284609178 gbvrl214.seq
499991791 gbvrl215.seq
499984806 gbvrl216.seq
499966951 gbvrl217.seq
499966931 gbvrl218.seq
267326045 gbvrl219.seq
345042918 gbvrl22.seq
499967874 gbvrl220.seq
499947022 gbvrl221.seq
499971008 gbvrl222.seq
499947832 gbvrl223.seq
282072473 gbvrl224.seq
499993036 gbvrl225.seq
499996759 gbvrl226.seq
499988074 gbvrl227.seq
499956095 gbvrl228.seq
281602267 gbvrl229.seq
499999129 gbvrl23.seq
499943753 gbvrl230.seq
499945390 gbvrl231.seq
499963339 gbvrl232.seq
499933861 gbvrl233.seq
272168655 gbvrl234.seq
499965401 gbvrl235.seq
499986586 gbvrl236.seq
499999501 gbvrl237.seq
499952670 gbvrl238.seq
236225905 gbvrl239.seq
499999421 gbvrl24.seq
499967117 gbvrl240.seq
499964692 gbvrl241.seq
499937904 gbvrl242.seq
499977305 gbvrl243.seq
260936517 gbvrl244.seq
499955249 gbvrl245.seq
499946112 gbvrl246.seq
499964144 gbvrl247.seq
499946558 gbvrl248.seq
262003463 gbvrl249.seq
369234991 gbvrl25.seq
499988486 gbvrl250.seq
499964398 gbvrl251.seq
499993543 gbvrl252.seq
499963987 gbvrl253.seq
261519361 gbvrl254.seq
499996215 gbvrl255.seq
499956991 gbvrl256.seq
499970605 gbvrl257.seq
135826763 gbvrl258.seq
499985373 gbvrl259.seq
499997246 gbvrl26.seq
499939366 gbvrl260.seq
499937016 gbvrl261.seq
143689424 gbvrl262.seq
499975547 gbvrl263.seq
499992483 gbvrl264.seq
499933477 gbvrl265.seq
499960699 gbvrl266.seq
499956436 gbvrl267.seq
499950744 gbvrl268.seq
242326481 gbvrl269.seq
499997176 gbvrl27.seq
499992824 gbvrl270.seq
499953306 gbvrl271.seq
499987451 gbvrl272.seq
499951664 gbvrl273.seq
252200854 gbvrl274.seq
499934723 gbvrl275.seq
499942327 gbvrl276.seq
499972085 gbvrl277.seq
499933904 gbvrl278.seq
259828859 gbvrl279.seq
313907711 gbvrl28.seq
499973107 gbvrl280.seq
499955856 gbvrl281.seq
499980883 gbvrl282.seq
499947539 gbvrl283.seq
419157758 gbvrl284.seq
499986608 gbvrl285.seq
499993239 gbvrl286.seq
499947087 gbvrl287.seq
165261586 gbvrl288.seq
499970770 gbvrl289.seq
499961522 gbvrl29.seq
499934626 gbvrl290.seq
499964378 gbvrl291.seq
226563801 gbvrl292.seq
499938765 gbvrl293.seq
499958807 gbvrl294.seq
499998638 gbvrl295.seq
307688634 gbvrl296.seq
499984868 gbvrl297.seq
499986674 gbvrl298.seq
499983952 gbvrl299.seq
499982631 gbvrl3.seq
499998395 gbvrl30.seq
267104810 gbvrl300.seq
499947999 gbvrl301.seq
499965447 gbvrl302.seq
499975643 gbvrl303.seq
371074205 gbvrl304.seq
499944411 gbvrl305.seq
499980624 gbvrl306.seq
499969846 gbvrl307.seq
384620894 gbvrl308.seq
499972734 gbvrl309.seq
499964334 gbvrl31.seq
499984053 gbvrl310.seq
499991947 gbvrl311.seq
499979823 gbvrl312.seq
22323878 gbvrl313.seq
499950508 gbvrl314.seq
499991178 gbvrl315.seq
499987602 gbvrl316.seq
268497265 gbvrl317.seq
499941238 gbvrl318.seq
499976760 gbvrl319.seq
347284976 gbvrl32.seq
499968875 gbvrl320.seq
247221488 gbvrl321.seq
499996037 gbvrl322.seq
499983469 gbvrl323.seq
499969184 gbvrl324.seq
163407664 gbvrl325.seq
499997786 gbvrl326.seq
499950075 gbvrl327.seq
499971452 gbvrl328.seq
499979384 gbvrl329.seq
499997641 gbvrl33.seq
68188474 gbvrl330.seq
499951301 gbvrl331.seq
499945433 gbvrl332.seq
499990893 gbvrl333.seq
462708056 gbvrl334.seq
499971146 gbvrl335.seq
499947096 gbvrl336.seq
499958554 gbvrl337.seq
499952907 gbvrl338.seq
728655 gbvrl339.seq
499960010 gbvrl34.seq
499951782 gbvrl340.seq
499951054 gbvrl341.seq
499969335 gbvrl342.seq
499994748 gbvrl343.seq
145734526 gbvrl344.seq
499978270 gbvrl345.seq
499942806 gbvrl346.seq
499940355 gbvrl347.seq
189464476 gbvrl348.seq
499994988 gbvrl349.seq
431569348 gbvrl35.seq
499962285 gbvrl350.seq
499965349 gbvrl351.seq
448546791 gbvrl352.seq
499959557 gbvrl353.seq
499979597 gbvrl354.seq
499962854 gbvrl355.seq
221307917 gbvrl356.seq
499983757 gbvrl357.seq
499987313 gbvrl358.seq
499976078 gbvrl359.seq
499996327 gbvrl36.seq
359441421 gbvrl360.seq
499999763 gbvrl361.seq
499955465 gbvrl362.seq
499995321 gbvrl363.seq
499940485 gbvrl364.seq
152763900 gbvrl365.seq
499940695 gbvrl366.seq
499933273 gbvrl367.seq
499964922 gbvrl368.seq
493838590 gbvrl369.seq
500000076 gbvrl37.seq
499987555 gbvrl370.seq
499942150 gbvrl371.seq
499971688 gbvrl372.seq
495863938 gbvrl373.seq
499940976 gbvrl374.seq
499981427 gbvrl375.seq
499961611 gbvrl376.seq
277063126 gbvrl377.seq
499955345 gbvrl378.seq
499966970 gbvrl379.seq
426524103 gbvrl38.seq
499939745 gbvrl380.seq
259383097 gbvrl381.seq
499979056 gbvrl382.seq
499941396 gbvrl383.seq
499941446 gbvrl384.seq
234494235 gbvrl385.seq
499953265 gbvrl386.seq
499947663 gbvrl387.seq
499935875 gbvrl388.seq
297696967 gbvrl389.seq
499998264 gbvrl39.seq
499984305 gbvrl390.seq
499997808 gbvrl391.seq
499987512 gbvrl392.seq
220974830 gbvrl393.seq
499990233 gbvrl394.seq
499951450 gbvrl395.seq
499954765 gbvrl396.seq
162289252 gbvrl397.seq
499998039 gbvrl398.seq
499998239 gbvrl399.seq
310824648 gbvrl4.seq
499937334 gbvrl40.seq
499957119 gbvrl400.seq
230611428 gbvrl401.seq
499986591 gbvrl402.seq
499998102 gbvrl403.seq
499995268 gbvrl404.seq
457294403 gbvrl405.seq
499967011 gbvrl406.seq
499954739 gbvrl407.seq
499984939 gbvrl408.seq
414094020 gbvrl409.seq
499946171 gbvrl41.seq
499954450 gbvrl410.seq
499954218 gbvrl411.seq
499956240 gbvrl412.seq
187514998 gbvrl413.seq
499966803 gbvrl414.seq
499954137 gbvrl415.seq
499973194 gbvrl416.seq
241682345 gbvrl417.seq
499947222 gbvrl418.seq
499979873 gbvrl419.seq
324960994 gbvrl42.seq
499963302 gbvrl420.seq
208827545 gbvrl421.seq
499944050 gbvrl422.seq
499955652 gbvrl423.seq
499938208 gbvrl424.seq
400010586 gbvrl425.seq
499996551 gbvrl426.seq
499956076 gbvrl427.seq
499993841 gbvrl428.seq
296703516 gbvrl429.seq
499967715 gbvrl43.seq
499946144 gbvrl430.seq
499964513 gbvrl431.seq
499969532 gbvrl432.seq
379587541 gbvrl433.seq
499958453 gbvrl434.seq
499957218 gbvrl435.seq
499997268 gbvrl436.seq
499960128 gbvrl437.seq
115257743 gbvrl438.seq
499944168 gbvrl439.seq
499408142 gbvrl44.seq
499971441 gbvrl440.seq
499973502 gbvrl441.seq
202955713 gbvrl442.seq
499984732 gbvrl443.seq
499955417 gbvrl444.seq
499993984 gbvrl445.seq
499947345 gbvrl446.seq
499946678 gbvrl447.seq
396624177 gbvrl448.seq
499970676 gbvrl449.seq
499995657 gbvrl45.seq
499973368 gbvrl450.seq
499942083 gbvrl451.seq
281299677 gbvrl452.seq
499958542 gbvrl453.seq
499954304 gbvrl454.seq
499978183 gbvrl455.seq
158226128 gbvrl456.seq
499968876 gbvrl457.seq
499975962 gbvrl458.seq
499964419 gbvrl459.seq
298395368 gbvrl46.seq
379599804 gbvrl460.seq
499969312 gbvrl461.seq
499960058 gbvrl462.seq
499984374 gbvrl463.seq
499995166 gbvrl464.seq
269945364 gbvrl465.seq
499990058 gbvrl466.seq
499954921 gbvrl467.seq
499947563 gbvrl468.seq
275190841 gbvrl469.seq
499986863 gbvrl47.seq
499975597 gbvrl470.seq
499954064 gbvrl471.seq
499939356 gbvrl472.seq
335383084 gbvrl473.seq
499974122 gbvrl474.seq
499969115 gbvrl475.seq
499999515 gbvrl476.seq
275758487 gbvrl477.seq
499961449 gbvrl478.seq
499956858 gbvrl479.seq
499994758 gbvrl48.seq
499965720 gbvrl480.seq
285813244 gbvrl481.seq
499970058 gbvrl482.seq
499991140 gbvrl483.seq
499968333 gbvrl484.seq
452213394 gbvrl485.seq
499958042 gbvrl486.seq
499959057 gbvrl487.seq
499690922 gbvrl488.seq
462401826 gbvrl489.seq
499997583 gbvrl49.seq
499937845 gbvrl490.seq
499985643 gbvrl491.seq
499936856 gbvrl492.seq
500000061 gbvrl493.seq
499963386 gbvrl494.seq
499964167 gbvrl495.seq
229385612 gbvrl496.seq
499987276 gbvrl497.seq
499956188 gbvrl498.seq
499956335 gbvrl499.seq
499999330 gbvrl5.seq
362597298 gbvrl50.seq
499993334 gbvrl500.seq
241149499 gbvrl501.seq
499977127 gbvrl502.seq
499962932 gbvrl503.seq
499997682 gbvrl504.seq
271326163 gbvrl505.seq
499980061 gbvrl506.seq
499997976 gbvrl507.seq
499964216 gbvrl508.seq
183846441 gbvrl509.seq
499963643 gbvrl51.seq
499974432 gbvrl510.seq
499998524 gbvrl511.seq
499988983 gbvrl512.seq
215865424 gbvrl513.seq
499971888 gbvrl514.seq
499951450 gbvrl515.seq
499995874 gbvrl516.seq
226305088 gbvrl517.seq
499957072 gbvrl518.seq
499983743 gbvrl519.seq
499946869 gbvrl52.seq
499943583 gbvrl520.seq
499966712 gbvrl521.seq
323187012 gbvrl522.seq
499939269 gbvrl523.seq
499970690 gbvrl524.seq
499984118 gbvrl525.seq
499978421 gbvrl526.seq
328675524 gbvrl527.seq
499977749 gbvrl528.seq
499978824 gbvrl529.seq
499969379 gbvrl53.seq
499986300 gbvrl530.seq
499949195 gbvrl531.seq
413139443 gbvrl532.seq
499977849 gbvrl533.seq
499935080 gbvrl534.seq
499953131 gbvrl535.seq
287929098 gbvrl536.seq
499947826 gbvrl537.seq
499988233 gbvrl538.seq
499974585 gbvrl539.seq
283792117 gbvrl54.seq
324215214 gbvrl540.seq
499984901 gbvrl541.seq
499974352 gbvrl542.seq
499973125 gbvrl543.seq
499968326 gbvrl544.seq
100495667 gbvrl545.seq
499986500 gbvrl546.seq
499966758 gbvrl547.seq
499958280 gbvrl548.seq
219323215 gbvrl549.seq
499974759 gbvrl55.seq
499984603 gbvrl550.seq
499956486 gbvrl551.seq
499964306 gbvrl552.seq
282563595 gbvrl553.seq
499979765 gbvrl554.seq
499983021 gbvrl555.seq
499968825 gbvrl556.seq
188826432 gbvrl557.seq
499958584 gbvrl558.seq
499934145 gbvrl559.seq
499933972 gbvrl56.seq
499954762 gbvrl560.seq
183687231 gbvrl561.seq
499970666 gbvrl562.seq
499953417 gbvrl563.seq
499941468 gbvrl564.seq
161733085 gbvrl565.seq
499960155 gbvrl566.seq
499993841 gbvrl567.seq
499941632 gbvrl568.seq
185444975 gbvrl569.seq
499968831 gbvrl57.seq
499933221 gbvrl570.seq
499970953 gbvrl571.seq
499693299 gbvrl572.seq
277845412 gbvrl573.seq
499960182 gbvrl574.seq
499996039 gbvrl575.seq
499956785 gbvrl576.seq
245028833 gbvrl577.seq
499968707 gbvrl578.seq
499933573 gbvrl579.seq
500000244 gbvrl58.seq
499980397 gbvrl580.seq
177140861 gbvrl581.seq
499943894 gbvrl582.seq
499948365 gbvrl583.seq
499936236 gbvrl584.seq
499987544 gbvrl585.seq
499775235 gbvrl586.seq
499938287 gbvrl587.seq
270892153 gbvrl588.seq
491838696 gbvrl589.seq
195418107 gbvrl59.seq
499992498 gbvrl590.seq
252600862 gbvrl591.seq
76688277 gbvrl592.seq
499994644 gbvrl593.seq
499965832 gbvrl594.seq
499992766 gbvrl595.seq
249246445 gbvrl596.seq
499997356 gbvrl597.seq
499968021 gbvrl598.seq
499975157 gbvrl599.seq
499995589 gbvrl6.seq
499974161 gbvrl60.seq
277362516 gbvrl600.seq
499986328 gbvrl601.seq
499998041 gbvrl602.seq
499991373 gbvrl603.seq
172223328 gbvrl604.seq
499974416 gbvrl605.seq
499965555 gbvrl606.seq
499999523 gbvrl607.seq
145010935 gbvrl608.seq
499994253 gbvrl609.seq
499998208 gbvrl61.seq
499995803 gbvrl610.seq
499991262 gbvrl611.seq
256692149 gbvrl612.seq
499977192 gbvrl613.seq
499989563 gbvrl614.seq
499977781 gbvrl615.seq
139016222 gbvrl616.seq
499971782 gbvrl617.seq
499992483 gbvrl618.seq
499969022 gbvrl619.seq
499958626 gbvrl62.seq
113149528 gbvrl620.seq
146053233 gbvrl621.seq
499993900 gbvrl622.seq
499995644 gbvrl623.seq
499995585 gbvrl624.seq
123615955 gbvrl625.seq
499970770 gbvrl626.seq
499989717 gbvrl627.seq
499994821 gbvrl628.seq
468067485 gbvrl629.seq
499941530 gbvrl63.seq
499990609 gbvrl630.seq
499992443 gbvrl631.seq
499990532 gbvrl632.seq
145344402 gbvrl633.seq
499980893 gbvrl634.seq
499994525 gbvrl635.seq
499989301 gbvrl636.seq
360222417 gbvrl637.seq
499994806 gbvrl638.seq
499976395 gbvrl639.seq
176323446 gbvrl64.seq
499998703 gbvrl640.seq
499997263 gbvrl641.seq
277770188 gbvrl642.seq
499962348 gbvrl643.seq
499975621 gbvrl644.seq
499992555 gbvrl645.seq
499980250 gbvrl646.seq
52815776 gbvrl647.seq
499984496 gbvrl648.seq
499977083 gbvrl649.seq
499998031 gbvrl65.seq
499984787 gbvrl650.seq
401002093 gbvrl651.seq
499996302 gbvrl652.seq
499978248 gbvrl653.seq
499988785 gbvrl654.seq
355342586 gbvrl655.seq
499975084 gbvrl656.seq
499977309 gbvrl657.seq
499974395 gbvrl658.seq
244521075 gbvrl659.seq
499999938 gbvrl66.seq
499968670 gbvrl660.seq
499997546 gbvrl661.seq
499963192 gbvrl662.seq
311694760 gbvrl663.seq
499981531 gbvrl664.seq
499973272 gbvrl665.seq
499991882 gbvrl666.seq
284971859 gbvrl667.seq
499992409 gbvrl668.seq
499962612 gbvrl669.seq
499982239 gbvrl67.seq
499977215 gbvrl670.seq
282218963 gbvrl671.seq
499967068 gbvrl672.seq
499983903 gbvrl673.seq
499986213 gbvrl674.seq
288453631 gbvrl675.seq
499994213 gbvrl676.seq
499966415 gbvrl677.seq
499974762 gbvrl678.seq
286157045 gbvrl679.seq
499956285 gbvrl68.seq
499986001 gbvrl680.seq
499963921 gbvrl681.seq
499998169 gbvrl682.seq
277140680 gbvrl683.seq
499969093 gbvrl684.seq
499964383 gbvrl685.seq
499964010 gbvrl686.seq
499964007 gbvrl687.seq
134104072 gbvrl688.seq
499970858 gbvrl689.seq
151994692 gbvrl69.seq
499972210 gbvrl690.seq
499981521 gbvrl691.seq
499968020 gbvrl692.seq
75289052 gbvrl693.seq
499969619 gbvrl694.seq
499988646 gbvrl695.seq
499989858 gbvrl696.seq
499977592 gbvrl697.seq
95322116 gbvrl698.seq
499998986 gbvrl699.seq
499995545 gbvrl7.seq
499987709 gbvrl70.seq
499983957 gbvrl700.seq
499996265 gbvrl701.seq
115772178 gbvrl702.seq
499998688 gbvrl703.seq
499960543 gbvrl704.seq
499966738 gbvrl705.seq
126127423 gbvrl706.seq
499970629 gbvrl707.seq
499981370 gbvrl708.seq
499966012 gbvrl709.seq
499961963 gbvrl71.seq
126773040 gbvrl710.seq
499999536 gbvrl711.seq
499976907 gbvrl712.seq
499970193 gbvrl713.seq
499976639 gbvrl714.seq
151449021 gbvrl715.seq
499969967 gbvrl716.seq
499978019 gbvrl717.seq
499995448 gbvrl718.seq
257095030 gbvrl719.seq
499944341 gbvrl72.seq
499996408 gbvrl720.seq
499989854 gbvrl721.seq
499974337 gbvrl722.seq
499967069 gbvrl723.seq
311597469 gbvrl724.seq
499991724 gbvrl725.seq
499975836 gbvrl726.seq
499963451 gbvrl727.seq
396877857 gbvrl728.seq
499981468 gbvrl729.seq
409284386 gbvrl73.seq
499966910 gbvrl730.seq
499984054 gbvrl731.seq
499986996 gbvrl732.seq
499995586 gbvrl733.seq
499963850 gbvrl734.seq
122796079 gbvrl735.seq
499987463 gbvrl736.seq
499975234 gbvrl737.seq
499962459 gbvrl738.seq
499995113 gbvrl739.seq
499982927 gbvrl74.seq
499968730 gbvrl740.seq
473278274 gbvrl741.seq
499997702 gbvrl742.seq
499994587 gbvrl743.seq
499987603 gbvrl744.seq
499985455 gbvrl745.seq
388126430 gbvrl746.seq
499970171 gbvrl747.seq
499981542 gbvrl748.seq
499985882 gbvrl749.seq
499953140 gbvrl75.seq
499996723 gbvrl750.seq
77629412 gbvrl751.seq
499963176 gbvrl752.seq
499967043 gbvrl753.seq
499994658 gbvrl754.seq
499971205 gbvrl755.seq
499984889 gbvrl756.seq
321928326 gbvrl757.seq
499962131 gbvrl758.seq
499976621 gbvrl759.seq
499960070 gbvrl76.seq
499962727 gbvrl760.seq
499969540 gbvrl761.seq
364235553 gbvrl762.seq
499983912 gbvrl763.seq
499993585 gbvrl764.seq
499989673 gbvrl765.seq
499995555 gbvrl766.seq
20617195 gbvrl767.seq
499985259 gbvrl768.seq
499978299 gbvrl769.seq
360510095 gbvrl77.seq
499989929 gbvrl770.seq
499963331 gbvrl771.seq
19244380 gbvrl772.seq
499966678 gbvrl773.seq
499988178 gbvrl774.seq
499974911 gbvrl775.seq
499982381 gbvrl776.seq
43440266 gbvrl777.seq
499970940 gbvrl778.seq
499986514 gbvrl779.seq
499945661 gbvrl78.seq
499970797 gbvrl780.seq
499985099 gbvrl781.seq
7639592 gbvrl782.seq
499961633 gbvrl783.seq
499977830 gbvrl784.seq
499977631 gbvrl785.seq
240129337 gbvrl786.seq
499965580 gbvrl787.seq
499982145 gbvrl788.seq
499993340 gbvrl789.seq
499984265 gbvrl79.seq
499962386 gbvrl790.seq
48832277 gbvrl791.seq
499983186 gbvrl792.seq
499982477 gbvrl793.seq
499973026 gbvrl794.seq
499969929 gbvrl795.seq
56565845 gbvrl796.seq
499992731 gbvrl797.seq
499984807 gbvrl798.seq
499981550 gbvrl799.seq
499982394 gbvrl8.seq
499984875 gbvrl80.seq
188362090 gbvrl800.seq
499966628 gbvrl801.seq
499966102 gbvrl802.seq
499973678 gbvrl803.seq
184289882 gbvrl804.seq
499996219 gbvrl805.seq
499967516 gbvrl806.seq
499973093 gbvrl807.seq
191249024 gbvrl808.seq
499984192 gbvrl809.seq
324045770 gbvrl81.seq
499985869 gbvrl810.seq
499999956 gbvrl811.seq
220791292 gbvrl812.seq
499991238 gbvrl813.seq
499992699 gbvrl814.seq
499983395 gbvrl815.seq
221347040 gbvrl816.seq
499984314 gbvrl817.seq
499983733 gbvrl818.seq
499964306 gbvrl819.seq
499972413 gbvrl82.seq
189239067 gbvrl820.seq
499999076 gbvrl821.seq
499985369 gbvrl822.seq
499961904 gbvrl823.seq
194381162 gbvrl824.seq
500000241 gbvrl825.seq
499965896 gbvrl826.seq
499978695 gbvrl827.seq
499970776 gbvrl828.seq
499993952 gbvrl829.seq
499975049 gbvrl83.seq
205970486 gbvrl830.seq
499982716 gbvrl831.seq
499991160 gbvrl832.seq
499975836 gbvrl833.seq
370021944 gbvrl834.seq
499996904 gbvrl835.seq
499979732 gbvrl836.seq
499995653 gbvrl837.seq
114860459 gbvrl838.seq
499963358 gbvrl839.seq
499982990 gbvrl84.seq
499995850 gbvrl840.seq
499985463 gbvrl841.seq
304136278 gbvrl842.seq
499981552 gbvrl843.seq
499984495 gbvrl844.seq
499970631 gbvrl845.seq
499976189 gbvrl846.seq
499969095 gbvrl847.seq
499984652 gbvrl848.seq
73777629 gbvrl849.seq
43397665 gbvrl85.seq
499977338 gbvrl850.seq
499990100 gbvrl851.seq
499964812 gbvrl852.seq
283677426 gbvrl853.seq
500000109 gbvrl854.seq
499996359 gbvrl855.seq
499989188 gbvrl856.seq
499987160 gbvrl857.seq
186995561 gbvrl858.seq
499974380 gbvrl859.seq
499997518 gbvrl86.seq
499988942 gbvrl860.seq
499968369 gbvrl861.seq
499962792 gbvrl862.seq
144553399 gbvrl863.seq
499997169 gbvrl864.seq
499978827 gbvrl865.seq
499992989 gbvrl866.seq
500000118 gbvrl867.seq
497541303 gbvrl868.seq
499963834 gbvrl869.seq
499934109 gbvrl87.seq
499991568 gbvrl870.seq
499982890 gbvrl871.seq
418970961 gbvrl872.seq
499977016 gbvrl873.seq
499986718 gbvrl874.seq
499962517 gbvrl875.seq
196577880 gbvrl876.seq
499995181 gbvrl877.seq
499959748 gbvrl878.seq
499985892 gbvrl879.seq
499936201 gbvrl88.seq
153629918 gbvrl880.seq
499992696 gbvrl881.seq
499999458 gbvrl882.seq
499988208 gbvrl883.seq
499967589 gbvrl884.seq
499969701 gbvrl885.seq
289483133 gbvrl886.seq
183369680 gbvrl89.seq
301632987 gbvrl9.seq
499961017 gbvrl90.seq
499993969 gbvrl91.seq
499939121 gbvrl92.seq
189980194 gbvrl93.seq
499950520 gbvrl94.seq
499942501 gbvrl95.seq
499965280 gbvrl96.seq
228051195 gbvrl97.seq
499976812 gbvrl98.seq
499950212 gbvrl99.seq
499899959 gbvrt1.seq
290137512 gbvrt10.seq
1063697373 gbvrt100.seq
1045817456 gbvrt101.seq
754876698 gbvrt102.seq
616753988 gbvrt103.seq
490283916 gbvrt104.seq
470651151 gbvrt105.seq
397152890 gbvrt106.seq
351566814 gbvrt107.seq
339881554 gbvrt108.seq
404716166 gbvrt109.seq
87351606 gbvrt11.seq
489465929 gbvrt110.seq
499108511 gbvrt111.seq
486719349 gbvrt112.seq
58362562 gbvrt113.seq
436489699 gbvrt114.seq
486735687 gbvrt115.seq
492786702 gbvrt116.seq
424170309 gbvrt117.seq
281367593 gbvrt118.seq
478264522 gbvrt119.seq
499806081 gbvrt12.seq
485840122 gbvrt120.seq
493662272 gbvrt121.seq
75046811 gbvrt122.seq
979125221 gbvrt123.seq
838606764 gbvrt124.seq
678362247 gbvrt125.seq
476490051 gbvrt126.seq
461393141 gbvrt127.seq
438814149 gbvrt128.seq
394334276 gbvrt129.seq
284674796 gbvrt13.seq
313818221 gbvrt130.seq
288999697 gbvrt131.seq
280186115 gbvrt132.seq
407765043 gbvrt133.seq
421853258 gbvrt134.seq
478932645 gbvrt135.seq
480028007 gbvrt136.seq
438022009 gbvrt137.seq
174441466 gbvrt138.seq
487902327 gbvrt139.seq
15637437 gbvrt14.seq
456814552 gbvrt140.seq
462308829 gbvrt141.seq
168813991 gbvrt142.seq
455915969 gbvrt143.seq
469542169 gbvrt144.seq
479148432 gbvrt145.seq
211438035 gbvrt146.seq
481255007 gbvrt147.seq
475910680 gbvrt148.seq
366785231 gbvrt149.seq
36035214 gbvrt15.seq
464881586 gbvrt150.seq
474452025 gbvrt151.seq
234874130 gbvrt152.seq
697335450 gbvrt153.seq
670835803 gbvrt154.seq
524090553 gbvrt155.seq
413420126 gbvrt156.seq
345317144 gbvrt157.seq
329841089 gbvrt158.seq
250750417 gbvrt159.seq
18509260 gbvrt16.seq
486600390 gbvrt160.seq
364885711 gbvrt161.seq
448395879 gbvrt162.seq
471877569 gbvrt163.seq
393642536 gbvrt164.seq
355134416 gbvrt165.seq
470602746 gbvrt166.seq
448657488 gbvrt167.seq
384724558 gbvrt168.seq
432320923 gbvrt169.seq
497676963 gbvrt17.seq
471132362 gbvrt170.seq
497676594 gbvrt171.seq
207882210 gbvrt172.seq
397267013 gbvrt173.seq
366771863 gbvrt174.seq
351249970 gbvrt175.seq
309532358 gbvrt176.seq
296271444 gbvrt177.seq
286321426 gbvrt178.seq
268164730 gbvrt179.seq
497173924 gbvrt18.seq
253329800 gbvrt180.seq
494939336 gbvrt181.seq
424426418 gbvrt182.seq
410896883 gbvrt183.seq
369957025 gbvrt184.seq
169574120 gbvrt185.seq
426847158 gbvrt186.seq
496824472 gbvrt187.seq
434394575 gbvrt188.seq
494362940 gbvrt189.seq
481350583 gbvrt19.seq
61896390 gbvrt190.seq
431425030 gbvrt191.seq
474666078 gbvrt192.seq
479195533 gbvrt193.seq
352877912 gbvrt194.seq
479777961 gbvrt195.seq
497464627 gbvrt196.seq
432868094 gbvrt197.seq
439843808 gbvrt198.seq
469531790 gbvrt199.seq
499839565 gbvrt2.seq
400795564 gbvrt20.seq
496015817 gbvrt200.seq
488626307 gbvrt201.seq
432135676 gbvrt202.seq
70119528 gbvrt203.seq
491056051 gbvrt204.seq
328508705 gbvrt205.seq
497328806 gbvrt206.seq
499238966 gbvrt207.seq
187508760 gbvrt208.seq
490842556 gbvrt209.seq
488197715 gbvrt21.seq
463385772 gbvrt210.seq
446788975 gbvrt211.seq
438416202 gbvrt212.seq
170595769 gbvrt213.seq
451342688 gbvrt214.seq
474563355 gbvrt215.seq
461335548 gbvrt216.seq
436658187 gbvrt217.seq
154682616 gbvrt218.seq
456837606 gbvrt219.seq
479291185 gbvrt22.seq
488930196 gbvrt220.seq
466502331 gbvrt221.seq
455725140 gbvrt222.seq
453475816 gbvrt223.seq
462276007 gbvrt224.seq
497473221 gbvrt225.seq
499283767 gbvrt226.seq
481742871 gbvrt227.seq
54779872 gbvrt228.seq
477445338 gbvrt229.seq
480798341 gbvrt23.seq
495314530 gbvrt230.seq
486008997 gbvrt231.seq
489201368 gbvrt232.seq
499536480 gbvrt233.seq
347470388 gbvrt234.seq
1068402516 gbvrt235.seq
1067356333 gbvrt236.seq
896844819 gbvrt237.seq
805318347 gbvrt238.seq
718662677 gbvrt239.seq
499274554 gbvrt24.seq
556944666 gbvrt240.seq
299728838 gbvrt241.seq
293507186 gbvrt242.seq
484357811 gbvrt243.seq
130768604 gbvrt244.seq
874873715 gbvrt245.seq
685858825 gbvrt246.seq
627564227 gbvrt247.seq
610271897 gbvrt248.seq
543871783 gbvrt249.seq
483255278 gbvrt25.seq
284797667 gbvrt250.seq
269299175 gbvrt251.seq
474717664 gbvrt252.seq
402979396 gbvrt253.seq
343325815 gbvrt254.seq
450550965 gbvrt255.seq
494368803 gbvrt256.seq
470723064 gbvrt257.seq
470514883 gbvrt258.seq
229726572 gbvrt259.seq
484154109 gbvrt26.seq
499999569 gbvrt260.seq
499996144 gbvrt261.seq
500000051 gbvrt262.seq
15683094 gbvrt263.seq
499997940 gbvrt264.seq
499999421 gbvrt265.seq
315036935 gbvrt266.seq
445682876 gbvrt267.seq
474231618 gbvrt268.seq
490948606 gbvrt269.seq
65325640 gbvrt27.seq
332589082 gbvrt270.seq
477156039 gbvrt271.seq
499226352 gbvrt272.seq
477696169 gbvrt273.seq
353039605 gbvrt274.seq
438196164 gbvrt275.seq
489809255 gbvrt276.seq
460938782 gbvrt277.seq
425935508 gbvrt278.seq
463055690 gbvrt279.seq
437233554 gbvrt28.seq
486381290 gbvrt280.seq
437842391 gbvrt281.seq
440417012 gbvrt282.seq
475637321 gbvrt283.seq
477247535 gbvrt284.seq
464765084 gbvrt285.seq
442158629 gbvrt286.seq
490038950 gbvrt287.seq
437760826 gbvrt288.seq
442760644 gbvrt289.seq
488520688 gbvrt29.seq
386023782 gbvrt290.seq
474714280 gbvrt291.seq
485233797 gbvrt292.seq
481701496 gbvrt293.seq
437638720 gbvrt294.seq
484571077 gbvrt295.seq
497401344 gbvrt296.seq
473482376 gbvrt297.seq
467112365 gbvrt298.seq
392029870 gbvrt299.seq
467954951 gbvrt3.seq
456456384 gbvrt30.seq
447682143 gbvrt300.seq
458968414 gbvrt301.seq
489671978 gbvrt302.seq
498333218 gbvrt303.seq
249806054 gbvrt304.seq
449206571 gbvrt305.seq
492547884 gbvrt306.seq
481880513 gbvrt307.seq
498774154 gbvrt308.seq
111733219 gbvrt309.seq
337132552 gbvrt31.seq
436870892 gbvrt310.seq
440148969 gbvrt311.seq
482571941 gbvrt312.seq
484107234 gbvrt313.seq
52095057 gbvrt314.seq
470800028 gbvrt315.seq
472090268 gbvrt316.seq
484740940 gbvrt317.seq
476579517 gbvrt318.seq
487385971 gbvrt319.seq
446089299 gbvrt32.seq
391563647 gbvrt320.seq
455738434 gbvrt321.seq
373020280 gbvrt322.seq
430677277 gbvrt323.seq
493479067 gbvrt324.seq
489511330 gbvrt325.seq
496625891 gbvrt326.seq
496023577 gbvrt327.seq
483316423 gbvrt328.seq
455697611 gbvrt329.seq
493221105 gbvrt33.seq
463738379 gbvrt330.seq
476553580 gbvrt331.seq
382729569 gbvrt332.seq
488972896 gbvrt333.seq
496745927 gbvrt334.seq
114457470 gbvrt335.seq
483642213 gbvrt336.seq
486499113 gbvrt337.seq
480199921 gbvrt338.seq
449130925 gbvrt339.seq
459987661 gbvrt34.seq
493582352 gbvrt340.seq
455855740 gbvrt341.seq
496938106 gbvrt342.seq
445299021 gbvrt343.seq
488289465 gbvrt344.seq
456295928 gbvrt345.seq
491344127 gbvrt346.seq
433632055 gbvrt347.seq
461359229 gbvrt348.seq
352990890 gbvrt349.seq
14152653 gbvrt35.seq
486129256 gbvrt350.seq
433069569 gbvrt351.seq
468000104 gbvrt352.seq
213511432 gbvrt353.seq
464521445 gbvrt354.seq
484103216 gbvrt355.seq
469113604 gbvrt356.seq
484092005 gbvrt357.seq
21384662 gbvrt36.seq
90973101 gbvrt37.seq
499951059 gbvrt38.seq
499999429 gbvrt39.seq
179100370 gbvrt4.seq
500000121 gbvrt40.seq
55916370 gbvrt41.seq
499999857 gbvrt42.seq
270398834 gbvrt43.seq
499998933 gbvrt44.seq
121228192 gbvrt45.seq
499999161 gbvrt46.seq
448457297 gbvrt47.seq
499997600 gbvrt48.seq
28876688 gbvrt49.seq
448778544 gbvrt5.seq
444263965 gbvrt50.seq
499999112 gbvrt51.seq
388876068 gbvrt52.seq
499999644 gbvrt53.seq
280105140 gbvrt54.seq
499999980 gbvrt55.seq
499999742 gbvrt56.seq
485617358 gbvrt57.seq
499630950 gbvrt58.seq
499990415 gbvrt59.seq
490703641 gbvrt6.seq
462471618 gbvrt60.seq
202128841 gbvrt61.seq
123737443 gbvrt62.seq
483315318 gbvrt63.seq
481925744 gbvrt64.seq
499146212 gbvrt65.seq
499983703 gbvrt66.seq
297372571 gbvrt67.seq
492211550 gbvrt68.seq
492375887 gbvrt69.seq
499120716 gbvrt7.seq
479677491 gbvrt70.seq
480814553 gbvrt71.seq
362168611 gbvrt72.seq
487931186 gbvrt73.seq
465950606 gbvrt74.seq
489430322 gbvrt75.seq
352376871 gbvrt76.seq
465372186 gbvrt77.seq
488788789 gbvrt78.seq
189348250 gbvrt79.seq
483706902 gbvrt8.seq
451948482 gbvrt80.seq
443703248 gbvrt81.seq
400719178 gbvrt82.seq
427517644 gbvrt83.seq
319264824 gbvrt84.seq
275756309 gbvrt85.seq
252640763 gbvrt86.seq
251496345 gbvrt87.seq
466369516 gbvrt88.seq
418722220 gbvrt89.seq
263802276 gbvrt9.seq
186091498 gbvrt90.seq
404212770 gbvrt91.seq
481131817 gbvrt92.seq
474827267 gbvrt93.seq
480710662 gbvrt94.seq
89576280 gbvrt95.seq
435880706 gbvrt96.seq
487966705 gbvrt97.seq
497561523 gbvrt98.seq
468911724 gbvrt99.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 102014 184372448
BCT10 102 246510870
BCT100 99 245428056
BCT101 87 223381451
BCT102 59 181990919
BCT103 93 237302287
BCT104 103 223843089
BCT105 62 225168570
BCT106 64 140507059
BCT107 89 229551845
BCT108 90 230404163
BCT109 99 240991650
BCT11 143 242657671
BCT110 27 42382325
BCT111 94 226656782
BCT112 118 229172914
BCT113 127 232212861
BCT114 90 178403076
BCT115 114 212138354
BCT116 76 223040870
BCT117 111 225956545
BCT118 125 221492878
BCT119 4 6013748
BCT12 168 262541373
BCT120 246 222256023
BCT121 104 221252195
BCT122 100 224644129
BCT123 83 222703364
BCT124 21 86233168
BCT125 68 221578114
BCT126 87 219795809
BCT127 87 223588406
BCT128 80 226303150
BCT129 20 45564131
BCT13 8 14890521
BCT130 124 217933644
BCT131 53 217706139
BCT132 90 227492926
BCT133 57 149506400
BCT134 94 223837173
BCT135 73 221711999
BCT136 122 215811464
BCT137 80 227727095
BCT138 8 8657925
BCT139 159 220206896
BCT14 165 232257568
BCT140 84 220629983
BCT141 79 216070642
BCT142 141 227102717
BCT143 107 224394264
BCT144 80 221199213
BCT145 92 196245950
BCT146 115 225967887
BCT147 92 220409897
BCT148 158 214217907
BCT149 88 207032597
BCT15 150 236302365
BCT150 140 220978157
BCT151 63 217844098
BCT152 90 215013764
BCT153 125 217101319
BCT154 88 223616604
BCT155 21 65066945
BCT156 174 220602866
BCT157 128 221993348
BCT158 118 216449560
BCT159 170 220678969
BCT16 187 250598312
BCT160 54 177570665
BCT161 104 218683705
BCT162 113 217389079
BCT163 151 218678288
BCT164 108 219330740
BCT165 118 227921687
BCT166 139 215115054
BCT167 95 229134325
BCT168 104 222093509
BCT169 97 225362965
BCT17 219 231641963
BCT170 121 221034621
BCT171 95 220241289
BCT172 136 218333971
BCT173 44 84896110
BCT174 169 220902025
BCT175 100 223727909
BCT176 96 223995439
BCT177 95 219439398
BCT178 71 223304376
BCT179 129 228001663
BCT18 31 58194184
BCT180 150 229208112
BCT181 77 216466477
BCT182 11 10188678
BCT183 100 233591727
BCT184 96 224680213
BCT185 133 222280876
BCT186 85 221811199
BCT187 26 92438538
BCT188 119 222185746
BCT189 151 231715107
BCT19 135 235079883
BCT190 72 216080650
BCT191 81 120955479
BCT192 111 216184725
BCT193 156 227708035
BCT194 111 220250972
BCT195 89 136614524
BCT196 133 229717687
BCT197 109 213797140
BCT198 111 220064957
BCT199 77 222877345
BCT2 106 226805638
BCT20 131 231843219
BCT200 19 34014599
BCT201 98 220152536
BCT202 132 227699493
BCT203 126 229823053
BCT204 115 247492878
BCT205 116 229072476
BCT206 35 100612124
BCT207 131 216438017
BCT208 93 226438829
BCT209 108 224089005
BCT21 109 220733955
BCT210 116 221458112
BCT211 65 122261042
BCT212 127 225144984
BCT213 137 258852104
BCT214 100 226684234
BCT215 159 219265722
BCT216 71 116660995
BCT217 123 222422665
BCT218 115 218469346
BCT219 89 219209021
BCT22 212 222430645
BCT220 103 229936404
BCT221 104 209481600
BCT222 104 234499310
BCT223 94 222201735
BCT224 95 222593575
BCT225 105 225137188
BCT226 98 229933616
BCT227 106 224550172
BCT228 90 192942285
BCT229 104 221826114
BCT23 50 66104168
BCT230 108 221051727
BCT231 98 226007841
BCT232 76 270744187
BCT233 75 254647899
BCT234 101 225874656
BCT235 178 218571314
BCT236 132 228118798
BCT237 58 111799670
BCT238 303 275286702
BCT239 119 219435892
BCT24 174 220036188
BCT240 114 219246925
BCT241 53 88783408
BCT242 89 220099828
BCT243 87 228427298
BCT244 82 236651858
BCT245 106 224032415
BCT246 39 81227217
BCT247 60 216868170
BCT248 120 221119124
BCT249 86 223426276
BCT25 157 217996559
BCT250 85 217663772
BCT251 31 72411893
BCT252 157 275025230
BCT253 82 232627723
BCT254 84 220566907
BCT255 144 212385076
BCT256 20 28670539
BCT257 109 262921422
BCT258 72 217635148
BCT259 100 214909619
BCT26 52 221902715
BCT260 79 210171996
BCT261 143 306547296
BCT262 72 239204396
BCT263 88 216728836
BCT264 131 224161084
BCT265 140 264048514
BCT266 50 101444202
BCT267 146 273570514
BCT268 114 257004034
BCT269 35 229012536
BCT27 110 224934926
BCT270 60 215899496
BCT271 112 219135997
BCT272 126 219604182
BCT273 95 249332001
BCT274 78 222741730
BCT275 14 34821419
BCT276 124 215159011
BCT277 98 220607386
BCT278 65 210721442
BCT279 137 230450043
BCT28 204 233470802
BCT280 114 227067240
BCT281 109 229190301
BCT282 88 225088899
BCT283 80 141524915
BCT284 106 218843831
BCT285 82 215186387
BCT286 95 234056453
BCT287 98 187209491
BCT288 93 235647841
BCT289 104 235928514
BCT29 3 27676824
BCT290 69 223063860
BCT291 105 213470710
BCT292 119 216777827
BCT293 166 226651969
BCT294 161 212763762
BCT295 157 238023030
BCT296 8 17431560
BCT297 101 230275411
BCT298 119 225277295
BCT299 156 250483403
BCT3 37542 125814925
BCT30 83 236556551
BCT300 117 235914627
BCT301 10 46450140
BCT302 123 226718502
BCT303 112 212578426
BCT304 91 227407856
BCT305 111 218543332
BCT306 158 225952317
BCT307 153 214037229
BCT308 116 177319993
BCT309 128 225499547
BCT31 96 221838262
BCT310 106 222744013
BCT311 83 218273834
BCT312 70 215964942
BCT313 123 196813336
BCT314 87 241506031
BCT315 110 227851319
BCT316 82 219259803
BCT317 52 214399303
BCT318 90 197873444
BCT319 113 220728285
BCT32 96 219800168
BCT320 129 231228144
BCT321 125 212458214
BCT322 94 219289732
BCT323 148 223216642
BCT324 3 10254404
BCT325 124 248813935
BCT326 110 222498371
BCT327 82 228432498
BCT328 61 221300332
BCT329 89 186048909
BCT33 117 236937870
BCT330 128 238885544
BCT331 201 232731845
BCT332 144 217080977
BCT333 134 215029591
BCT334 118 217111970
BCT335 41 76975466
BCT336 139 245503240
BCT337 169 279754521
BCT338 165 215010867
BCT339 135 218768734
BCT34 50 70336694
BCT340 19 125140083
BCT341 72 229560250
BCT342 126 238154065
BCT343 742 221695520
BCT344 398 217882477
BCT345 95 232152237
BCT346 6 15239951
BCT347 102 223982909
BCT348 126 215582359
BCT349 97 209352135
BCT35 83 218320760
BCT350 136 219595918
BCT351 194 233701122
BCT352 221 221853326
BCT353 125 220599552
BCT354 63 136640347
BCT355 137 223613724
BCT356 144 220140457
BCT357 140 221719607
BCT358 129 223885767
BCT359 146 235862095
BCT36 114 237396740
BCT360 97 239165671
BCT361 58 123851515
BCT362 111 224832352
BCT363 162 233574566
BCT364 123 223186299
BCT365 126 221926705
BCT366 83 201870051
BCT367 130 230534195
BCT368 126 226096115
BCT369 68 217368925
BCT37 77 219464643
BCT370 90 224232763
BCT371 58 216978287
BCT372 50 220959735
BCT373 133 225778925
BCT374 46 14896968
BCT375 195 229604129
BCT376 127 252087880
BCT377 114 228068446
BCT378 219 225533189
BCT379 69 100304035
BCT38 163 232252437
BCT380 90 239192530
BCT381 114 247991308
BCT382 46 214210162
BCT383 53 216377196
BCT384 19 73275105
BCT385 128 213375994
BCT386 113 228373833
BCT387 92 226874676
BCT388 172 248573405
BCT389 164 227863654
BCT39 118 190840583
BCT390 94 222494596
BCT391 118 230432459
BCT392 3 4787823
BCT393 184 265248059
BCT394 183 233381025
BCT395 468 226636956
BCT396 123 230691656
BCT397 160 240032463
BCT398 105 232776488
BCT399 106 210395049
BCT4 41290 139250707
BCT40 159 238840241
BCT400 109 230735808
BCT401 84 216238233
BCT402 94 218004732
BCT403 102 226314622
BCT404 155 220876767
BCT405 68 123957640
BCT406 89 221294643
BCT407 100 226379498
BCT408 139 258578529
BCT409 132 300096398
BCT41 131 292587326
BCT410 116 234237510
BCT411 95 271979224
BCT412 29 64450937
BCT413 113 228698436
BCT414 150 217704956
BCT415 95 220381437
BCT416 136 227714139
BCT417 137 216828440
BCT418 113 233203017
BCT419 129 223221335
BCT42 115 222903129
BCT420 37 31441708
BCT421 122 226585208
BCT422 153 219365274
BCT423 149 229541054
BCT424 159 230173281
BCT425 131 218220461
BCT426 21 41744019
BCT427 129 231508633
BCT428 141 220573282
BCT429 141 220438911
BCT43 107 216845564
BCT430 101 217783001
BCT431 94 221873764
BCT432 107 232528182
BCT433 119 237505662
BCT434 102 312787629
BCT435 96 215503192
BCT436 86 124951076
BCT437 123 217943213
BCT438 125 218373908
BCT439 90 216204202
BCT44 164 221117526
BCT440 104 264987199
BCT441 63 170685276
BCT442 118 212264610
BCT443 113 224096535
BCT444 111 221803154
BCT445 115 211305566
BCT446 43 81514768
BCT447 144 219919128
BCT448 104 251665529
BCT449 156 212575427
BCT45 182 226510942
BCT450 159 212139624
BCT451 12 11443917
BCT452 238 214458452
BCT453 129 214250986
BCT454 99 218510804
BCT455 117 230291203
BCT456 123 262063092
BCT457 78 178549235
BCT458 103 236047200
BCT459 127 236790346
BCT46 249 222464459
BCT460 131 219550029
BCT461 104 228221181
BCT462 91 216460991
BCT463 53 217868736
BCT464 81 148217592
BCT465 165 216872086
BCT466 110 220085662
BCT467 114 226586398
BCT468 132 213116796
BCT469 11 41867039
BCT47 141 224031500
BCT470 78 220992704
BCT471 139 212603090
BCT472 157 216271864
BCT473 317 213898340
BCT474 364 210657095
BCT475 117 212804246
BCT476 134 211491923
BCT477 150 212215499
BCT478 174 222080619
BCT479 168 211415286
BCT48 152 231087076
BCT480 49 74787780
BCT481 161 208257957
BCT482 162 212193463
BCT483 114 210605338
BCT484 157 213126972
BCT485 132 209356669
BCT486 131 195243107
BCT487 183 210687290
BCT488 116 210811583
BCT489 136 211510245
BCT49 438 99686068
BCT490 167 220748430
BCT491 53 105084722
BCT492 159 241842392
BCT493 131 230855104
BCT494 208 228620320
BCT495 111 219347014
BCT496 6 12814141
BCT497 112 230828773
BCT498 119 221323829
BCT499 132 234778895
BCT5 20642 162919204
BCT50 5200 7533877
BCT500 104 237587098
BCT501 110 66092449
BCT502 107 232838404
BCT503 96 224202359
BCT504 110 224180420
BCT505 69 230451487
BCT506 119 247887479
BCT507 111 267612902
BCT508 71 144393115
BCT509 184 216765022
BCT51 10402 13141863
BCT510 123 229632434
BCT511 132 222688660
BCT512 118 215522252
BCT513 196 222254317
BCT514 120 226680323
BCT515 143 223398823
BCT516 2 9711339
BCT517 90 256897498
BCT518 142 214248519
BCT519 98 214768017
BCT52 53921 202024657
BCT520 157 213710019
BCT521 24 53836540
BCT522 140 218732960
BCT523 109 225107446
BCT524 89 216531385
BCT525 169 225245387
BCT526 83 69720141
BCT527 157 237479776
BCT528 137 340179435
BCT529 107 245007957
BCT53 185 208765651
BCT530 183 270247097
BCT531 127 217390520
BCT532 70 231758780
BCT533 113 226057212
BCT534 23 75148282
BCT535 101 223784323
BCT536 76 214366141
BCT537 103 234847991
BCT538 126 218765783
BCT539 113 216994736
BCT54 101 231004346
BCT540 102 125479564
BCT541 125 216431578
BCT542 139 217127904
BCT543 127 231713695
BCT544 120 221815212
BCT545 295 218276916
BCT546 49 74057150
BCT547 138 225206185
BCT548 95 240075980
BCT549 88 219124207
BCT55 122 221744163
BCT550 170 215211253
BCT551 142 218709373
BCT552 171 209989476
BCT553 72 85138827
BCT554 156 208447709
BCT555 127 240984651
BCT556 128 222248609
BCT557 160 221935754
BCT558 95 150336359
BCT559 164 225596417
BCT56 103 222777517
BCT560 50 213452168
BCT561 228 251217686
BCT562 133 234560957
BCT563 95 223485036
BCT564 122 186348334
BCT565 153 215988330
BCT566 126 276622167
BCT567 205 209499795
BCT568 142 249238352
BCT569 98 257055478
BCT57 131 222293417
BCT570 10 28305238
BCT571 126 229584098
BCT572 140 225797801
BCT573 146 228175936
BCT574 98 220515926
BCT575 96 219200729
BCT576 14 36127315
BCT577 123 221651394
BCT578 130 226062430
BCT579 103 221052628
BCT58 121 218256338
BCT580 98 217579003
BCT581 94 218107147
BCT582 120 225602420
BCT583 46 122532076
BCT584 128 228496151
BCT585 146 223925807
BCT586 166 215804467
BCT587 159 225256591
BCT588 113 227612447
BCT589 103 167637347
BCT59 146 224934131
BCT590 200 242437082
BCT591 124 230378479
BCT592 181 208546238
BCT593 86 223929713
BCT594 80 225091976
BCT595 170 214714139
BCT596 130 145107413
BCT597 115 216899415
BCT598 62 209197316
BCT599 60 209524722
BCT6 2600 37759883
BCT60 145 227211700
BCT600 88 226875805
BCT601 171 213858993
BCT602 59 185158308
BCT603 78 212768523
BCT604 93 212302100
BCT605 158 240170963
BCT606 193 290765717
BCT607 67 128918494
BCT608 134 222118709
BCT609 42 214577135
BCT61 125 133390248
BCT610 37 214639852
BCT611 169 234699017
BCT612 64 148941997
BCT613 92 213593695
BCT614 114 218674056
BCT615 93 219321028
BCT616 147 221523320
BCT617 93 214510261
BCT618 96 214714848
BCT619 125 210858736
BCT62 255 227294457
BCT620 50 41790853
BCT621 119 241102727
BCT622 107 227040599
BCT623 122 215290949
BCT624 128 225376117
BCT625 106 245577954
BCT626 96 388904612
BCT627 103 267236511
BCT628 91 317300604
BCT629 170 225029563
BCT63 86 220119558
BCT630 149 219841110
BCT631 145 235286079
BCT632 124 270222682
BCT633 77 75818779
BCT634 117 217993852
BCT635 100 225520169
BCT636 87 222569991
BCT637 176 273341737
BCT638 5 22392116
BCT639 171 229859570
BCT64 113 224688543
BCT640 146 232969725
BCT641 272 212067792
BCT642 137 222049937
BCT643 28 65911365
BCT644 148 258116456
BCT645 106 226011678
BCT646 129 212839463
BCT647 147 215160680
BCT648 111 181144450
BCT649 112 211778878
BCT65 128 222273877
BCT650 115 219644798
BCT651 187 214896897
BCT652 130 221800533
BCT653 62 26129241
BCT654 137 242501423
BCT655 146 212177855
BCT656 99 226813904
BCT657 186 222915689
BCT658 78 191581491
BCT659 194 245749804
BCT66 135 219988879
BCT660 136 227342484
BCT661 113 223476611
BCT662 97 215388555
BCT663 92 105994657
BCT664 129 221393446
BCT665 191 251865362
BCT666 135 217727284
BCT667 48 211643289
BCT668 64 214250225
BCT669 73 149187396
BCT67 111 162805198
BCT670 85 213343638
BCT671 121 216390365
BCT672 84 218626001
BCT673 84 234501343
BCT674 86 194623312
BCT675 170 215443584
BCT676 171 220277380
BCT677 302 212686174
BCT678 57 214947681
BCT679 113 247911747
BCT68 136 223054995
BCT680 152 234831620
BCT681 152 221691200
BCT682 12 33180893
BCT683 73 212371616
BCT684 92 217821699
BCT685 104 226296657
BCT686 144 207592415
BCT687 136 210240811
BCT688 26 47055588
BCT689 142 206612759
BCT69 112 217399067
BCT690 117 213883354
BCT691 136 219396034
BCT692 80 217057439
BCT693 96 175588315
BCT694 122 220472990
BCT695 97 242959064
BCT696 110 225655409
BCT697 137 214454155
BCT698 126 221330357
BCT699 132 228462453
BCT7 1310 133308362
BCT70 131 223635367
BCT700 3 7665308
BCT701 104 223025233
BCT702 106 217782989
BCT703 122 225096704
BCT704 139 237725671
BCT705 46 73869872
BCT706 107 217566484
BCT707 74 218950444
BCT708 116 221737252
BCT709 143 212049084
BCT71 121 221481204
BCT710 88 111987983
BCT711 86 213573894
BCT712 133 216920053
BCT713 120 210324419
BCT714 164 239317299
BCT715 110 220232185
BCT716 121 216687723
BCT717 44 54968090
BCT718 88 208252607
BCT719 74 219829363
BCT72 138 232661918
BCT720 82 212902772
BCT721 175 208840716
BCT722 75 215650755
BCT723 76 150313928
BCT724 144 221478023
BCT725 172 204583425
BCT726 125 221550361
BCT727 176 217121529
BCT728 123 208219892
BCT729 143 222479340
BCT73 108 225781339
BCT730 35 49845663
BCT731 143 232831805
BCT732 169 216793934
BCT733 253 217684128
BCT734 94 237722802
BCT735 130 209672113
BCT736 55 93600661
BCT737 100 206724587
BCT738 79 212166855
BCT739 141 211902659
BCT74 38 50860113
BCT740 125 225273485
BCT741 84 209334978
BCT742 119 208420950
BCT743 8 33309806
BCT744 129 230851121
BCT745 114 222333645
BCT746 120 207421819
BCT747 121 203397845
BCT748 126 213787132
BCT749 82 142290418
BCT75 95 230912422
BCT750 127 212744212
BCT751 122 215919433
BCT752 102 213112120
BCT753 121 212949809
BCT754 118 209745509
BCT755 252 307645608
BCT756 22 28867878
BCT757 159 228107701
BCT758 124 208889956
BCT759 167 247630752
BCT76 117 227983621
BCT760 119 216857725
BCT761 116 217766710
BCT762 97 156836153
BCT763 127 205319007
BCT764 129 221769502
BCT765 68 213478854
BCT766 85 216885085
BCT767 2 9041828
BCT768 112 212240259
BCT769 157 210771590
BCT77 160 232898310
BCT770 161 224176577
BCT771 79 212118114
BCT772 6 32769515
BCT773 78 221812250
BCT774 125 223032976
BCT775 140 234179597
BCT776 167 211230911
BCT777 31 48247471
BCT778 145 206703555
BCT779 100 206890519
BCT78 154 221704284
BCT780 111 215976662
BCT781 96 214544894
BCT782 58 113857580
BCT783 129 205109490
BCT784 106 204252990
BCT785 126 215377746
BCT786 118 217008261
BCT787 28 80547090
BCT788 83 211379609
BCT789 128 216146050
BCT79 128 238275556
BCT790 94 222713388
BCT791 268 328365761
BCT792 37 72900309
BCT793 102 222375899
BCT794 123 218859995
BCT795 141 246227109
BCT796 86 212092688
BCT797 102 218444850
BCT798 47 93692184
BCT799 134 204535806
BCT8 191 234251938
BCT80 114 230664549
BCT800 100 215651848
BCT801 130 206999723
BCT802 143 236156744
BCT803 129 220543101
BCT804 91 208035626
BCT805 127 216875046
BCT806 90 239489963
BCT807 77 219464743
BCT808 108 217602651
BCT809 119 228463458
BCT81 54 123393656
BCT810 250 245553208
BCT811 70 207724870
BCT812 130 219628493
BCT813 46 72760789
BCT814 145 214529738
BCT815 158 230169206
BCT816 158 217598782
BCT817 181 210758625
BCT818 56 126713764
BCT819 95 214957529
BCT82 300 239582260
BCT820 256 206020983
BCT821 104 206354330
BCT822 133 208848207
BCT823 85 84977522
BCT824 122 214664829
BCT825 125 253298288
BCT826 53 214674368
BCT827 140 225168281
BCT828 16 29424532
BCT829 108 245022408
BCT83 142 231562727
BCT830 145 232047903
BCT831 141 226601597
BCT832 92 208835506
BCT833 17 29621612
BCT834 147 235416781
BCT835 104 251339374
BCT836 136 214020124
BCT837 87 219090828
BCT838 112 225485025
BCT839 120 212629326
BCT84 354 225466658
BCT840 176 200395485
BCT841 528 115589384
BCT842 1589 2511957
BCT843 3172 5268484
BCT844 6338 7796395
BCT845 12613 14997690
BCT846 25523 27672494
BCT847 50566 54072396
BCT848 148892 156728661
BCT849 14191 193504504
BCT85 110 222922994
BCT850 3297 203942569
BCT851 2512 213432676
BCT852 7212 212654349
BCT853 164 249069009
BCT854 39928 39703867
BCT855 75116 183078801
BCT856 11043 200071397
BCT857 6078 200796727
BCT858 100695 182725025
BCT859 60982 67424103
BCT86 120 208517065
BCT860 149221 156937773
BCT861 84520 88110101
BCT862 144593 151100723
BCT863 25885 25544289
BCT864 132574 167542096
BCT865 31491 43691434
BCT866 116491 178557549
BCT867 7589 16980642
BCT868 32978 54237222
BCT869 38409 221284281
BCT87 120 227473574
BCT870 4374 317254124
BCT871 2451 39148036
BCT872 5034 225438591
BCT873 3847 224092509
BCT874 1442 273316652
BCT875 109 222593498
BCT876 55 216844860
BCT877 70 213822191
BCT878 34 137765382
BCT879 69 224394912
BCT88 99 226611423
BCT880 364 238323955
BCT881 889 289911825
BCT882 316 85816731
BCT883 1274 198668008
BCT884 287 209619920
BCT885 559 377168493
BCT886 919 316619406
BCT887 271 80140439
BCT888 3148 246273076
BCT889 677 253307538
BCT89 90 224039666
BCT890 380 388957404
BCT891 317 211223197
BCT892 362 393266490
BCT893 364 392445913
BCT894 515 239197049
BCT895 1741 221923984
BCT896 11 22317190
BCT897 86 222746849
BCT898 78 227354684
BCT899 3023 245927078
BCT9 133 236750743
BCT90 98 225070223
BCT900 1230 124242115
BCT901 1412 261424764
BCT902 47 241352896
BCT903 45 243003094
BCT904 2180 269716913
BCT905 945 54278114
BCT906 2284 261463112
BCT907 87 288890299
BCT908 417 278222635
BCT909 3023 263078339
BCT91 58 138528232
BCT910 11940 19905115
BCT911 25214 42009480
BCT912 118315 188760611
BCT913 115195 191764918
BCT914 91251 165820768
BCT915 97683 200881089
BCT916 118415 192699283
BCT917 56634 295005937
BCT918 120053 213848811
BCT919 753 218722719
BCT92 53 211054879
BCT920 296 267218187
BCT921 153 204084183
BCT922 210 206349257
BCT923 198 204269326
BCT924 196 204493575
BCT925 174 202934235
BCT926 52 67175899
BCT927 179 205883676
BCT928 202 206537177
BCT929 226 205678653
BCT93 45 210584326
BCT930 173 206520918
BCT931 37 50683886
BCT932 237 205937725
BCT933 272 218221577
BCT934 254 226502493
BCT935 197 294351544
BCT936 9237 259084259
BCT937 14940 27691097
BCT94 45 210864282
BCT95 45 212727898
BCT96 76 222861078
BCT97 40 115080869
BCT98 112 227959956
BCT99 129 231316827
ENV1 189943 141864479
ENV10 83 219720293
ENV11 86 225075562
ENV12 154 211251214
ENV13 141331 180371587
ENV14 97748 59111983
ENV15 218972 102571242
ENV16 176357 159880963
ENV17 19588 17081855
ENV18 204688 124199284
ENV19 186312 145971129
ENV2 111956 180369984
ENV20 209232 131011833
ENV21 180827 144718919
ENV22 1249 1675336
ENV23 155433 156521287
ENV24 244834 67513585
ENV25 92643 21373836
ENV26 220959 118335235
ENV27 255264 109061988
ENV28 205163 126335257
ENV29 27420 25899715
ENV3 103088 171363025
ENV30 152288 158743920
ENV31 201173 103413016
ENV32 68233 51313819
ENV33 213275 108915575
ENV34 170976 153761541
ENV35 135004 163680815
ENV36 11559 15747993
ENV37 179943 128302937
ENV38 218035 118474885
ENV39 78511 41735891
ENV4 126 289839815
ENV40 143979 98000846
ENV41 100618 112273875
ENV42 130603 80420660
ENV43 173933 138863958
ENV44 163629 139561410
ENV45 179871 114631267
ENV46 200965 107345641
ENV47 196347 109548395
ENV48 111594 97825926
ENV49 158038 134816472
ENV5 94 222349120
ENV50 145070 136773819
ENV51 169155 47811798
ENV52 172154 133100300
ENV53 210921 100424019
ENV54 142450 62215028
ENV55 216484 84261358
ENV56 212740 92635014
ENV57 108070 43432737
ENV58 224267 98776998
ENV59 224773 91723234
ENV6 101 217595213
ENV60 142959 92500613
ENV61 198346 110962778
ENV62 182969 90536018
ENV63 184949 119806354
ENV64 50232 41961810
ENV65 128629 186314172
ENV66 223266 135703193
ENV67 235366 93588045
ENV68 95554 44025219
ENV69 194521 112033810
ENV7 69 218175793
ENV70 131080 170996628
ENV71 67437 134681257
ENV72 41585 215292021
ENV73 136469 144650545
ENV74 74486 198083966
ENV75 62723 223207356
ENV76 72797 318772270
ENV77 51502 76326312
ENV8 14 44651888
ENV9 76 217162029
EST1 152676 59069390
EST10 155716 67095973
EST100 152778 76471565
EST101 145010 99279907
EST102 145172 85252768
EST103 148873 93081688
EST104 7515 4350644
EST105 149617 109417790
EST106 135201 99318378
EST107 136259 97454300
EST108 136240 94831240
EST109 2404 1587299
EST11 163527 69169482
EST110 136751 77270907
EST111 176402 105757023
EST112 193950 119224074
EST113 236922 141664136
EST114 6627 4069381
EST115 229453 127643708
EST116 181415 102870914
EST117 190249 93414076
EST118 5248 4073334
EST119 148552 100253258
EST12 150881 64818035
EST120 154735 119130491
EST121 166280 97900067
EST122 22063 15461205
EST123 130028 82530428
EST124 83543 30920786
EST125 36769 12485692
EST126 84106 31034635
EST127 84264 34515269
EST128 33711 11378339
EST129 85031 32709177
EST13 186630 83471161
EST130 82017 34968192
EST131 83454 35266094
EST132 84118 32965334
EST133 14468 5903340
EST134 83460 51063090
EST135 173481 87480434
EST136 170361 77647991
EST137 145527 91797238
EST138 29659 18775715
EST139 140355 87014374
EST14 104811 47840316
EST140 149335 97877743
EST141 157292 78661333
EST142 181198 92623099
EST143 8928 5198058
EST144 141571 76041135
EST145 151619 73235123
EST146 148412 87034276
EST147 155766 83575958
EST148 11706 6903282
EST149 166215 102160051
EST15 197326 111627972
EST150 202194 107310927
EST151 158867 93286369
EST152 102222 51075859
EST153 155639 79042501
EST154 135075 80133731
EST155 141690 88158876
EST156 165810 85752287
EST157 9314 5218716
EST158 178955 104146744
EST159 218711 94419121
EST16 147207 104727434
EST160 145779 85813988
EST161 161375 87629602
EST162 3062 1523802
EST163 140660 82396713
EST164 132522 83740466
EST165 147239 88250074
EST166 146464 80718105
EST167 20644 10465585
EST168 117769 61073260
EST169 115690 61941713
EST17 156582 83437611
EST170 122419 54128062
EST171 121107 48630686
EST172 29423 11431564
EST173 122215 48678047
EST174 125709 48482605
EST175 165795 83310643
EST176 172205 75576921
EST177 24657 15513157
EST178 147743 104364925
EST179 163429 99358064
EST18 190951 116800077
EST180 205284 116217156
EST181 167108 93350542
EST182 154079 103286743
EST183 134219 92993843
EST184 10781 6013701
EST185 146582 94120876
EST186 155009 80959254
EST187 131944 71058979
EST188 160849 90599706
EST189 13374 8457055
EST19 177400 113022366
EST190 148840 87645185
EST191 153698 95464921
EST192 175523 99185391
EST193 140423 77123132
EST194 5092 4172247
EST195 123967 64273734
EST196 162722 90850517
EST197 173183 99602742
EST198 149609 92840514
EST199 6210 3892188
EST2 157282 60510852
EST20 71000 55722012
EST200 164744 79130838
EST201 122492 84332756
EST202 163359 96333237
EST203 163858 96045019
EST204 14393 6878323
EST205 5847 2580354
EST206 111103 63044131
EST207 151046 87021483
EST208 107365 63627893
EST209 164131 100717476
EST21 194393 109147209
EST210 168271 124553548
EST211 82827 67366748
EST212 186242 95036481
EST213 145260 90138733
EST214 87567 65796037
EST215 141914 85219333
EST216 137898 75149598
EST217 95604 30686008
EST218 146894 86267439
EST219 148594 82459905
EST22 179801 92389705
EST220 141359 94228947
EST221 155420 90008351
EST222 9706 6814092
EST223 161771 99542731
EST224 154079 93665372
EST225 123359 88323100
EST226 146020 90237685
EST227 6963 4216754
EST228 128831 82021098
EST229 127856 89666249
EST23 107383 50545406
EST230 44462 31954010
EST231 156429 83331488
EST232 167399 92029721
EST233 166930 92691445
EST234 158125 88082990
EST235 163896 91508682
EST236 163228 92242200
EST237 166033 91294921
EST238 154891 85088026
EST239 168030 90687163
EST24 190972 61390762
EST240 187909 98489047
EST241 191353 107062803
EST242 168339 100302935
EST243 180025 103224685
EST244 190025 112759300
EST245 186323 113230756
EST246 178010 115392887
EST247 7071 5607359
EST248 140689 86235688
EST249 212624 138847765
EST25 136527 39211071
EST250 226912 111308057
EST251 164069 113913134
EST252 183146 95756964
EST253 197974 98471029
EST254 123046 89289573
EST255 7475 5185523
EST256 140224 82365172
EST257 206165 112641063
EST258 162517 106389114
EST259 93648 92356852
EST26 102354 27619605
EST260 15357 19986774
EST261 147622 99189632
EST262 150767 89756528
EST263 139176 101742893
EST264 216336 99353332
EST265 4565 2821766
EST266 133636 96436124
EST267 129480 90283987
EST268 135526 98313237
EST269 113350 81420942
EST27 201338 85169852
EST270 17516 11104500
EST271 136224 84348047
EST272 125703 85851017
EST273 127789 96576509
EST274 36548 26163923
EST275 126643 89388805
EST276 116524 79042651
EST277 138898 83679903
EST278 145962 114898436
EST279 15579 11020136
EST28 19821 8893541
EST280 125395 117388350
EST281 132433 98775254
EST282 162339 97563678
EST283 165664 104470554
EST284 19255 12069207
EST285 142244 92439543
EST286 168943 115108709
EST287 151678 103899230
EST288 136291 103153979
EST289 3472 2297545
EST29 203801 100091766
EST290 159549 97229973
EST291 222526 90766361
EST292 152836 111325212
EST293 160406 71767282
EST294 10503 1187900
EST295 208917 37980980
EST296 212285 83331327
EST297 150079 115258622
EST298 168109 97764449
EST299 154827 103149238
EST3 156018 54727763
EST30 216481 109022941
EST300 169047 109966773
EST301 149394 109821736
EST302 2203 1480297
EST303 180765 102246724
EST304 178557 93088789
EST305 168969 109475926
EST306 158895 104101101
EST307 2396 1912330
EST308 225880 106203457
EST309 266222 115902028
EST31 153855 67071563
EST310 185440 112103160
EST311 151096 28710776
EST312 227853 99483459
EST313 175581 100343452
EST314 156175 99883140
EST315 159727 95006074
EST316 543 410397
EST317 166298 114042738
EST318 179946 95180769
EST319 143779 97256505
EST32 149562 63751558
EST320 188320 110423173
EST321 187360 49128528
EST322 201669 33864879
EST323 174165 95391984
EST324 14772 9232819
EST325 158235 113265480
EST326 184738 110428476
EST327 167386 97733523
EST328 166007 109762232
EST329 165849 71375282
EST33 165156 65678946
EST330 127635 80036880
EST331 121236 80456825
EST332 146639 101331657
EST333 22486 8250892
EST334 250611 26632520
EST335 254708 23392212
EST336 152004 94195783
EST337 152251 98608210
EST338 150976 99681932
EST339 145899 92253285
EST34 147003 64492285
EST340 237630 43480357
EST341 185645 80879638
EST342 4020 4962914
EST343 168844 99777986
EST344 163962 101131199
EST345 145648 92755775
EST346 189443 103114377
EST347 156148 109739284
EST348 153297 101566189
EST349 2426 915498
EST35 162550 70856127
EST350 184333 108360592
EST351 169905 94663156
EST352 169194 105184069
EST353 178491 59664389
EST354 195269 72030896
EST355 194748 75388710
EST356 197291 74551080
EST357 134728 70211808
EST358 174807 127367579
EST359 148391 85100581
EST36 160821 65983217
EST360 150484 86625888
EST361 121476 94901926
EST362 5931 4700816
EST363 142701 94368059
EST364 155330 94309089
EST365 162012 90113788
EST366 157009 100315910
EST367 23643 10396066
EST368 45656 24624838
EST369 155288 104534407
EST37 107941 33682655
EST370 137833 97018607
EST371 158406 101968757
EST372 152636 109693741
EST373 30270 25787026
EST374 173564 146756127
EST375 163544 85426714
EST376 127562 80904900
EST377 137826 94038840
EST378 51307 35926427
EST379 131619 88276056
EST38 99513 30489875
EST380 137093 89601408
EST381 139337 96986761
EST382 147160 97102148
EST383 51247 41093666
EST384 164163 86543504
EST385 143622 81414969
EST386 144917 86070913
EST387 144174 103725090
EST388 155671 93199334
EST389 137838 87384737
EST39 99154 31399112
EST390 132358 84149156
EST391 20621 12735139
EST392 196942 107257732
EST393 136851 75001285
EST394 92969 54570705
EST395 120408 80237774
EST396 23482 14313208
EST397 131137 82988342
EST398 119642 76596711
EST399 147274 80748116
EST4 142972 56362966
EST40 98816 29786908
EST400 210376 82563196
EST401 30531 12823211
EST402 163628 84364287
EST403 163914 99171502
EST404 159146 95828757
EST405 125989 81300696
EST406 12161 7969381
EST407 129505 86703580
EST408 137395 90180185
EST409 178547 111875412
EST41 39236 11600145
EST410 154171 93123046
EST411 27993 12149931
EST412 166683 91977745
EST413 168828 124886745
EST414 87419 56155432
EST415 69678 41106155
EST416 34134 16805232
EST417 137508 79953191
EST418 82435 49421981
EST419 139695 56837590
EST42 101326 31351096
EST420 148165 29996844
EST421 148030 30296764
EST422 162600 80122839
EST423 28322 14992272
EST424 201213 115842274
EST425 237755 108748070
EST426 220152 107479554
EST427 127106 74508992
EST428 128057 85803248
EST429 131704 80409324
EST43 102633 36243427
EST430 93228 56881081
EST431 174105 110064955
EST432 213136 84698644
EST433 106574 28506785
EST434 183632 112100394
EST435 203907 111383113
EST436 180144 106307515
EST437 199637 118042696
EST438 132935 62223660
EST439 110330 60167533
EST44 95475 48218258
EST440 162601 108614110
EST441 181152 115720728
EST442 108077 86015819
EST443 177004 139599957
EST444 150295 90619060
EST445 54250 34510266
EST446 166032 106944103
EST447 178087 101018025
EST448 43119 24597584
EST449 195466 106587863
EST45 121121 52335541
EST450 183935 94237774
EST451 52147 38920690
EST452 189910 115818986
EST453 180010 117991294
EST454 54575 33990107
EST455 196573 133887305
EST456 219857 123775014
EST457 190087 126956582
EST458 189311 147449039
EST459 240 204401
EST46 55810 33167886
EST460 204235 155997292
EST461 192186 115131159
EST462 160757 96336104
EST463 181270 94921873
EST464 7385 612837
EST465 53496 4381716
EST466 158232 12239421
EST467 144975 12987161
EST468 147925 29931089
EST469 148356 29501756
EST47 176557 89017795
EST470 8452 1761940
EST471 148043 30264080
EST472 141212 81174487
EST473 171837 100379435
EST474 161774 110922925
EST475 18855 13397987
EST476 160786 92773669
EST477 150648 104119784
EST478 133680 93215925
EST479 141644 98055796
EST48 158183 65088174
EST480 16394 8452879
EST481 157371 103675515
EST482 146436 105285373
EST483 162015 97563475
EST484 165796 50902234
EST485 11902 1870117
EST486 160476 40344382
EST487 150798 102143723
EST488 146638 96520117
EST489 170800 112269129
EST49 162221 91938423
EST490 21948 11903259
EST491 132527 75702844
EST492 189749 107907416
EST493 149390 109146835
EST494 53584 36369591
EST495 126855 87064282
EST496 145499 90195929
EST497 147481 88686820
EST498 163220 89105363
EST499 36884 18818734
EST5 162046 62591557
EST50 154876 80579871
EST500 151785 92116569
EST501 155989 91971233
EST502 168248 101934793
EST503 136371 85421263
EST504 15934 9012046
EST505 100253 71169364
EST506 78626 60620272
EST507 97471 64748244
EST508 143354 80449887
EST509 37260 21236560
EST51 156390 74771983
EST510 120626 73365540
EST511 133392 87396068
EST512 135163 79259009
EST513 151534 92857981
EST514 47047 25601183
EST515 155600 85748129
EST516 184618 110443864
EST517 120128 78951977
EST518 178654 94905512
EST519 5703 2165131
EST52 108219 61222574
EST520 52576 18674859
EST521 182559 100658494
EST522 152151 81322787
EST523 23060 13932967
EST524 162316 94446797
EST525 211236 123658554
EST526 30185 19341621
EST527 147958 99624045
EST528 158446 97595891
EST529 134305 87490150
EST53 153908 88947693
EST530 128605 87865201
EST531 26182 16357153
EST532 178675 74362205
EST533 179100 79391228
EST534 198856 83506649
EST535 194861 80609089
EST536 4095 1379666
EST537 178841 95307232
EST538 174453 102491582
EST539 180226 107868953
EST54 154192 84966111
EST540 171846 103644370
EST541 196638 126473040
EST542 186429 103129128
EST543 178905 82832322
EST544 148048 94309687
EST545 206518 125003286
EST546 205657 126701639
EST547 188926 108266858
EST548 208317 121345654
EST549 34317 17820709
EST55 152219 92235100
EST550 154052 96415299
EST551 188315 117674408
EST552 166547 98818629
EST553 133848 98348660
EST554 8666 7053012
EST555 157219 92146041
EST556 170362 84878810
EST557 149253 85159295
EST558 151163 81933158
EST559 11899 7114414
EST56 150016 69955319
EST560 156486 79968172
EST561 181237 106307093
EST562 162166 102980351
EST563 175037 107738988
EST564 4093 2821702
EST565 170731 117095565
EST566 183762 113530526
EST567 129211 83784441
EST568 168566 97317315
EST569 185265 110277659
EST57 142162 76714634
EST570 38440 25369104
EST571 204465 119127975
EST572 269500 91747576
EST573 25706 9441749
EST574 262208 83553217
EST575 157843 95706673
EST576 156061 104112677
EST577 162591 58135590
EST578 92203 36397309
EST58 151712 83218730
EST59 161193 65788370
EST6 166228 65026396
EST60 144589 70133092
EST61 160365 89939140
EST62 150337 92592984
EST63 150109 99270886
EST64 157599 94515357
EST65 2729 1149637
EST66 154753 103415401
EST67 162949 82998651
EST68 166589 84840478
EST69 142352 77836923
EST7 163850 67729799
EST70 148303 82498115
EST71 149036 86111097
EST72 148459 92218660
EST73 150501 87400628
EST74 3311 1956678
EST75 29919 18235506
EST76 186623 102758272
EST77 170455 90769208
EST78 212135 115450370
EST79 179537 103352293
EST8 161034 67849081
EST80 2595 1769868
EST81 196745 121640362
EST82 167531 93331236
EST83 136014 63286286
EST84 128082 62611016
EST85 11183 5739653
EST86 150319 92587484
EST87 154531 96912480
EST88 130223 66329267
EST89 140169 89287993
EST9 169413 69378292
EST90 14619 7602591
EST91 183459 91893008
EST92 204450 119806817
EST93 202071 108015966
EST94 192047 90419584
EST95 203809 87000415
EST96 145899 86952030
EST97 137792 84713453
EST98 158915 76746036
EST99 9280 6073374
GSS1 172819 126566183
GSS10 15063 14534273
GSS100 156116 139401502
GSS101 16660 10968419
GSS102 168722 143967545
GSS103 157878 109069542
GSS104 156130 106446313
GSS105 152737 105718247
GSS106 168006 122784077
GSS107 149452 126270618
GSS108 161684 125096048
GSS109 186495 115926183
GSS11 145620 106560749
GSS110 16919 10327274
GSS111 185687 119751799
GSS112 201287 103923207
GSS113 219830 124101551
GSS114 87638 57037950
GSS115 151983 114077516
GSS116 155174 118808941
GSS117 155138 118870338
GSS118 163306 106817361
GSS119 37488 21562888
GSS12 199550 104018945
GSS120 179013 131661113
GSS121 189765 117491847
GSS122 166053 55057548
GSS123 169938 76249060
GSS124 3108 2065491
GSS125 161448 105035511
GSS126 188861 124688564
GSS127 200296 82002210
GSS128 168220 79987296
GSS129 137268 94431217
GSS13 191750 84122956
GSS130 129855 104605133
GSS131 132043 108777560
GSS132 132451 106048276
GSS133 8056 5958858
GSS134 135214 112032054
GSS135 56598 47104660
GSS136 132584 107786768
GSS137 139149 116140565
GSS138 140043 114408742
GSS139 138251 109584898
GSS14 173812 89350503
GSS140 4155 2820771
GSS141 134784 106426486
GSS142 134049 108003847
GSS143 134400 111531585
GSS144 138188 116474348
GSS145 4675 3643453
GSS146 139468 108106612
GSS147 136810 113648547
GSS148 136898 113473892
GSS149 137299 112649085
GSS15 1924 980066
GSS150 559 466085
GSS151 137155 110923756
GSS152 134480 106278327
GSS153 133002 107665198
GSS154 138659 116136290
GSS155 1985 1674795
GSS156 127182 92203837
GSS157 174122 105056445
GSS158 184491 110111133
GSS159 162397 108642338
GSS16 167950 83915732
GSS160 177416 102428926
GSS161 195401 128350696
GSS162 201539 133261553
GSS163 200714 134062384
GSS164 181014 126532494
GSS165 198341 136948587
GSS166 196713 139067120
GSS167 196064 138671402
GSS168 174299 134354206
GSS169 144474 97339661
GSS17 159733 81434885
GSS170 138053 80502012
GSS171 165315 73484620
GSS172 130293 57961944
GSS173 162971 140972883
GSS174 170927 113508196
GSS175 80878 52986476
GSS176 191836 128985792
GSS177 195995 117721523
GSS178 29060 15232802
GSS179 180225 98140530
GSS18 155956 85599361
GSS180 181302 123365801
GSS181 178800 126906476
GSS182 181098 127179984
GSS183 19114 12799890
GSS184 165902 130533276
GSS185 170769 155442034
GSS186 219492 123624062
GSS187 216568 103419657
GSS188 17938 8362456
GSS189 210015 95106166
GSS19 153559 95946744
GSS190 162425 134536276
GSS191 16879 16812210
GSS192 125540 102753347
GSS193 122235 93469471
GSS194 156641 154268782
GSS195 167926 158459909
GSS196 131396 104305071
GSS197 149360 107958474
GSS198 170079 141603399
GSS199 173853 119767432
GSS2 172571 106974789
GSS20 153654 72719206
GSS200 20792 12076547
GSS201 181326 133978343
GSS202 184903 120111167
GSS203 180120 93026884
GSS204 172833 121727487
GSS205 189431 117159380
GSS206 189632 116856204
GSS207 21296 12387505
GSS208 200656 130020228
GSS209 215713 142627344
GSS21 106599 59132134
GSS210 217639 140378671
GSS211 166383 136378793
GSS212 152394 108659129
GSS213 159527 120137430
GSS214 159222 144721897
GSS215 159797 141631201
GSS216 160025 145012269
GSS217 161623 143744366
GSS218 162207 142682743
GSS219 161901 124660013
GSS22 132522 64635660
GSS220 168118 139542770
GSS221 162158 116272085
GSS222 180642 88789528
GSS223 2275 1543221
GSS224 251369 52150506
GSS225 262481 40466091
GSS226 262523 40408947
GSS227 122800 38229504
GSS228 253355 52912344
GSS229 182565 86129448
GSS23 125192 56723722
GSS230 188824 55952203
GSS231 154340 118464017
GSS232 177033 144334259
GSS233 160566 145786280
GSS234 158963 146486119
GSS235 175119 110481562
GSS236 238210 57319690
GSS237 198718 101419800
GSS238 228550 39520519
GSS239 119400 74782163
GSS24 133968 72981771
GSS240 173535 111783710
GSS241 148014 90085518
GSS242 140464 83790991
GSS243 159730 149647456
GSS244 6503 5533776
GSS245 112668 95722541
GSS246 180351 149222837
GSS247 172952 122406011
GSS248 201906 127716686
GSS249 188212 120277412
GSS25 142794 74274291
GSS250 166175 94403497
GSS251 159866 84501441
GSS252 156429 119869966
GSS253 203515 148105651
GSS254 14308 9404890
GSS255 171523 67875770
GSS256 176316 96175653
GSS257 195480 152066346
GSS258 199052 153893384
GSS259 8581 7079434
GSS26 12574 5388027
GSS260 197610 157072181
GSS261 197571 124238425
GSS262 194887 142548802
GSS263 839 578548
GSS264 214431 131244295
GSS265 189953 57620998
GSS266 211774 108913136
GSS267 177797 157192397
GSS268 163847 150141472
GSS269 233829 131848785
GSS27 140896 65655631
GSS270 241255 120361822
GSS28 159847 79832355
GSS29 156451 92519127
GSS3 138092 115758007
GSS30 164864 85230462
GSS31 10282 5319388
GSS32 171961 102867176
GSS33 182793 109077642
GSS34 182274 87046795
GSS35 172994 102196685
GSS36 190487 103919871
GSS37 162239 112347665
GSS38 160362 98313234
GSS39 173083 108442870
GSS4 140070 112435882
GSS40 4467 3211536
GSS41 183985 122974505
GSS42 181741 117322404
GSS43 52286 27335335
GSS44 177820 102905200
GSS45 164518 141969870
GSS46 179633 148569334
GSS47 139686 92499212
GSS48 182873 132017102
GSS49 181617 114554523
GSS5 12738 9524807
GSS50 204428 116967955
GSS51 185581 99459566
GSS52 211954 108037045
GSS53 211747 108318359
GSS54 197283 132772792
GSS55 158243 124832316
GSS56 185583 139405028
GSS57 196772 63136393
GSS58 171739 96411428
GSS59 157707 106161954
GSS6 152750 116376137
GSS60 23373 13575160
GSS61 166615 156644394
GSS62 177188 98818477
GSS63 161235 115245018
GSS64 172262 112292681
GSS65 175437 118749924
GSS66 184317 127706706
GSS67 205680 128787401
GSS68 187487 111746271
GSS69 904 494120
GSS7 170822 119987739
GSS70 200507 134082593
GSS71 215979 158545254
GSS72 188980 137988156
GSS73 173702 107612445
GSS74 198148 111946385
GSS75 140507 76313882
GSS76 163068 95818066
GSS77 10997 7015314
GSS78 159270 97756741
GSS79 159481 96970229
GSS8 177098 108890889
GSS80 172278 114346124
GSS81 170756 109404389
GSS82 174615 122489482
GSS83 188951 105344114
GSS84 175437 126363935
GSS85 163968 106294793
GSS86 1150 906691
GSS87 189248 108544814
GSS88 180902 113819623
GSS89 166588 117808805
GSS9 141916 118718103
GSS90 192391 105665595
GSS91 10240 5928398
GSS92 213831 107550639
GSS93 226833 89047322
GSS94 213068 138993481
GSS95 183490 92580894
GSS96 94686 37020965
GSS97 193805 75823638
GSS98 201086 123394316
GSS99 191020 122180795
HTC1 41190 63371632
HTC2 32318 72271528
HTC3 32081 77888423
HTC4 84851 50686507
HTC5 129507 161162980
HTC6 125281 123134227
HTC7 137566 130735831
HTC8 68382 61636249
HTG1 3784 374870703
HTG10 2848 363016285
HTG11 1976 365940103
HTG12 1714 382089084
HTG13 1718 381796340
HTG14 1659 383118453
HTG15 1835 380424998
HTG16 1750 361896240
HTG17 1843 380599315
HTG18 1752 382301790
HTG19 1775 381824019
HTG2 5068 373604329
HTG20 1891 380883515
HTG21 2135 355865123
HTG22 2426 376351102
HTG23 2269 379507879
HTG24 2442 381163865
HTG25 2175 382733656
HTG26 2070 368006459
HTG27 2074 380458182
HTG28 2061 380108509
HTG29 1047 202962639
HTG3 2556 370662362
HTG30 2040 379446758
HTG31 2203 375546591
HTG32 986 170706729
HTG33 2152 379221269
HTG34 2348 376393195
HTG35 1372 195850538
HTG36 2462 370234045
HTG37 2428 372528369
HTG38 1015 169191937
HTG39 2235 381490266
HTG4 2735 369989641
HTG40 2336 385145188
HTG41 1069 180930974
HTG42 2312 384776536
HTG43 2363 384490832
HTG44 906 155597869
HTG45 2500 379735659
HTG46 2319 385244375
HTG47 927 158722850
HTG48 2315 385567657
HTG49 2293 386023883
HTG5 2500 373389217
HTG50 900 149450476
HTG51 2237 385154833
HTG52 2106 380011723
HTG53 657 122585305
HTG54 2010 379525743
HTG55 1981 378955508
HTG56 1184 193581815
HTG57 2144 380658486
HTG58 2686 383430148
HTG59 2972 383122016
HTG6 2 386956
HTG60 885 128384665
HTG61 2959 380503057
HTG62 3012 366231486
HTG63 2990 372824610
HTG64 2953 336850403
HTG65 3178 359117111
HTG66 3179 359260560
HTG67 3186 360427818
HTG68 3128 367889098
HTG69 2913 377859052
HTG7 2327 375791086
HTG70 1846 312468258
HTG71 3415 365492036
HTG72 2071 381329139
HTG73 1668 298160154
HTG74 2088 382520375
HTG75 2244 384445864
HTG76 1669 296247510
HTG77 2201 385233869
HTG78 2249 384504439
HTG79 3218 384021459
HTG8 1500 384347777
HTG80 2165 384532378
HTG81 3034 373057359
HTG82 2129 232838110
HTG9 1582 384062276
INV1 154224 140308768
INV10 6 363887313
INV100 27 393364046
INV100 7 350337011
INV100 14 345060509
INV100 28 376473495
INV100 20 387688055
INV100 25 387549397
INV100 16 273291927
INV100 21 391659234
INV100 15 388003948
INV100 17 392782098
INV100 22 384497843
INV101 23 381713426
INV101 1 384599746
INV101 1 375927842
INV101 5 382993214
INV101 19 385797313
INV101 11 123214675
INV101 3 392646952
INV101 11 381074049
INV101 23 391735799
INV101 18 390168307
INV101 2 42007124
INV102 137 350719386
INV102 17 349645545
INV102 36 391559871
INV102 15 393037217
INV102 17 380153622
INV102 3 59787137
INV102 18 391697154
INV102 18 366312255
INV102 3 337894111
INV102 4 302073392
INV102 2 299644653
INV103 4 381900476
INV103 2 270514050
INV103 3 389949835
INV103 3 377785151
INV103 1 117072231
INV103 7 379476447
INV103 13 370594929
INV103 19 385355871
INV103 19 310143194
INV103 24 379964624
INV103 23 389484464
INV104 24 389620289
INV104 18 384799792
INV104 11 311697054
INV104 19 385416179
INV104 23 381933246
INV104 21 387246911
INV104 4 249799159
INV104 2 366882438
INV104 14 388370346
INV104 21 372413558
INV104 11 364644469
INV105 33 393229173
INV105 9 299858585
INV105 3 322474280
INV105 5 373079097
INV105 6 253444959
INV105 1 278847389
INV105 2 381917736
INV105 5 382304965
INV105 10 386062363
INV105 10 259701476
INV105 13 376291971
INV106 9 344807465
INV106 17 379702260
INV106 14 391466716
INV106 23 381561736
INV106 7 104919562
INV106 17 384568933
INV106 4 354385143
INV106 5 393615696
INV106 5 350509167
INV106 13 170433122
INV106 41 385022073
INV107 23 323415557
INV107 30 380703697
INV107 20 392681339
INV107 13 369303117
INV107 3 121760452
INV107 10 368178692
INV107 15 386351526
INV107 16 393205423
INV107 22 382093519
INV107 5 84901051
INV107 23 391606292
INV108 32 372756064
INV108 19 384186373
INV108 24 387846790
INV108 20 373516354
INV108 4 111080816
INV108 18 393422118
INV108 46 378688286
INV108 19 382845041
INV108 14 380720656
INV108 16 377993913
INV108 13 388384596
INV109 20 384740836
INV109 15 353225248
INV109 10 385225146
INV109 11 273470899
INV109 12 363823232
INV109 18 371293482
INV109 18 391994412
INV109 31 390819384
INV109 6 350425796
INV109 14 392098573
INV109 29 373609145
INV11 37201 245836657
INV110 25 385708589
INV110 17 389590392
INV110 16 381486986
INV110 15 318246839
INV110 17 388617783
INV110 14 389176964
INV110 29 259715661
INV110 4 364567413
INV110 8 381014917
INV110 2 78434448
INV110 5 350286208
INV111 29 388680045
INV111 2 290331975
INV111 2 278888238
INV111 2 276514222
INV111 2 269676904
INV111 4 363956289
INV111 18 391284265
INV111 12 224045865
INV111 19 391324862
INV111 17 390982751
INV111 18 376274198
INV112 22 323658394
INV112 19 352401134
INV112 3 302186515
INV112 4 353711471
INV112 5 357741396
INV112 13 382478042
INV112 12 224411599
INV112 17 376440323
INV112 17 366693890
INV112 13 391571027
INV112 18 382117156
INV113 25 386606940
INV113 3 51115388
INV113 24 358079042
INV113 12 377073348
INV113 21 382278417
INV113 30 359479577
INV113 2 70328500
INV113 13 381531391
INV113 10 308545783
INV113 3 357081424
INV113 3 303625532
INV114 22 384360764
INV114 2 181194408
INV114 13 384377122
INV114 33 392079687
INV114 13 343474254
INV114 1 226676804
INV114 1 219059534
INV114 16 385377860
INV114 22 389649401
INV114 14 386739832
INV114 14 369921279
INV115 22 375170759
INV115 1 61636059
INV115 7 366264750
INV115 9 350557811
INV115 15 365667369
INV115 6 378807618
INV115 186 393477787
INV115 10 373214505
INV115 7 128813925
INV115 37 384493639
INV115 27 388854011
INV116 31 394116451
INV116 23 380037898
INV116 28 363846557
INV116 15 377681854
INV116 22 393673783
INV116 9 130141504
INV116 20 389123558
INV116 20 387294169
INV116 14 389119304
INV116 19 379601315
INV116 23 386448258
INV117 20 281624502
INV117 8 389213531
INV117 13 380257717
INV117 204 387365574
INV117 30 392954113
INV117 3 276039202
INV117 2 378921420
INV117 2 303390991
INV117 9 391074667
INV117 16 390694906
INV117 12 366488514
INV118 11 364532943
INV118 4 325784878
INV118 6 389357642
INV118 9 384120626
INV118 11 376230233
INV118 5 157146748
INV118 15 387407218
INV118 10 372793310
INV118 13 386573559
INV118 15 366464331
INV118 25 368796884
INV119 14 378464462
INV119 14 394572131
INV119 15 272825452
INV119 7 382020802
INV119 3 377751995
INV119 1 74373700
INV119 6 372848766
INV119 19 392995865
INV119 20 361450650
INV119 18 393654662
INV119 27 368630202
INV12 129080 165753959
INV120 38 390437780
INV120 24 392519924
INV120 20 384861097
INV120 24 394625452
INV120 21 320922556
INV120 4 339818558
INV120 6 372821066
INV120 12 375257232
INV120 18 356987095
INV120 14 392597749
INV120 21 390274896
INV121 20 259303673
INV121 3 43344510
INV121 31 388699035
INV121 27 388119446
INV121 10 369434192
INV121 17 377251515
INV121 4 346682597
INV121 3 85114833
INV121 22 388207738
INV121 17 378212285
INV121 16 392106212
INV122 35 382133951
INV122 25 393533165
INV122 6 365268265
INV122 9 317988506
INV122 13 387631941
INV122 19 375812714
INV122 6 360702987
INV122 9 377395012
INV122 315 360903659
INV122 24 386975977
INV122 2 20618579
INV123 38912 329097860
INV123 11 379797353
INV123 7 271219600
INV123 6 392152830
INV123 13 379500142
INV123 21 377719287
INV123 17 385022185
INV123 3 60281174
INV123 8 344365302
INV123 4 370341263
INV123 5 385484997
INV124 150880 102329608
INV124 3 361480762
INV124 2 227816091
INV124 3 326627480
INV124 3 179785975
INV124 1 394411929
INV124 1 208357731
INV124 2 387387157
INV124 28 393959523
INV124 241 387119275
INV124 22 379489872
INV125 32990 23666311
INV125 23 385909353
INV125 7 124975265
INV125 15 390696136
INV125 18 371915036
INV125 16 382295963
INV125 15 370940962
INV125 8 363964332
INV125 7 216076461
INV125 1 222508353
INV125 2 378391780
INV126 149037 103677761
INV126 11 365473561
INV126 4 178163008
INV126 24 386512327
INV126 26 391903437
INV126 36 382490299
INV126 14 376797262
INV126 8 203772100
INV126 21 389229967
INV126 14 386982868
INV126 19 389026688
INV127 152043 116289798
INV127 10 374195572
INV127 7 158156167
INV127 15 377259953
INV127 23 388223446
INV127 14 372625691
INV127 19 382678381
INV127 10 189595137
INV127 24 380015923
INV127 20 388962198
INV127 14 379590905
INV128 122196 83945712
INV128 13 301439739
INV128 15 378313646
INV128 15 386611886
INV128 23 392780439
INV128 14 300976708
INV128 22 355579415
INV128 6 382504563
INV128 8 311266892
INV128 3 335903695
INV128 1 91272002
INV129 154823 113505752
INV129 4 340601518
INV129 5 393178719
INV129 7 378352357
INV129 8 368654020
INV129 3 55757405
INV129 1 219663937
INV129 2 347956425
INV129 5 371419038
INV129 12 376377240
INV129 16 384236082
INV13 207 346774014
INV130 153339 120375073
INV130 8 176370631
INV130 18 372019888
INV130 24 386509465
INV130 24 389713698
INV130 31 307760477
INV130 5 386523964
INV130 1 28255227
INV130 5 90894419
INV130 1 485851375
INV130 1 214862200
INV131 54984 36693255
INV131 8 378994418
INV131 19 376407609
INV131 45 376396442
INV131 3 388122302
INV131 11 318389619
INV131 3 234762902
INV131 2 315919502
INV131 6 393647630
INV131 11 381373389
INV131 19 381074705
INV132 153101 110248519
INV132 22 386497102
INV132 21 390526659
INV132 254 366101051
INV132 12 386296471
INV132 16 387655277
INV132 21 383151662
INV132 20 383401877
INV132 19 344640379
INV132 1 82766246
INV132 17 385091065
INV133 153451 114944747
INV133 20 387924663
INV133 12 388536663
INV133 8 219178196
INV133 11 367097380
INV133 13 382777311
INV133 13 359364339
INV133 7 252534006
INV133 7 348359881
INV133 6 327698438
INV133 2 316788101
INV134 39110 33877492
INV134 3 312494531
INV134 4 204379861
INV134 1 406294527
INV134 1 310928733
INV134 3 388958877
INV134 11 148169598
INV134 1 249786838
INV134 2 319646621
INV134 4 298015822
INV134 1 281865375
INV135 141649 88555998
INV135 1 241717587
INV135 10 375364887
INV135 17 384501009
INV135 11 328663993
INV135 1 106314825
INV135 4 339541539
INV135 7 369695073
INV135 5 344800758
INV135 8 394204524
INV135 4 119862796
INV136 147691 93940982
INV136 10 365101424
INV136 18 388033671
INV136 26 393220942
INV136 12 266980887
INV136 19 392458449
INV136 55 389557696
INV136 24 387260689
INV136 13 234291481
INV136 7 258353618
INV136 2 295700062
INV137 44858 33888010
INV137 7 366943025
INV137 11 381355472
INV137 4 106561761
INV137 19 343847635
INV137 17 382516650
INV137 2 332743733
INV137 6 313828708
INV137 16 380123343
INV137 45 361967714
INV137 3 372946856
INV138 148160 97282512
INV138 20082 205689745
INV139 139445 81651462
INV14 85 322154899
INV140 42653 25291499
INV141 138616 82882357
INV142 138412 82983380
INV143 52992 35055509
INV144 139275 83568116
INV145 135377 98983204
INV146 74609 58397208
INV147 141428 108461726
INV148 150153 121021778
INV149 155834 117707370
INV15 3 136766944
INV150 117243 190801401
INV151 31521 73661334
INV152 181112 235169059
INV153 218151 167649786
INV154 38629 187147326
INV155 800 42674647
INV156 566 40635863
INV157 8037 115580217
INV158 23265 332345847
INV159 23319 172531536
INV16 14 359428768
INV160 67585 303875862
INV161 121343 264933975
INV162 66775 80327893
INV163 180562 231780487
INV164 41599 303967104
INV165 314 393292454
INV166 1015 105322314
INV167 2059 383654064
INV168 2 41011863
INV169 591 361654729
INV17 9 363281720
INV170 8 378508614
INV171 974 354275690
INV172 6 380479040
INV173 2 95552909
INV174 22 390382246
INV175 10036 362338941
INV176 380 367128711
INV177 197 343944761
INV178 27 353316387
INV179 25 362372590
INV18 52 355336707
INV180 18 224818646
INV181 552 321019135
INV182 2 371500015
INV183 2 289902239
INV184 2965 358959205
INV185 59309 333102202
INV186 34 383065485
INV187 19 393344928
INV188 14 327270017
INV189 27 393651567
INV19 14 371434550
INV190 32 390738662
INV191 24 383706815
INV192 25 382049854
INV193 31 378115211
INV194 13 297748085
INV195 18 387848062
INV196 24 381271345
INV197 36 390867092
INV198 34 389743485
INV199 26 391141334
INV2 2290 316239855
INV20 78 134821644
INV200 19 292893418
INV201 11 371260264
INV202 19 391738075
INV203 12 391781067
INV204 13 372901688
INV205 32 389502835
INV206 22 330411078
INV207 29 389284801
INV208 38 387663352
INV209 17 367589223
INV21 6 384224499
INV210 12 387517245
INV211 17 362786034
INV212 10 320557524
INV213 13 376469258
INV214 35 380323776
INV215 26 392110960
INV216 24 388964019
INV217 21 391745060
INV218 22 309540561
INV219 27 392282931
INV22 14 390998271
INV220 24 388632304
INV221 12 375724207
INV222 16 393313708
INV223 13 392068868
INV224 10 277290815
INV225 15 358735036
INV226 11 386907833
INV227 40 377177573
INV228 21 392427759
INV229 5 215849302
INV23 25 372322353
INV230 15 382505853
INV231 743 382889760
INV232 26 386022184
INV233 28 394591284
INV234 7 307846648
INV235 4 182170525
INV236 2 342421305
INV237 2 269826459
INV238 18 385786230
INV239 1901 346423954
INV24 18 383937723
INV240 8862 318236250
INV241 11615 311304128
INV242 29308 84779614
INV243 137013 98941909
INV244 129595 76450982
INV245 119656 73622297
INV246 151090 93753300
INV247 144147 102746953
INV248 68217 58973486
INV249 151261 123351637
INV25 26 392368732
INV250 150000 121506608
INV251 86069 70049851
INV252 148765 115696141
INV253 142104 123210644
INV254 100100 118737794
INV255 142971 130352656
INV256 143965 117828111
INV257 95504 189232782
INV258 1984 378683974
INV259 3066 244460869
INV26 36 374901277
INV260 96781 321023124
INV261 217342 232110336
INV262 60949 250981301
INV263 103988 292596017
INV264 28973 364551361
INV265 1764 378352969
INV266 2739 197024699
INV267 184144 268358078
INV268 1785 378880292
INV269 5583 374469857
INV27 4 251686535
INV270 20768 153711624
INV271 288223 205808194
INV272 1224 379793465
INV273 4515 373876603
INV274 92490 210334617
INV275 391527 140904810
INV276 109733 258294965
INV277 62463 308727005
INV278 4162 375136162
INV279 44629 350112618
INV28 3 241225934
INV280 2155 4626806
INV281 298725 199657065
INV282 214334 249067665
INV283 2226 377046597
INV284 19303 366955288
INV285 16948 41978773
INV286 298408 186907243
INV287 1355 379516794
INV288 3687 378313727
INV289 136930 300095839
INV29 3 393880593
INV290 38349 357698579
INV291 664 92151452
INV292 8529 370827851
INV293 197744 256830145
INV294 359558 128682792
INV295 93023 322972837
INV296 2568 378355489
INV297 61847 343439542
INV298 72069 24187260
INV299 150251 127215760
INV3 104326 181663919
INV30 3 261336042
INV300 143760 118380828
INV301 102624 194249270
INV302 20 306133566
INV303 15 379655485
INV304 6 355188453
INV305 1 239744465
INV306 1 231634122
INV307 1 221096292
INV308 1 220877407
INV309 1 216720617
INV31 3 322765503
INV310 1 210676062
INV311 2 387811394
INV312 2 329972158
INV313 2 302384449
INV314 20 360081608
INV315 9 301825222
INV316 23 382490317
INV317 23 380735444
INV318 18 387931948
INV319 33 390736486
INV32 2 265971290
INV320 795 381170065
INV321 20 391287680
INV322 2 32244328
INV323 27 388830496
INV324 21 386972019
INV325 9 351834369
INV326 5 163634948
INV327 1 292306469
INV328 1 164045107
INV329 2 318230244
INV33 4 328757598
INV330 868 391036523
INV331 30 390895475
INV332 25 383908286
INV333 25 388289419
INV334 3 49480870
INV335 25 384967191
INV336 26 391463882
INV337 22 392427991
INV338 26 383547221
INV339 26 265978999
INV34 5 378753109
INV340 6 371290168
INV341 13 374069663
INV342 19 385560269
INV343 15 373391572
INV344 13 350978987
INV345 22 386100611
INV346 24 386055502
INV347 23 389090030
INV348 31 366704932
INV349 12 307588661
INV35 5 371191486
INV350 24 393914970
INV351 16 362929629
INV352 8 361035446
INV353 13 369493806
INV354 13 384884009
INV355 18 390461886
INV356 22 394170044
INV357 11 336163521
INV358 6 353407420
INV359 7 372089599
INV36 4 376987297
INV360 3 84055545
INV361 9 390327029
INV362 19 393988728
INV363 11 137914990
INV364 1 346874609
INV365 1 248688513
INV366 1 195213701
INV367 21 389226046
INV368 16 380802157
INV369 17 384888603
INV37 4 293537168
INV370 24 390785021
INV371 14 272669524
INV372 19 394017224
INV373 17 391933486
INV374 7 291754234
INV375 2 360067285
INV376 1 158111693
INV377 5 390880948
INV378 1 269711166
INV379 1 265788494
INV38 4 373434888
INV380 5 389225578
INV381 8 84827761
INV382 32 385135770
INV383 29 391336068
INV384 26 380265073
INV385 8 257485661
INV386 20 383534134
INV387 18 388997674
INV388 13 372064491
INV389 12 246225518
INV39 42 369246043
INV390 18 394216238
INV391 18 380558243
INV392 10 378653212
INV393 35 286756574
INV394 57 386542022
INV395 41 394290459
INV396 30 391877099
INV397 23 388833300
INV398 17 384297034
INV399 310 391634117
INV4 59667 271706284
INV40 71 345464815
INV400 26 381054851
INV401 8 105967983
INV402 29 389236155
INV403 23 387510109
INV404 25 393194949
INV405 29 393406758
INV406 10 389413895
INV407 12 256001243
INV408 25 382453876
INV409 25 387644779
INV41 11 126310825
INV410 17 390017898
INV411 13 185974631
INV412 1 252586203
INV413 2 382245123
INV414 1 170640157
INV415 3 172715237
INV416 1 265601162
INV417 1 235131548
INV418 8 377013040
INV419 18 389308576
INV42 33 389894099
INV420 6 76294397
INV421 2 316929497
INV422 5 371999024
INV423 13 377525467
INV424 22 380131966
INV425 4 94235370
INV426 20 386111019
INV427 10 330750052
INV428 8 388492156
INV429 29 385235322
INV43 24 300399380
INV430 3 68204675
INV431 1 375708846
INV432 156 377889012
INV433 3 72566929
INV434 18 393806697
INV435 12 375328864
INV436 13 388485421
INV437 17 389690952
INV438 10 355855682
INV439 12 388165924
INV44 7 368066952
INV440 5 66893570
INV441 2 334507981
INV442 2 271847796
INV443 9 384970046
INV444 14 380331769
INV445 17 331062789
INV446 4 353245537
INV447 5 361980503
INV448 1 66459093
INV449 6 375950524
INV45 21 354736242
INV450 11 380698960
INV451 13 393299321
INV452 16 371834617
INV453 4 107829629
INV454 16 390859621
INV455 35 393136677
INV456 18 389411089
INV457 79 348191088
INV458 10 366985680
INV459 18 382945053
INV46 63 320315483
INV460 3 55752453
INV461 23 351194891
INV462 4 361297550
INV463 19 383086968
INV464 16 391635138
INV465 22 382293034
INV466 15 196098011
INV467 12 326431359
INV468 3 345780114
INV469 4 385052575
INV47 4 318600517
INV470 6 392605260
INV471 17 135120912
INV472 1 319032388
INV473 1 282837000
INV474 1 278321370
INV475 1 265031889
INV476 1 264456228
INV477 1 255727343
INV478 1 255305493
INV479 1 230784347
INV48 1 75813843
INV480 9 392641003
INV481 28 356306819
INV482 2 278332741
INV483 8 361353987
INV484 10 379658367
INV485 13 380787037
INV486 8 386860579
INV487 6 361028373
INV488 3 168396230
INV489 7 375518624
INV49 5 362121003
INV490 10 375539956
INV491 5 355133492
INV492 12 346368422
INV493 4 128335036
INV494 18 344289019
INV495 6 343424801
INV496 6 355424926
INV497 9 361129815
INV498 1 209131117
INV499 2 365485920
INV5 75 316413743
INV50 211 385264302
INV500 2 326453370
INV501 2 310804349
INV502 3 355594170
INV503 7 341653095
INV504 44 372332433
INV505 6 201861407
INV506 19 385553829
INV507 11 389495243
INV508 9 318918022
INV509 7 359994759
INV51 55 389266884
INV510 11 363361177
INV511 18 352506103
INV512 2 121342079
INV513 11 370878851
INV514 38 392392993
INV515 39 383674587
INV516 29 392907305
INV517 24 381869223
INV518 13 164951452
INV519 41 380881169
INV52 16 251967525
INV520 15 386326246
INV521 9 137942415
INV522 1 410988561
INV523 2 347081175
INV524 2 60458881
INV525 1 429819325
INV526 1 230177572
INV527 2 394052085
INV528 35 354776612
INV529 7 318208416
INV53 24 388112032
INV530 5 336561253
INV531 7 357043306
INV532 7 262116983
INV533 1 170575982
INV534 2 287036945
INV535 2 275604705
INV536 3 367947227
INV537 3 342256987
INV538 5 256835876
INV539 13 321847088
INV54 39 380190174
INV540 5 332460113
INV541 95 319933371
INV542 12 328718900
INV543 9 217598510
INV544 20 352503315
INV545 9 379049671
INV546 14 374215308
INV547 15 347131978
INV548 3 328312092
INV549 4 369177951
INV55 19 377508302
INV550 3 246468438
INV551 5 376372316
INV552 11 376604103
INV553 17 381822991
INV554 22 391138986
INV555 6 54648714
INV556 12 377183847
INV557 30 388952266
INV558 3 326197890
INV559 3 271412684
INV56 26716 351200192
INV560 6 360181556
INV561 18 382522482
INV562 24 379871629
INV563 21 312971658
INV564 22 381784561
INV565 21 380590911
INV566 13 371720425
INV567 17 390781836
INV568 3 78204341
INV569 17 377301939
INV57 126337 102452898
INV570 12 357316205
INV571 6 368644317
INV572 9 270151474
INV573 12 189039214
INV574 1 244108438
INV575 1 210424776
INV576 2 347597490
INV577 2 286016373
INV578 2 120783828
INV579 22 392193755
INV58 167094 134107554
INV580 13 360806743
INV581 11 375564408
INV582 9 362288897
INV583 3 377576368
INV584 4 158823784
INV585 12 376095937
INV586 6 372905819
INV587 7 388366567
INV588 7 351386075
INV589 12 377915288
INV59 126883 112528029
INV590 10 168222845
INV591 21 336280653
INV592 11 387853015
INV593 17 383594904
INV594 12 371624632
INV595 4 205127384
INV596 1 255265360
INV597 1 230794410
INV598 2 372619140
INV599 2 311523487
INV6 170 364968923
INV60 37136 273256295
INV600 13 393665610
INV601 24 199571394
INV602 2 323510804
INV603 12 381394394
INV604 12 281321844
INV605 6 301645505
INV606 3 327580854
INV607 2 283053804
INV608 4 358883688
INV609 3 313487646
INV61 2779 371575686
INV610 12 372628339
INV611 11 296511468
INV612 12 205288598
INV613 1 329103898
INV614 1 266482116
INV615 1 255371252
INV616 1 249620899
INV617 11 381319634
INV618 28 382489592
INV619 15 383181010
INV62 44 370097884
INV620 13 350686833
INV621 1 90894639
INV622 5 367141834
INV623 4 355766912
INV624 6 390997169
INV625 1 283143227
INV626 7 385962722
INV627 18 390420686
INV628 14 352409616
INV629 3 310319640
INV63 24 379270301
INV630 1 94671628
INV631 4 375545906
INV632 2 330374624
INV633 9 385008187
INV634 36 348936130
INV635 7 362657616
INV636 12 375776805
INV637 21 386373372
INV638 28 385558874
INV639 2 30875957
INV64 5 76533839
INV640 30 377576257
INV641 16 383023174
INV642 25 385163881
INV643 20 289852567
INV644 11 387811488
INV645 13 388478264
INV646 20 388641472
INV647 37 387165660
INV648 14 208952549
INV649 33 393285708
INV65 32 391299062
INV650 13 364621498
INV651 12 378544770
INV652 14 393303348
INV653 17 283001740
INV654 25 393022599
INV655 6 259595995
INV656 2 306898484
INV657 22 392724989
INV658 11 81108636
INV659 1 334972678
INV66 25 362900281
INV660 1 327956322
INV661 4 369938243
INV662 10 387945021
INV663 6 333511012
INV664 3 390034570
INV665 6 388490213
INV666 37 293380102
INV667 3 330508129
INV668 3 304092200
INV669 4 386935527
INV67 18 380479131
INV670 16 364918260
INV671 10 392609098
INV672 30 381546124
INV673 2 331139274
INV674 5 390800394
INV675 2 93184197
INV676 9 363742103
INV677 11 374818742
INV678 13 353874383
INV679 29 353592845
INV68 19 390062857
INV680 6 313902203
INV681 2 325968719
INV682 2 326866526
INV683 2 294862287
INV684 2 277963616
INV685 1 135489923
INV686 5 389105293
INV687 21 334259074
INV688 19 374293438
INV689 21 257681977
INV69 5 134896453
INV690 15 378008119
INV691 18 345890599
INV692 9 374177525
INV693 13 282334662
INV694 13 367448714
INV695 14 383036237
INV696 9 337662876
INV697 4 285079875
INV698 13 380626621
INV699 20 391060643
INV7 5 352575630
INV70 18 373966012
INV700 17 236492487
INV701 1 253604678
INV702 1 244180387
INV703 2 385719063
INV704 2 323852856
INV705 3 391496974
INV706 69 343048078
INV707 3 58690555
INV708 1 427500052
INV709 1 280788551
INV71 24 386584721
INV710 1 231232069
INV711 2 365961697
INV712 2 306037738
INV713 2 294194033
INV714 8 383537417
INV715 10 382401646
INV716 15 373941744
INV717 2 278659155
INV718 5 350216916
INV719 5 342671345
INV72 8 380395300
INV720 7 377861791
INV721 14 385594223
INV722 25 241789371
INV723 2 304382108
INV724 5 380650692
INV725 6 108274197
INV726 30 387029729
INV727 27 330887562
INV728 3 314705854
INV729 4 344406745
INV73 19 379365223
INV730 5 389867528
INV731 5 353121931
INV732 14 392298773
INV733 2 53978732
INV734 17 382363442
INV735 13 374918202
INV736 15 379396417
INV737 103 385952128
INV738 20 386688731
INV739 18 382007266
INV74 9 138772803
INV740 57 153866701
INV741 5 219711870
INV742 2 319873814
INV743 6 380185718
INV744 3 381341903
INV745 1 111009446
INV746 5 379226736
INV747 12 393993623
INV748 22 391120037
INV749 20 316738233
INV75 28 391443580
INV750 1 263587734
INV751 2 374750442
INV752 2 338140745
INV753 2 298578205
INV754 5 384869169
INV755 30 387739996
INV756 13 296449972
INV757 18 279137441
INV758 2 322765580
INV759 3 390029089
INV76 28 392100242
INV760 4 345523436
INV761 2 287481868
INV762 3 368157705
INV763 4 330380185
INV764 2 273986171
INV765 11 380263283
INV766 21 357807916
INV767 12 391993231
INV768 8 369418028
INV769 9 378821074
INV77 45 382097969
INV770 10 378877305
INV771 2 122089777
INV772 7 366744808
INV773 18 393384596
INV774 28 374632208
INV775 17 380406226
INV776 10 104480107
INV777 1 298134333
INV778 6 372478433
INV779 7 273110839
INV78 27 372689086
INV780 1 174811163
INV781 1 246577358
INV782 3 380592957
INV783 8 336515494
INV784 5 388249994
INV785 7 360174377
INV786 8 393835422
INV787 7 326451249
INV788 18 390226185
INV789 4 212448392
INV79 18 385206419
INV790 2 361639366
INV791 11 389090510
INV792 24 261483440
INV793 20 187767331
INV794 1 300440965
INV795 1 255158195
INV796 1 235639307
INV797 1 234027751
INV798 5 364518894
INV799 1 52122333
INV8 7 383441747
INV80 12 373566826
INV800 17 394627877
INV801 24 372312688
INV802 5 353472817
INV803 6 348815087
INV804 3 142239958
INV805 9 371553807
INV806 10 389038857
INV807 15 393343847
INV808 354 351174080
INV809 61 370950558
INV81 1 94407144
INV810 13 377490054
INV811 17 362779264
INV812 1 215246178
INV813 1 179976030
INV814 2 326215908
INV815 12 393295794
INV816 17 355147463
INV817 7 364022270
INV818 8 232711543
INV819 10 320236834
INV82 15 381614547
INV820 5 374560279
INV821 5 347050153
INV822 6 365683735
INV823 8 350757240
INV824 8 330705725
INV825 7 319315304
INV826 8 294380847
INV827 8 300070536
INV828 5 296140165
INV829 7 321898042
INV83 29 387067226
INV830 8 344779364
INV831 5 204172647
INV832 8 363714706
INV833 8 335684798
INV834 7 325614821
INV835 8 343203705
INV836 8 295765726
INV837 4 296872836
INV838 1 277791574
INV839 2 374437900
INV84 25 384930026
INV840 3 384355230
INV841 4 287970803
INV842 8 310860357
INV843 1 87642240
INV844 3 322074102
INV845 5 350860081
INV846 3 341421742
INV847 3 303252646
INV848 3 274953531
INV849 5 354560190
INV85 18 381070342
INV850 4 293401691
INV851 5 291612199
INV852 6 363161146
INV853 7 367190402
INV854 1 63881323
INV855 7 369938164
INV856 24 385109501
INV857 29 371254400
INV858 3 369936174
INV859 3 324539581
INV86 96898 235181623
INV860 4 365244967
INV861 5 389493350
INV862 6 394661900
INV863 13 382083182
INV864 31 381763837
INV865 28 392125926
INV866 4 128300843
INV867 4 359450428
INV868 5 357390477
INV869 10 360971319
INV87 124474 97335014
INV870 10 388368184
INV871 12 376602273
INV872 78 347723211
INV873 3 159381941
INV874 8 277689252
INV875 2 308292894
INV876 4 378776770
INV877 3 224250587
INV878 2 353669327
INV879 3 365790299
INV88 28942 319697553
INV880 5 373092601
INV881 25 383158187
INV882 13 390048803
INV883 10 389033966
INV884 13 387771417
INV885 15 383558849
INV886 8 145928775
INV887 16 387212131
INV888 17 373736547
INV889 10 387894809
INV89 28941 347133943
INV890 13 380870662
INV891 36 385258928
INV892 13 163501620
INV893 28 381827489
INV894 22 374847337
INV895 2 310213387
INV896 4 223537066
INV897 1 311186714
INV898 4 305252952
INV899 1 117261666
INV9 4 353796308
INV90 20 388604938
INV900 4 325431757
INV901 5 343105299
INV902 8 390057518
INV903 11 390412576
INV904 18 344362951
INV905 4 389304644
INV906 8 374713972
INV907 4 67335450
INV908 1 354881887
INV909 1 306296502
INV91 15 389699299
INV910 2 379020699
INV911 10 369838626
INV912 2 26750373
INV913 1 249865697
INV914 3 387636064
INV915 14 388824602
INV916 16 387485480
INV917 8 379220830
INV918 6 382970618
INV919 3 146110617
INV92 16 252138391
INV920 10 369487108
INV921 12 390659631
INV922 23 390394397
INV923 25 366663447
INV924 15 378170753
INV925 12 180879245
INV926 22 392034752
INV927 12 386348701
INV928 10 373953727
INV929 6 388811552
INV93 34 391108680
INV930 25 386609090
INV931 13 334938607
INV932 3 236174852
INV933 5 333202408
INV934 7 380888452
INV935 6 288483784
INV936 3 359596411
INV937 3 275853845
INV938 5 376167017
INV939 7 369632890
INV94 71 392017627
INV940 15 378314108
INV941 17 368087933
INV942 5 133748391
INV943 20 388296339
INV944 17 379457536
INV945 20 368530964
INV946 5 394539175
INV947 1 71901920
INV948 6 370194894
INV949 8 316109534
INV95 24 388974367
INV950 1 991969171
INV951 1 998895236
INV952 1 991394496
INV953 1 709211797
INV954 1 559013835
INV955 1 538612828
INV956 1 476618521
INV957 1 348474640
INV958 1 332259893
INV959 1 287425978
INV96 21 381982755
INV960 1 237816702
INV961 1 222571878
INV962 2 391571136
INV963 8 340292240
INV964 1 47220557
INV965 4 366546274
INV966 12 379725079
INV967 19 391162514
INV968 10 251573840
INV969 19 379932152
INV97 20 377528210
INV970 33 382987660
INV971 33 386339958
INV972 30 353746939
INV973 21 371601066
INV974 6 362567176
INV975 13 390937191
INV976 12 231701502
INV977 27 388004708
INV978 229 382141802
INV979 33 392005379
INV98 24 388990898
INV980 11 192522327
INV981 20 349696121
INV982 9 386500094
INV983 11 373924042
INV984 9 250287188
INV985 16 392208593
INV986 30 375590146
INV987 20 381850848
INV988 9 220479775
INV989 3 349443465
INV99 29 394663938
INV990 3 121655962
INV991 1 378734160
INV992 1 272287048
INV993 6 307813224
INV994 29 391276627
INV995 16 383716194
INV996 34 374759466
INV997 5 262281928
INV998 11 371329702
INV999 6 368879584
MAM1 32392 323881936
MAM10 26814 24994146
MAM100 5 381968701
MAM101 4 345040697
MAM102 3 176472919
MAM103 6 356825309
MAM104 3 354814440
MAM105 3336 333279354
MAM106 67918 268571517
MAM107 98468 193931907
MAM108 13299 242723303
MAM109 4 274800947
MAM11 13731 20581276
MAM110 4 294612101
MAM111 4 368804057
MAM112 5 360824188
MAM113 3 381844289
MAM114 4 323611747
MAM115 5 314441637
MAM116 278 273083750
MAM117 1 216965501
MAM118 1 210729441
MAM119 2 349064804
MAM12 3445 7368868
MAM120 2 311803703
MAM121 2 284093331
MAM122 3 348809871
MAM123 4 369368223
MAM124 5 363867118
MAM125 1 61486999
MAM126 391 303038843
MAM127 2 387082860
MAM128 2 304198725
MAM129 3 374133223
MAM13 107 699953
MAM130 3 326166110
MAM131 4 378433792
MAM132 4 343736516
MAM133 25 156133341
MAM134 2 295910882
MAM135 3 365955123
MAM136 3 347352947
MAM137 3 322237442
MAM138 4 341689478
MAM139 5 362834364
MAM14 20 277696380
MAM140 7 390905713
MAM141 3 258595851
MAM142 2 333773690
MAM143 3 387942990
MAM144 3 354718536
MAM145 2 226942227
MAM146 3 311333393
MAM147 4 346893067
MAM148 5 358087510
MAM149 7 370527586
MAM15 1 249270926
MAM150 141 52864919
MAM151 2 381699852
MAM152 2 379453767
MAM153 2 323756069
MAM154 3 363198547
MAM155 2 215864552
MAM156 4 373314142
MAM157 5 370562270
MAM158 3 229138897
MAM159 2 357862388
MAM16 2 343930246
MAM160 1 148378616
MAM161 2 277983130
MAM162 3 347551233
MAM163 3 317094091
MAM164 4 359797234
MAM165 5 367203739
MAM166 8032 43204493
MAM17 3 325384739
MAM18 1 90795278
MAM19 4 322903327
MAM2 22255 277077797
MAM20 4 298795355
MAM21 6 353843759
MAM22 5 329700903
MAM23 2 289079565
MAM24 3 348530310
MAM25 4 336581445
MAM26 5 375256260
MAM27 6 373952570
MAM28 8 377813420
MAM29 5 379300313
MAM3 2 316219032
MAM30 1 38035513
MAM31 5 285741626
MAM32 5 342804543
MAM33 8 370485433
MAM34 6 316655225
MAM35 4 238884849
MAM36 4 355768297
MAM37 6 355037276
MAM38 7 389945117
MAM39 6 319172640
MAM4 2 376685399
MAM40 5 323047396
MAM41 4 347221982
MAM42 5 288444151
MAM43 5 375232988
MAM44 5 248962388
MAM45 1 277956744
MAM46 1 154038104
MAM47 3 374028897
MAM48 2 298256496
MAM49 3 355148320
MAM5 2 295769989
MAM50 3 355658200
MAM51 3 369352591
MAM52 15 389812204
MAM53 54 7614329
MAM54 215 34073042
MAM55 431 71272130
MAM56 861 68509101
MAM57 1706 2411269
MAM58 6836 6159435
MAM59 110526 193403794
MAM6 2 385026516
MAM60 33191 281608286
MAM61 4 358286156
MAM62 5 387739617
MAM63 5 335893012
MAM64 6 364021592
MAM65 6 304412506
MAM66 10 386743576
MAM67 132589 153984716
MAM68 117943 169520964
MAM69 7803 6806230
MAM7 3 316699161
MAM70 1 716413629
MAM71 1 662751787
MAM72 1 611347268
MAM73 1 464895054
MAM74 1 288121652
MAM75 3 338107697
MAM76 1 223449203
MAM77 1 210645437
MAM78 1 201318998
MAM79 1 197708286
MAM8 5 343489620
MAM80 2 320231256
MAM81 2 293750401
MAM82 3 367535284
MAM83 4 351244600
MAM84 367 269065793
MAM85 1 203623556
MAM86 2 383513587
MAM87 4 383666147
MAM88 5 381503248
MAM89 263 390074346
MAM9 933 216317382
MAM90 2 265153725
MAM91 4 366992153
MAM92 5 369689861
MAM93 5 392803577
MAM94 6 298207437
MAM95 3 363734450
MAM96 1 118519168
MAM97 3 328935722
MAM98 4 359964523
MAM99 4 383777488
PAT1 420070 157361480
PAT10 304138 130867531
PAT100 352852 189327041
PAT101 310862 206556098
PAT102 261889 226571161
PAT103 130469 96637053
PAT104 304402 217824161
PAT105 276793 236021165
PAT106 255575 243191966
PAT107 219302 91982645
PAT108 185317 167852275
PAT109 193799 145642177
PAT11 236002 217109413
PAT110 99282 56236103
PAT111 244010 110313663
PAT112 143102 226374942
PAT113 78461 27196701
PAT114 88272 271848294
PAT115 224855 124891137
PAT116 225588 104815240
PAT117 1433 4501745
PAT118 247765 75673289
PAT119 230776 33741646
PAT12 83479 75654154
PAT120 94886 123403652
PAT121 98574 119749391
PAT122 81936 115812708
PAT123 202984 107720769
PAT124 26268 9055716
PAT125 203753 100524714
PAT126 183495 80758770
PAT127 117401 19496561
PAT128 249524 208801833
PAT129 384350 114595535
PAT13 242994 211781414
PAT130 54355 7592425
PAT131 283244 179648818
PAT132 123901 298046155
PAT133 110594 304028648
PAT134 393156 122357792
PAT135 289830 158267892
PAT136 13515 9100944
PAT137 287143 182661675
PAT138 409358 14024130
PAT139 496793 33315099
PAT14 328221 148439163
PAT140 525210 7878150
PAT141 153477 3896858
PAT142 377387 123755135
PAT143 245735 106348136
PAT144 259895 238802744
PAT145 4634 392128968
PAT146 190899 207809354
PAT147 308470 120437803
PAT148 140525 153741649
PAT149 6433 91705488
PAT15 63785 1594625
PAT150 177885 181303248
PAT151 71548 185117089
PAT152 75797 115786083
PAT153 75754 115775734
PAT154 46229 38674255
PAT155 245086 68542189
PAT156 202127 63182312
PAT157 264560 57807373
PAT158 309566 83974022
PAT159 458755 54678106
PAT16 197471 165311926
PAT160 227775 118065838
PAT161 359528 132220619
PAT162 288071 50679473
PAT163 154892 4647464
PAT164 228343 77240368
PAT165 228223 72940282
PAT166 281346 18592237
PAT167 65057 7149686
PAT168 153383 170227500
PAT169 73417 134980723
PAT17 217860 141787822
PAT170 74139 123431457
PAT171 137229 84274353
PAT172 175192 2627880
PAT173 233544 99258157
PAT174 198431 145045588
PAT175 229731 110452631
PAT176 105692 68108984
PAT177 80124 122466507
PAT178 260808 46028950
PAT179 294811 4422165
PAT18 217803 104595857
PAT180 7891 118365
PAT181 278538 10765362
PAT182 99589 135915721
PAT183 220910 105875726
PAT184 23918 35278552
PAT185 143999 206566501
PAT186 173285 186742155
PAT187 70129 243259642
PAT188 6542 8869371
PAT189 137168 133366031
PAT19 238917 105580979
PAT190 136591 204923644
PAT191 208574 98959751
PAT192 284107 31395303
PAT193 26281 42269507
PAT194 264589 66935450
PAT195 227270 82111975
PAT196 179588 5746816
PAT197 194347 81151001
PAT198 52345 9088588
PAT199 82690 146051882
PAT2 329682 203027725
PAT20 217496 131790868
PAT200 75930 116106222
PAT201 76058 115438165
PAT202 205771 85563217
PAT203 2801 56020
PAT204 342231 6844620
PAT205 341891 7168782
PAT206 341071 7503562
PAT207 331154 110021550
PAT208 268658 230373189
PAT209 282624 222310160
PAT21 295521 53395748
PAT210 192664 139614235
PAT211 276098 235021090
PAT212 188385 291326630
PAT213 137484 196232251
PAT214 247191 246690030
PAT215 11728 387687504
PAT216 313354 152356909
PAT217 244602 252477336
PAT218 160029 300870611
PAT219 215545 135077252
PAT22 146944 94851159
PAT220 172971 290885692
PAT221 266029 215708369
PAT222 351360 145806942
PAT223 304049 76034844
PAT224 317818 206630332
PAT225 43590 365712261
PAT226 151381 180550783
PAT227 338212 193787787
PAT228 332520 206353769
PAT229 155792 199233054
PAT23 196054 155782932
PAT230 249094 251157045
PAT231 209852 277995521
PAT232 184404 195925874
PAT233 326554 210405939
PAT234 203551 272092254
PAT235 99377 335866542
PAT236 108195 332037529
PAT237 262381 184432790
PAT238 10551 3893003
PAT239 223859 118359705
PAT24 279885 73143560
PAT240 272870 62593458
PAT241 204521 140753739
PAT242 283956 19296326
PAT243 274486 22246248
PAT244 281624 22162860
PAT245 286514 14630240
PAT246 287155 13479675
PAT247 96564 20012546
PAT248 263509 44902329
PAT249 293106 5569014
PAT25 228143 147531550
PAT250 320135 26229849
PAT251 249058 78016562
PAT252 228425 63564264
PAT26 209294 140242152
PAT27 62577 53805912
PAT28 304663 206977404
PAT29 321047 202868622
PAT3 50185 20260882
PAT30 69606 127456844
PAT31 217213 274043600
PAT32 399532 38379558
PAT33 255491 168752875
PAT34 232105 138105635
PAT35 62839 29375914
PAT36 159609 193120408
PAT37 187244 152013825
PAT38 211998 134510297
PAT39 97878 9820333
PAT4 329493 180385940
PAT40 349669 21562164
PAT41 269130 102155126
PAT42 166 390395449
PAT43 7287 386170547
PAT44 91551 5256634
PAT45 304606 19422510
PAT46 304621 19407682
PAT47 188137 183520250
PAT48 31158 33401194
PAT49 100017 274294954
PAT5 261771 200080773
PAT50 347907 22046915
PAT51 356635 6776065
PAT52 92442 1756398
PAT53 351473 15875984
PAT54 360979 6858601
PAT55 133566 2537754
PAT56 360626 6851894
PAT57 359974 6839506
PAT58 125418 2711844
PAT59 535700 100616524
PAT6 217821 164405163
PAT60 111356 330233433
PAT61 289774 158820679
PAT62 481493 50383058
PAT63 225645 89298067
PAT64 254459 194605980
PAT65 328331 204072087
PAT66 171864 140719964
PAT67 349862 190728733
PAT68 612603 75778089
PAT69 132887 40797313
PAT7 247421 122522264
PAT70 484033 127126269
PAT71 126354 109119371
PAT72 150168 307250321
PAT73 318626 211710240
PAT74 51881 214846609
PAT75 189165 289007376
PAT76 317843 207880789
PAT77 123868 129694058
PAT78 342751 192409991
PAT79 362616 180214431
PAT8 224259 103111502
PAT80 20467 17346132
PAT81 311143 212599739
PAT82 414691 138165335
PAT83 481150 57356698
PAT84 327468 49354777
PAT85 456875 82634238
PAT86 157579 115885389
PAT87 166944 185725555
PAT88 315063 151645570
PAT89 225013 179170486
PAT9 153338 78052846
PAT90 161452 40716387
PAT91 548289 10417491
PAT92 499577 9491963
PAT93 509421 32468072
PAT94 211222 45802544
PAT95 257667 203186481
PAT96 387969 140940984
PAT97 39812 44642305
PAT98 361773 186862184
PAT99 415062 154422395
PHG1 8934 216898203
PHG2 4794 226342207
PHG3 5288 215737428
PHG4 6715 235804048
PHG5 5551 225127794
PHG6 3330 151244401
PLN1 135615 171563507
PLN10 18946 157439113
PLN100 1 225803546
PLN100 1 703299309
PLN100 1 569771178
PLN100 1 620176429
PLN100 1 717542863
PLN100 1 493761083
PLN100 1 746502734
PLN100 1 752612656
PLN100 1 648661963
PLN100 51 362271236
PLN100 6678 233646823
PLN101 1 219123305
PLN101 1 445829560
PLN101 1 657893865
PLN101 1 636117214
PLN101 1 520569408
PLN101 1 614738994
PLN101 1 536175046
PLN101 1 610578938
PLN101 4 16378138
PLN101 58 389996895
PLN101 14 385024567
PLN102 2 394302667
PLN102 30 368986150
PLN102 14 379761940
PLN102 14 388380456
PLN102 5 138123356
PLN102 14 386817082
PLN102 14 393670454
PLN102 28 388378543
PLN102 21 371825237
PLN102 14 382705053
PLN102 5 137783507
PLN103 55 43040327
PLN103 13 362021382
PLN103 14 384652328
PLN103 14 385328574
PLN103 14 387607699
PLN103 13 362161900
PLN103 7 192427420
PLN103 14 391787584
PLN103 14 371741286
PLN103 10 360532952
PLN103 5 370119782
PLN104 15 305289289
PLN104 8 393655910
PLN104 6 194621872
PLN104 23 318601285
PLN104 4 331833036
PLN104 6 383779503
PLN104 7 364418253
PLN104 6 168945745
PLN104 11 364495457
PLN104 13 371343624
PLN104 14 390506009
PLN105 2 286029496
PLN105 50 388504808
PLN105 119 388423097
PLN105 2 272777406
PLN105 3 366184951
PLN105 4 390049233
PLN105 26 393235158
PLN105 9 339543817
PLN105 19 386115356
PLN105 4 322858024
PLN105 1 79481305
PLN106 2 307738366
PLN106 5 345056615
PLN106 6 348214746
PLN106 7 349249048
PLN106 8 356243003
PLN106 3 198571596
PLN106 3 333480027
PLN106 53 388888259
PLN106 222 363108809
PLN106 10 364192173
PLN106 1 291295799
PLN107 2 269669619
PLN107 1 258385429
PLN107 1 310695138
PLN107 2 390386182
PLN107 1 268171085
PLN107 144 349346382
PLN107 12 388150704
PLN107 2 287149637
PLN107 3 359070095
PLN107 10 373903616
PLN107 2 159588847
PLN108 1 157681923
PLN108 5 371769032
PLN108 7 383050287
PLN108 9 373845120
PLN108 7 344699691
PLN108 186 261971029
PLN108 1 865431811
PLN108 1 841368522
PLN108 1 772393794
PLN108 1 766078222
PLN108 1 735900830
PLN109 40 376080648
PLN109 1 693266847
PLN109 1 690056233
PLN109 1 654671025
PLN109 1 681539918
PLN109 1 650134427
PLN109 1 643737533
PLN109 1 547487370
PLN109 1 545352555
PLN109 1 528421643
PLN109 1 538505002
PLN11 29376 278343654
PLN110 33 389701062
PLN110 1 487455108
PLN110 1 484156440
PLN110 1 426775217
PLN110 2 882175
PLN110 1 1574527093
PLN110 1 1365994436
PLN110 1 1520236431
PLN110 21 341095642
PLN110 5 135803197
PLN110 14 377335903
PLN111 106 384154506
PLN111 14 378243710
PLN111 14 386520074
PLN111 14 381342717
PLN111 12868 372340779
PLN111 23805 46671472
PLN112 56 375854932
PLN113 1 136522531
PLN114 3 383186249
PLN115 2 268356222
PLN116 2 324123174
PLN117 3 363018427
PLN118 27 379124606
PLN119 19 134550855
PLN12 2660 334399488
PLN120 57 390189770
PLN121 11 373036233
PLN122 8 357693623
PLN123 6 351635285
PLN124 12 293471641
PLN125 78 341267500
PLN126 131 317758159
PLN127 130 348798505
PLN128 119 246756089
PLN129 196 355571810
PLN13 37 329935405
PLN130 129 347273899
PLN131 99 327554070
PLN132 48 365833376
PLN133 60 352557038
PLN134 204 383855350
PLN135 112 391758974
PLN136 84 391468457
PLN137 110 340740848
PLN138 69 334048427
PLN139 15 374915998
PLN14 46 124218893
PLN140 15 376631523
PLN141 117 268512615
PLN142 100 319711472
PLN143 22 387363813
PLN144 60 393232941
PLN145 290 225319064
PLN146 49 376691198
PLN147 107 332762629
PLN148 6 326759735
PLN149 17 340023864
PLN15 9 366014477
PLN150 115 393450449
PLN151 69 377992023
PLN152 47 381360174
PLN153 58 300160183
PLN154 2 265995834
PLN155 3 380342000
PLN156 3 341478110
PLN157 4 364941990
PLN158 2 267241309
PLN159 3 377845747
PLN16 2396 340681670
PLN160 2 218300262
PLN161 3 351455647
PLN162 3 282049637
PLN163 2 296748967
PLN164 2 276176029
PLN165 2 265406188
PLN166 3 366102397
PLN167 3 310633103
PLN168 1 90243615
PLN169 2 339450567
PLN17 1949 233857567
PLN170 2 383562320
PLN171 2 318742289
PLN172 2 356433379
PLN173 2 302010261
PLN174 2 361337975
PLN175 41 389463936
PLN176 56 346155909
PLN177 28 344950285
PLN178 66 101415911
PLN179 30 392671392
PLN18 3 330514248
PLN180 41 368093400
PLN181 7 348276578
PLN182 4 324836395
PLN183 19 371838636
PLN184 161 214327908
PLN185 37 16871
PLN186 149 79314
PLN187 2469 93786416
PLN188 7181 18795412
PLN189 14346 29953091
PLN19 37 343581774
PLN190 97593 209249304
PLN191 129575 90168428
PLN192 158758 148037237
PLN193 162646 146386220
PLN194 58045 31864949
PLN195 181512 123932051
PLN196 49957 254171224
PLN197 41545 288268410
PLN198 72045 110649218
PLN199 98644 85504671
PLN2 42546 278058457
PLN20 126 319952181
PLN200 49729 72847341
PLN201 25061 110565816
PLN202 13561 89764040
PLN203 1 774434471
PLN204 8305 28494037
PLN205 1861 361385154
PLN206 5 372618381
PLN207 6 372447772
PLN208 6 368295254
PLN209 2 132503639
PLN21 1 337042926
PLN210 498 311771607
PLN211 8 327823341
PLN212 6 343447962
PLN213 1 66465249
PLN214 1 474651383
PLN215 1 612216829
PLN216 1 571018318
PLN217 1 574020038
PLN218 1 538550714
PLN219 1 514282554
PLN22 1 177533547
PLN220 1 575541767
PLN221 134 336045988
PLN222 13675 307007082
PLN223 174190 123953405
PLN224 24770 16089213
PLN225 148143 156040280
PLN226 149395 145732965
PLN227 87082 72022901
PLN228 154400 132580337
PLN229 163871 118480009
PLN23 1 292038349
PLN230 25390 27604508
PLN231 148077 133571553
PLN232 126444 157671134
PLN233 167379 121297811
PLN234 116223 121189015
PLN235 134563 149280451
PLN236 102262 122013001
PLN237 135675 149876747
PLN238 126471 162974837
PLN239 120449 166599335
PLN24 1 253125799
PLN240 21324 19228561
PLN241 124181 164045602
PLN242 112746 172833715
PLN243 86182 158997907
PLN244 118871 172011373
PLN245 116358 186203331
PLN246 39938 242486694
PLN247 18945 346241597
PLN248 19737 363518883
PLN249 10232 333664247
PLN25 1 251194792
PLN250 302 288936846
PLN251 5 324373291
PLN252 1670 369972731
PLN253 1620 2256477
PLN254 1384 387002570
PLN255 8 179149947
PLN256 1282 232633870
PLN257 1 522466905
PLN258 1 675310294
PLN259 1 628753756
PLN26 1 253267520
PLN260 1 624247919
PLN261 1 599018945
PLN262 1 573247234
PLN263 1 634667502
PLN264 8563 149646365
PLN265 1 727344967
PLN266 1 946003158
PLN267 1 965754312
PLN268 1 906459801
PLN269 1 876148008
PLN27 1 267785325
PLN270 1 885153844
PLN271 1 899925126
PLN272 1 528437893
PLN273 4156 344360411
PLN274 10 362580157
PLN275 4 120184706
PLN276 129 363594612
PLN277 404 366581476
PLN278 9 335385998
PLN279 130 308977848
PLN28 1 175912755
PLN280 206 92200731
PLN281 16 383095167
PLN282 47 120890229
PLN283 1 541700351
PLN284 1 696809892
PLN285 1 655542733
PLN286 1 648987779
PLN287 1 622068216
PLN288 1 583456046
PLN289 1 654005093
PLN29 1 266007691
PLN290 130 298375
PLN291 1 522466905
PLN292 1 675310294
PLN293 1 628753756
PLN294 1 624247919
PLN295 1 599018945
PLN296 1 573247234
PLN297 1 634667502
PLN298 344 95023900
PLN299 1 521073757
PLN3 3692 380161517
PLN30 1 244603042
PLN300 1 672273650
PLN301 1 634137895
PLN302 1 624121443
PLN303 1 607506942
PLN304 1 564293627
PLN305 1 632401812
PLN306 1 520603772
PLN307 1 661076038
PLN308 1 626572591
PLN309 1 612852138
PLN31 1 277312646
PLN310 1 598896166
PLN311 1 570629545
PLN312 1 623813090
PLN313 1 513014082
PLN314 1 653624577
PLN315 1 616219606
PLN316 1 610044819
PLN317 1 583417444
PLN318 1 550735148
PLN319 1 620104558
PLN32 19814 317982365
PLN320 1 536602846
PLN321 1 685423969
PLN322 1 640667275
PLN323 1 639123876
PLN324 1 612949391
PLN325 1 577192767
PLN326 1 641629864
PLN327 1 500012378
PLN328 1 648922534
PLN329 1 604770208
PLN33 96584 101383193
PLN330 1 597403059
PLN331 1 576456374
PLN332 1 556080982
PLN333 1 603311816
PLN334 1 512023576
PLN335 1 652551272
PLN336 1 615767531
PLN337 1 605571303
PLN338 1 592249714
PLN339 1 549757368
PLN34 113437 117621940
PLN340 1 616509610
PLN341 2 1184
PLN342 1 550024188
PLN343 1 710194481
PLN344 1 661081403
PLN345 1 659460550
PLN346 1 630572514
PLN347 1 598618390
PLN348 1 658974642
PLN349 1 559656399
PLN35 57311 72144580
PLN350 1 717517502
PLN351 1 672450454
PLN352 1 665297378
PLN353 1 636785599
PLN354 1 599706080
PLN355 1 675658265
PLN356 1 523168208
PLN357 1 671211297
PLN358 1 630677708
PLN359 1 623428415
PLN36 28689 28922869
PLN360 1 604298040
PLN361 1 558526623
PLN362 1 628419988
PLN363 1 495661851
PLN364 1 640830439
PLN365 1 597781253
PLN366 1 600363860
PLN367 1 570178053
PLN368 1 534998810
PLN369 1 616598997
PLN37 2648 194594881
PLN370 1 537457279
PLN371 1 685947972
PLN372 1 649921694
PLN373 1 641099225
PLN374 1 611845738
PLN375 1 581041262
PLN376 1 655783664
PLN377 1 521174834
PLN378 1 667717957
PLN379 1 631819663
PLN38 344 254550430
PLN380 1 624692602
PLN381 1 597351075
PLN382 1 561737938
PLN383 1 629651422
PLN384 1 524514255
PLN385 1 670202054
PLN386 1 631946783
PLN387 1 626743494
PLN388 1 600801835
PLN389 1 566971015
PLN39 400 261235914
PLN390 1 629827058
PLN391 1 522114480
PLN392 1 671530377
PLN393 1 631910401
PLN394 1 622474059
PLN395 1 598240357
PLN396 1 562137082
PLN397 1 633805855
PLN398 1 525723083
PLN399 1 684336246
PLN4 3520 387694430
PLN40 198 168828441
PLN400 1 636053469
PLN401 1 629969872
PLN402 1 604087610
PLN403 1 568600391
PLN404 1 640498578
PLN405 1 519546829
PLN406 1 665715246
PLN407 1 624683667
PLN408 1 621078253
PLN409 1 600910593
PLN41 298 258873545
PLN410 1 558953701
PLN411 1 626840912
PLN412 1 543344542
PLN413 1 697540743
PLN414 1 655862368
PLN415 1 646765634
PLN416 1 618540729
PLN417 1 587963859
PLN418 1 658085510
PLN419 449 378687213
PLN42 339 265493888
PLN420 15 312691008
PLN421 20 111531882
PLN422 1 596211899
PLN423 1 705338699
PLN424 1 493450010
PLN425 1 804285258
PLN426 1 810734643
PLN427 1 673981989
PLN428 1 754496630
PLN429 1 855759449
PLN43 485 350911896
PLN430 1 614042580
PLN431 1 743847818
PLN432 1 673340788
PLN433 1 515668560
PLN434 1 713320806
PLN435 1 703598484
PLN436 1 570159854
PLN437 1 625793224
PLN438 1 721110502
PLN439 1 459355444
PLN44 112 80604200
PLN440 1 745201001
PLN441 1 749284433
PLN442 1 643344672
PLN443 1 595297365
PLN444 1 688905267
PLN445 1 491807393
PLN446 1 769338634
PLN447 1 671568023
PLN448 1 635285330
PLN449 1 745618965
PLN45 455 379563194
PLN450 1 839470345
PLN451 1 646400022
PLN452 1 747589525
PLN453 1 665179885
PLN454 1 506585010
PLN455 1 703962928
PLN456 1 702438406
PLN457 1 568126671
PLN458 1 610851963
PLN459 1 707596419
PLN46 143 364543151
PLN460 1 465558328
PLN461 1 734536914
PLN462 1 738743901
PLN463 1 636778132
PLN464 1 602900890
PLN465 1 697493198
PLN466 1 490518203
PLN467 1 784661008
PLN468 1 810500911
PLN469 1 655314739
PLN47 92 268011045
PLN470 1 752710991
PLN471 1 890847171
PLN472 1 621781073
PLN473 1 743084022
PLN474 1 676741658
PLN475 1 509452426
PLN476 1 710124532
PLN477 1 480767623
PLN478 1 578021311
PLN479 1 620140791
PLN48 108 325736871
PLN480 1 716573881
PLN481 1 476726550
PLN482 1 756324664
PLN483 1 977471539
PLN484 1 642207261
PLN485 1 502612092
PLN486 1 646234737
PLN487 1 605172934
PLN488 1 593744788
PLN489 1 571972453
PLN49 17 390428741
PLN490 1 545472572
PLN491 1 607667504
PLN492 1 590561804
PLN493 1 685720839
PLN494 1 490910922
PLN495 1 782694893
PLN496 1 796420183
PLN497 1 650274702
PLN498 1 739889549
PLN499 1 848590828
PLN5 97858 210738874
PLN50 246 346776993
PLN500 1 610626473
PLN501 1 738023571
PLN502 1 667607564
PLN503 1 506274898
PLN504 1 701434008
PLN505 1 690770133
PLN506 1 567265955
PLN507 1 612987783
PLN508 1 704156067
PLN509 1 475327881
PLN51 155 383508558
PLN510 1 732118298
PLN511 1 733931846
PLN512 1 636796232
PLN513 1 599764323
PLN514 1 691313424
PLN515 1 493357854
PLN516 1 782685093
PLN517 1 786410271
PLN518 1 648139033
PLN519 1 744407562
PLN52 85 329381794
PLN520 1 835583350
PLN521 1 623221719
PLN522 1 741299132
PLN523 1 669032550
PLN524 1 517040482
PLN525 1 711661679
PLN526 1 708205786
PLN527 1 573398137
PLN528 1 583494258
PLN529 1 707105489
PLN53 15 388403916
PLN530 1 471251328
PLN531 1 737453356
PLN532 1 736349413
PLN533 1 639162162
PLN534 1 586755746
PLN535 1 704478343
PLN536 1 492109999
PLN537 1 791475352
PLN538 1 785940626
PLN539 1 661246824
PLN54 22 360710420
PLN540 1 756990402
PLN541 1 858776195
PLN542 1 621195942
PLN543 1 754256086
PLN544 1 670301833
PLN545 1 509263899
PLN546 1 708234589
PLN547 1 725120110
PLN548 1 575129590
PLN549 1 620883766
PLN55 6 376299569
PLN550 1 727285804
PLN551 1 479660269
PLN552 1 745978486
PLN553 1 750160716
PLN554 1 642428577
PLN555 1 591313643
PLN556 1 705330581
PLN557 1 495656580
PLN558 1 803232604
PLN559 1 790745243
PLN56 1 65870126
PLN560 1 657494025
PLN561 1 759305888
PLN562 1 856542542
PLN563 1 628321883
PLN564 1 754364263
PLN565 1 697113365
PLN566 1 504254270
PLN567 1 715354979
PLN568 1 713929667
PLN569 1 572943128
PLN57 93 388494695
PLN570 1 626959190
PLN571 1 715714221
PLN572 1 483823121
PLN573 1 742917797
PLN574 1 748536659
PLN575 1 643784981
PLN576 1 600654286
PLN577 1 685083685
PLN578 1 486317123
PLN579 1 794150360
PLN58 15 373888800
PLN580 1 799857935
PLN581 1 655329108
PLN582 1 749763888
PLN583 1 838116175
PLN584 1 610468321
PLN585 1 736551279
PLN586 1 666328382
PLN587 1 504826275
PLN588 1 702606209
PLN589 1 467876140
PLN59 9 363551984
PLN590 1 566465558
PLN591 1 614421429
PLN592 1 698878671
PLN593 1 480431564
PLN594 1 735408736
PLN595 1 969998116
PLN596 1 635024734
PLN597 10 3368
PLN598 1 595339094
PLN599 1 698605642
PLN6 111631 128056225
PLN60 60 374148929
PLN600 1 499102108
PLN601 1 791748890
PLN602 1 797311483
PLN603 1 656817438
PLN604 1 753360318
PLN605 1 845838138
PLN606 1 619661694
PLN607 1 752772853
PLN608 1 689709469
PLN609 1 509595892
PLN61 14 212654302
PLN610 1 712797596
PLN611 1 710493282
PLN612 1 570643040
PLN613 1 619886155
PLN614 1 705533140
PLN615 1 484551304
PLN616 1 740148362
PLN617 1 757233630
PLN618 1 642499559
PLN619 1 594006513
PLN62 74 124609184
PLN620 1 693261537
PLN621 1 492948387
PLN622 1 781462734
PLN623 1 802944975
PLN624 1 650275864
PLN625 1 756841830
PLN626 1 850623622
PLN627 1 614136911
PLN628 1 723255126
PLN629 1 669876730
PLN63 8 358353307
PLN630 1 507533340
PLN631 1 712168462
PLN632 1 712339524
PLN633 1 564869106
PLN634 1 619418949
PLN635 1 715454519
PLN636 1 478264344
PLN637 1 734693445
PLN638 1 749685439
PLN639 1 633598967
PLN64 3 347496433
PLN640 1 782818162
PLN641 1 1022071454
PLN642 1 971920087
PLN643 1 827198496
PLN644 1 867619200
PLN645 1 806566123
PLN646 1 1015700474
PLN647 1 742303966
PLN648 1 956173857
PLN649 1 916702776
PLN65 4 370651368
PLN650 1 874517040
PLN651 1 816294110
PLN652 1 750216944
PLN653 1 862608691
PLN654 20 4493
PLN655 175 140763171
PLN656 1 516505932
PLN657 1 665585731
PLN658 1 621516506
PLN659 1 610333535
PLN66 2 271593360
PLN660 1 588218686
PLN661 1 561794515
PLN662 1 632540561
PLN663 118 87991
PLN664 1 313789095
PLN665 1 248068439
PLN666 1 241454477
PLN667 1 251811976
PLN668 1 225452224
PLN669 1 173806927
PLN67 1 150766190
PLN670 2 370152128
PLN671 168 374290347
PLN672 603 391598667
PLN673 10 362580157
PLN674 7 281547701
PLN675 1 314258027
PLN676 1 394306295
PLN677 1 325599754
PLN678 1 288763641
PLN679 1 187311108
PLN68 2 288204953
PLN680 1 277174932
PLN681 1 235078182
PLN682 15 332895745
PLN683 16436 36185494
PLN684 5636 1862075
PLN685 5224 2478918
PLN686 1 563502314
PLN687 833 298337632
PLN688 1194 92707173
PLN689 1 594102056
PLN69 2 286787940
PLN690 1 689851870
PLN691 1 495453186
PLN692 1 780798557
PLN693 1 801256715
PLN694 1 651852609
PLN695 1 750843639
PLN696 1 830829764
PLN697 1 615552423
PLN698 1 744588157
PLN699 1 673617499
PLN7 64212 184494355
PLN70 2 295931502
PLN700 1 509857067
PLN701 1 709773743
PLN702 1 713149757
PLN703 1 566080677
PLN704 1 618079260
PLN705 1 720988478
PLN706 1 473592718
PLN707 1 736706236
PLN708 1 750620385
PLN709 1 638686055
PLN71 64 355204210
PLN710 1 480980714
PLN711 6684 330577769
PLN712 3760 370633860
PLN713 10098 326491459
PLN714 1753 12315783
PLN715 1 585266722
PLN716 1 681112512
PLN717 1 775448786
PLN718 1 790338525
PLN719 1 746673839
PLN72 8 357495982
PLN720 1 836514780
PLN721 1 736872137
PLN722 1 676292951
PLN723 1 669155517
PLN724 1 701372996
PLN725 1 615672275
PLN726 1 698614761
PLN727 1 728031845
PLN728 1 722970987
PLN729 12302 8480478
PLN73 2 99419683
PLN730 94681 142561266
PLN731 109096 181644812
PLN732 87295 199568442
PLN733 84116 200951581
PLN734 96957 192847794
PLN735 103728 189113810
PLN736 101951 189299679
PLN737 14727 36372744
PLN738 89195 205942293
PLN739 83730 207398026
PLN74 7 376229618
PLN740 75335 221417945
PLN741 40978 134287562
PLN742 67427 233477171
PLN743 69585 218312714
PLN744 62054 241140453
PLN745 2325 9486856
PLN746 64406 235368998
PLN747 49349 247253708
PLN748 45447 250072436
PLN749 23880 70505306
PLN75 6 342806685
PLN750 63420 234675779
PLN751 52479 245397996
PLN752 54268 243857214
PLN753 55187 260432703
PLN754 53505 242923593
PLN755 9647 34380881
PLN756 53547 253316314
PLN757 59574 235933499
PLN758 56820 243642452
PLN759 41945 137290425
PLN76 6 347730275
PLN760 68029 235416211
PLN761 34353 276782519
PLN762 41314 277680695
PLN763 55331 242129074
PLN764 46040 282464630
PLN765 6 357582661
PLN766 2 87027724
PLN767 1 528447123
PLN768 1 678170541
PLN769 1 639558213
PLN77 6 350661716
PLN770 1 629672760
PLN771 1 608467472
PLN772 1 565695744
PLN773 1 634886329
PLN774 1 532083992
PLN775 1 684376481
PLN776 1 642597466
PLN777 1 631979072
PLN778 1 607115911
PLN779 1 582960187
PLN78 43 144640005
PLN780 1 640026769
PLN781 1 608979116
PLN782 1 720972993
PLN783 1 501257520
PLN784 1 804602427
PLN785 1 808121247
PLN786 1 649118519
PLN787 1 758906661
PLN788 1 861141126
PLN789 1 642382296
PLN79 144 326417895
PLN790 1 759893476
PLN791 1 689766370
PLN792 1 531462149
PLN793 1 714517032
PLN794 1 717288350
PLN795 1 586345039
PLN796 1 626266972
PLN797 1 738085275
PLN798 1 505809789
PLN799 1 759124079
PLN8 21754 107220939
PLN80 7 298887356
PLN800 1 751612808
PLN801 1 653055523
PLN802 7 358620060
PLN803 687 177292972
PLN804 1 478410592
PLN805 1 530843944
PLN806 1 529541203
PLN807 1 616320322
PLN808 1 560314678
PLN809 1 552570299
PLN81 6 332369654
PLN810 1 477706438
PLN811 1 464083788
PLN812 1 411577152
PLN813 1 461076154
PLN814 1 463363089
PLN815 1 481348281
PLN816 1 411112127
PLN817 1 485809178
PLN818 1 525998845
PLN819 1 469027344
PLN82 50 340388796
PLN820 1 409103995
PLN821 1 460274876
PLN822 1 476570508
PLN823 1 445971407
PLN824 1 490396672
PLN825 1 426632976
PLN826 1 538887009
PLN827 1 574640544
PLN828 1 667652801
PLN829 1 573769737
PLN83 40 308864128
PLN830 1 579564072
PLN831 1 506557729
PLN832 1 469999753
PLN833 1 516880681
PLN834 1 454437434
PLN835 1 415133431
PLN836 1 489887590
PLN837 1 289026301
PLN838 1 490033736
PLN839 1 542991241
PLN84 2 108425436
PLN840 1 484002173
PLN841 1 527161174
PLN842 1 513237590
PLN843 1 458108957
PLN844 1 448178421
PLN845 1 577845554
PLN846 1 529955746
PLN847 1 534821622
PLN848 1 551069265
PLN849 1 588203704
PLN85 202 322775705
PLN850 1 459891171
PLN851 1 555382095
PLN852 1 455803086
PLN853 1 509477500
PLN854 1 582703961
PLN855 1 567151184
PLN856 1 459232789
PLN857 1 577255397
PLN858 1 441736736
PLN859 1 534335728
PLN86 6 336790634
PLN860 19 2859863
PLN861 1 613662638
PLN862 1 794474755
PLN863 1 760111594
PLN864 1 769810128
PLN865 1 715684684
PLN866 1 623890083
PLN867 1 755457679
PLN868 1 717109572
PLN869 1 817712742
PLN87 5 336035871
PLN870 1 864624966
PLN871 1 701857263
PLN872 1 726425509
PLN873 1 738041677
PLN874 1 767912069
PLN875 1 504659958
PLN876 1 662526948
PLN877 1 633282846
PLN878 1 534651777
PLN879 1 584285409
PLN88 6 326965702
PLN880 1 507261758
PLN881 1 659687352
PLN882 1 224073253
PLN883 1 198628823
PLN884 1 322486422
PLN885 1 260047251
PLN886 1 262402055
PLN887 1 330012911
PLN888 1 349800169
PLN889 1 354403191
PLN89 5 304407451
PLN890 1 317988395
PLN891 1 376468909
PLN892 313 342168471
PLN893 5 315557653
PLN894 19 349825278
PLN895 12 384118750
PLN896 65 253169681
PLN897 38 343074766
PLN898 5 325733636
PLN899 389 384262295
PLN9 35208 291130285
PLN90 20 316869596
PLN900 10 375480087
PLN901 10 379071384
PLN902 9 351388705
PLN903 2 74237962
PLN904 1 472108912
PLN905 1 611709054
PLN906 1 571129681
PLN907 1 563957086
PLN908 1 535211053
PLN909 1 496554540
PLN91 5 284426683
PLN910 1 578502594
PLN911 127 369812239
PLN912 10 389503495
PLN913 10 374804231
PLN914 8 300501703
PLN915 10 369372075
PLN916 1042 169430586
PLN917 1 605966608
PLN918 1 703076930
PLN919 1 495911329
PLN92 8 327303441
PLN920 1 796169439
PLN921 1 779372321
PLN922 1 665561653
PLN923 1 757165295
PLN924 1 852704148
PLN925 1 623698249
PLN926 1 745048881
PLN927 1 677947850
PLN928 1 524289323
PLN929 1 726838826
PLN93 61 76849044
PLN930 1 701430346
PLN931 1 584133940
PLN932 1 622677745
PLN933 1 745712656
PLN934 1 490622797
PLN935 1 748850018
PLN936 1 753856519
PLN937 1 643890519
PLN938 699 30235861
PLN939 1 593930347
PLN94 2 355063454
PLN940 1 702775664
PLN941 1 494594617
PLN942 1 792837209
PLN943 1 812232696
PLN944 1 661835603
PLN945 1 750337041
PLN946 1 854463248
PLN947 1 623248023
PLN948 1 749950614
PLN949 1 673746810
PLN95 1 333667882
PLN950 1 520815567
PLN951 1 712547961
PLN952 1 703299309
PLN953 1 569771178
PLN954 1 620176429
PLN955 1 717542863
PLN956 1 493761083
PLN957 1 746502734
PLN958 1 752612656
PLN959 1 648661963
PLN96 1 302574826
PLN960 572 38290762
PLN961 1 540897063
PLN962 1 449127287
PLN963 1 425675180
PLN964 1 463192880
PLN965 1 485323027
PLN966 1 448461343
PLN967 1 493511962
PLN968 1 462796039
PLN969 1 589118817
PLN97 1 296818136
PLN970 1 638425132
PLN971 1 716105986
PLN972 1 613160974
PLN973 1 626220839
PLN974 1 551718542
PLN975 1 484215583
PLN976 1 532103454
PLN977 1 480949782
PLN978 1 455353809
PLN979 1 499214392
PLN98 1 257455782
PLN980 1 298028472
PLN981 1 528225653
PLN982 218 367788603
PLN983 6 375232671
PLN984 299 384945076
PLN985 9 251431714
PLN986 130 156049603
PLN987 1 593930347
PLN988 1 702775664
PLN989 1 494594617
PLN99 1 252943167
PLN990 1 792837209
PLN991 1 812232696
PLN992 1 661835603
PLN993 1 750337041
PLN994 1 854463248
PLN995 1 623248023
PLN996 1 749950614
PLN997 1 673746810
PLN998 1 520815567
PLN999 1 712547961
PRI1 23047 60053106
PRI10 2265 387936439
PRI11 4375 381717987
PRI12 2068 191950792
PRI13 2459 391017609
PRI14 17343 243216304
PRI15 27929 79132073
PRI16 96050 166265556
PRI17 11025 363947920
PRI18 3741 383223079
PRI19 15303 353911286
PRI2 23840 319341223
PRI20 2239 172855211
PRI21 1 250749103
PRI22 1 238414537
PRI23 2 387789264
PRI24 2 351926207
PRI25 2 301224727
PRI26 2 270924633
PRI27 3 376243325
PRI28 4 374251276
PRI29 5 290585290
PRI3 2613 370370379
PRI30 42294 314449515
PRI31 19027 23602325
PRI32 53141 193817517
PRI33 4 351860731
PRI34 5 337827736
PRI35 3 297245061
PRI36 3 382019003
PRI37 2 285375381
PRI38 2 306826759
PRI39 2 354172067
PRI4 2409 360399901
PRI40 2 394680893
PRI41 1 242696752
PRI42 1 248387328
PRI43 17505 351769399
PRI44 118186 177543446
PRI45 43987 90998900
PRI46 74331 199953923
PRI47 54422 215579299
PRI48 34648 144367010
PRI49 69722 214218466
PRI5 2593 353874487
PRI50 97702 190783522
PRI51 1131 237091781
PRI52 1 190673448
PRI53 9368 358512524
PRI54 49037 210795631
PRI55 84923 190355815
PRI56 46027 261811275
PRI57 65976 154985719
PRI6 2112 282951291
PRI7 2729 356953890
PRI8 3181 362167571
PRI9 2423 385530941
ROD1 38460 309640694
ROD10 15053 352243468
ROD100 3 326328631
ROD101 5 331474410
ROD102 2 318539651
ROD103 3 346986554
ROD104 2 195914539
ROD105 3 320471619
ROD106 2 303502892
ROD107 2 280790320
ROD108 3 392932004
ROD109 4 351698734
ROD11 1336 2453179
ROD110 2 368221265
ROD111 2 303625032
ROD112 2 292706097
ROD113 2 278161066
ROD114 3 373049758
ROD115 3 349653794
ROD116 3 308876130
ROD117 4 238660990
ROD118 2 379622902
ROD119 2 334811729
ROD12 22213 347967024
ROD120 2 307236712
ROD121 2 287806543
ROD122 3 391762678
ROD123 3 360814732
ROD124 3 314134467
ROD125 4 239932575
ROD126 2 373193903
ROD127 1 157584965
ROD128 2 299783671
ROD129 2 295158694
ROD13 1002 157743814
ROD130 3 388896513
ROD131 3 359745676
ROD132 3 334741362
ROD133 5 333237167
ROD134 2 317726462
ROD135 1 118876157
ROD136 3 341713382
ROD137 4 374029993
ROD138 3 389445867
ROD139 2 291998396
ROD14 53466 238707384
ROD140 2 278095263
ROD141 4 390852856
ROD142 2 370533799
ROD143 2 304047488
ROD144 2 292691026
ROD145 2 276929041
ROD146 3 372795034
ROD147 3 347692711
ROD148 3 308420172
ROD149 4 236625227
ROD15 21658 310382782
ROD150 2 370341452
ROD151 2 307760277
ROD152 2 294424009
ROD153 2 281871870
ROD154 3 372472209
ROD155 3 349207861
ROD156 2 214783614
ROD157 5 332654019
ROD158 2 367229262
ROD159 2 304331769
ROD16 228314 97111734
ROD160 2 288798215
ROD161 2 275554257
ROD162 2 251405689
ROD163 3 354090641
ROD164 3 326613543
ROD165 5 331013327
ROD166 2 368057253
ROD167 2 306226071
ROD168 1 147422267
ROD169 2 291393309
ROD17 97450 65689073
ROD170 3 385188841
ROD171 3 355338747
ROD172 3 326750920
ROD173 5 331081197
ROD174 1 196977572
ROD175 2 340285783
ROD176 2 310111918
ROD177 2 296020819
ROD178 2 268302591
ROD179 3 367814812
ROD18 39834 248462282
ROD180 3 354083518
ROD181 4 377434897
ROD182 2 58596888
ROD183 2 316597187
ROD184 3 346141334
ROD185 3 309646819
ROD186 3 235883790
ROD187 2 332395505
ROD188 2 297647048
ROD189 2 282771228
ROD19 2 383374219
ROD190 4 393253035
ROD191 2 311845466
ROD192 3 332317170
ROD193 4 331904146
ROD194 2 328442178
ROD195 2 293393805
ROD196 1 133371210
ROD197 2 271974197
ROD198 2 251802734
ROD199 3 271982115
ROD2 1810 346955540
ROD20 2 353017828
ROD200 2 270496589
ROD201 3 366902997
ROD202 3 316563723
ROD203 2 193388464
ROD204 4 334716799
ROD205 5 351324292
ROD206 7 371849360
ROD207 6 366049425
ROD208 3 376938858
ROD209 3 338808579
ROD21 2 317259772
ROD210 4 381108299
ROD211 4 323564818
ROD212 6 393907859
ROD213 8 351603620
ROD214 8 357587743
ROD215 1 188060799
ROD216 2 341922886
ROD217 2 316883888
ROD218 2 280377800
ROD219 3 347137656
ROD22 2 289653994
ROD220 3 315189109
ROD221 3 271011851
ROD222 5 354922138
ROD223 5 294688320
ROD224 2 387647059
ROD225 2 325165809
ROD226 2 311669100
ROD227 2 279641759
ROD228 3 378019186
ROD229 3 366857421
ROD23 1 140975125
ROD230 4 391937005
ROD231 3 259447828
ROD232 2 338914351
ROD233 1 159396618
ROD234 2 300967943
ROD235 2 278090573
ROD236 3 382029770
ROD237 3 346788880
ROD238 4 341355724
ROD239 3 299539788
ROD24 3 385591618
ROD240 2 384716882
ROD241 2 334812016
ROD242 2 317562325
ROD243 2 297867706
ROD244 3 391596307
ROD245 3 375850127
ROD246 3 319077903
ROD247 1 96079412
ROD248 4 372403099
ROD249 2 339353113
ROD25 4 335044383
ROD250 2 291476052
ROD251 3 361948668
ROD252 3 323820154
ROD253 4 334059592
ROD254 2 135967815
ROD255 6 388732520
ROD256 2 384840810
ROD257 2 325715141
ROD258 2 293400725
ROD259 3 361928079
ROD26 5 356599364
ROD260 3 312575313
ROD261 4 339307352
ROD262 6 387071614
ROD263 3 323777831
ROD264 2 323038558
ROD265 2 290396403
ROD266 3 353192969
ROD267 2 176309395
ROD268 4 317700958
ROD269 5 354035076
ROD27 2 394024503
ROD270 5 364586500
ROD271 2 377919911
ROD272 2 322351463
ROD273 2 275598125
ROD274 3 359387094
ROD275 4 359114848
ROD276 5 381796720
ROD277 5 291605963
ROD278 2 349406529
ROD279 2 332414924
ROD28 2 369416674
ROD280 1 154951719
ROD281 2 276957429
ROD282 3 340415119
ROD283 4 344898844
ROD284 5 391338277
ROD285 5 302617006
ROD286 2 360867642
ROD287 2 323987561
ROD288 2 295177884
ROD289 3 353085942
ROD29 2 335852806
ROD290 4 349381944
ROD291 5 391992857
ROD292 6 346362378
ROD293 2 318921425
ROD294 2 329179204
ROD295 1 153606186
ROD296 3 389462371
ROD297 3 321351180
ROD298 4 331856423
ROD299 6 392378592
ROD3 1885 351998373
ROD30 2 300392300
ROD300 20448 321922283
ROD31 2 283621167
ROD32 3 348161973
ROD33 5 386542915
ROD34 154 237877425
ROD35 1 193958709
ROD36 2 350925653
ROD37 2 319642044
ROD38 2 276360533
ROD39 3 382322699
ROD4 1944 361078959
ROD40 3 366447402
ROD41 84 245931526
ROD42 2 348668775
ROD43 2 314889876
ROD44 3 389462371
ROD45 3 321351180
ROD46 1 93020901
ROD47 5 385423505
ROD48 6 342729329
ROD49 3 325864489
ROD5 1990 363733749
ROD50 4 358685719
ROD51 4 302148481
ROD52 5 337904903
ROD53 6 385168143
ROD54 6 347801590
ROD55 6 283624907
ROD56 85905 225614486
ROD57 1 203594213
ROD58 2 307631349
ROD59 2 273205312
ROD6 306 57843793
ROD60 2 272523522
ROD61 3 367476852
ROD62 3 318205593
ROD63 5 305035074
ROD64 2 318173246
ROD65 2 308990189
ROD66 2 273361793
ROD67 3 387778067
ROD68 3 350884214
ROD69 4 388911322
ROD7 1975 368354297
ROD70 4 237246301
ROD71 2 368078907
ROD72 2 295232279
ROD73 2 276158786
ROD74 3 370764878
ROD75 3 367374895
ROD76 5 389069045
ROD77 100 129934266
ROD78 2 318742393
ROD79 3 344928637
ROD8 1990 369693686
ROD80 4 373808507
ROD81 3 390678500
ROD82 2 278778348
ROD83 2 267696443
ROD84 2 294192228
ROD85 3 240341385
ROD86 2 368562428
ROD87 2 305746062
ROD88 2 295306346
ROD89 2 279190114
ROD9 1959 368016559
ROD90 1 126990816
ROD91 3 364697793
ROD92 3 342498328
ROD93 4 374582747
ROD94 3 249713888
ROD95 2 330770236
ROD96 2 292927924
ROD97 2 286762350
ROD98 3 381058419
ROD99 3 353678059
STS1 170406 86844690
STS10 202242 61367394
STS11 167005 59450485
STS2 143556 63323860
STS3 8293 4868512
STS4 108725 63673512
STS5 110380 70041358
STS6 106165 81422843
STS7 122522 86626105
STS8 198952 60928403
STS9 8742 2375975
SYN1 54444 100627167
SYN10 2 382762979
SYN11 2 332214168
SYN12 4 386933112
SYN13 1 271050050
SYN14 2 294093621
SYN15 3 329883353
SYN16 4 353920981
SYN17 2 328712085
SYN18 4 357672913
SYN19 1 207870274
SYN2 1 271050050
SYN20 2 382762979
SYN21 2 332214168
SYN22 8 392789107
SYN23 23453 269143334
SYN24 42978 156551247
SYN25 9183 352928592
SYN26 17230 334487459
SYN27 109307 160800424
SYN28 33188 99424047
SYN29 17103 267830661
SYN3 2 294093621
SYN4 3 329883353
SYN5 4 353920981
SYN6 1 64242768
SYN7 3 371658272
SYN8 2 250483958
SYN9 1 207870274
TSA1 233360 79647647
TSA10 168600 151858390
TSA100 63252 114802277
TSA101 79841 41351312
TSA102 82721 28609319
TSA103 67721 19747702
TSA104 84021 22863253
TSA105 84236 21912832
TSA106 84446 20981295
TSA107 134042 46621688
TSA108 155667 149676184
TSA109 183730 101083950
TSA11 157771 129836062
TSA110 47348 107503283
TSA111 136867 166252974
TSA112 166495 124901244
TSA113 97423 237859520
TSA114 99257 234633653
TSA115 12708 5978473
TSA116 134189 172362066
TSA117 127781 180160426
TSA118 129595 177105775
TSA119 121186 168272985
TSA12 97052 81339890
TSA120 161588 123667649
TSA121 122311 187541168
TSA122 147961 145186533
TSA123 94592 61300137
TSA124 136202 168455642
TSA125 159235 124954199
TSA126 156460 125810552
TSA127 123500 121448801
TSA13 143803 166125438
TSA14 181274 128537289
TSA15 66503 19953423
TSA16 206960 109167065
TSA17 187358 103732845
TSA18 49536 65564276
TSA19 154726 149575015
TSA2 222146 88664556
TSA20 216942 100225854
TSA21 205832 104153678
TSA22 22790 12573568
TSA23 157963 126705803
TSA24 173066 148399631
TSA25 214217 84399823
TSA26 107828 75817784
TSA27 170344 70732329
TSA28 221651 89477532
TSA29 29733 20452936
TSA3 74968 22652895
TSA30 203801 105213489
TSA31 180446 145745163
TSA32 69475 30793322
TSA33 188098 125939281
TSA34 147088 170906602
TSA35 162436 143012225
TSA36 150764 162208921
TSA37 167242 151938086
TSA38 140834 133825444
TSA39 169992 156589628
TSA4 197157 115804961
TSA40 69588 96746788
TSA41 171848 122209118
TSA42 189667 128235933
TSA43 179069 130028168
TSA44 75738 42986921
TSA45 179829 148956459
TSA46 157580 110411669
TSA47 134660 95403465
TSA48 183454 131877937
TSA49 208660 102956314
TSA5 214836 133894002
TSA50 80586 111968754
TSA51 191615 109275606
TSA52 179941 117349019
TSA53 113521 119199539
TSA54 155201 136003572
TSA55 161488 91817237
TSA56 130889 143855858
TSA57 137079 81286772
TSA58 155441 162401639
TSA59 162373 156460053
TSA6 19260 21470091
TSA60 193151 120607701
TSA61 58953 96808413
TSA62 173904 118336485
TSA63 151844 162145055
TSA64 61002 124261245
TSA65 201330 152320116
TSA66 185417 143496051
TSA67 162494 121036165
TSA68 181441 137352733
TSA69 171437 97550710
TSA7 193237 53106267
TSA70 41533 39009849
TSA71 119065 123313318
TSA72 131964 141438855
TSA73 151655 115933671
TSA74 830 251943
TSA75 153005 102368390
TSA76 156511 143520695
TSA77 40571 33632062
TSA78 176683 138455592
TSA79 161599 158562361
TSA8 156264 122193813
TSA80 11806 9816655
TSA81 185669 115791752
TSA82 143260 147547562
TSA83 177228 144669069
TSA84 158729 177360001
TSA85 18209 12701058
TSA86 168396 128972709
TSA87 156485 150537294
TSA88 194540 124973144
TSA89 32593 22930994
TSA9 101475 69223319
TSA90 195904 138162133
TSA91 113368 113467451
TSA92 98986 206634893
TSA93 87112 229168164
TSA94 77344 247719367
TSA95 30093 107285833
TSA96 141033 144555977
TSA97 106053 76615758
TSA98 74413 65471527
TSA99 33768 32853514
UNA1 721 4443317
VRL1 132220 138942607
VRL10 121297 144496302
VRL100 10093 221937647
VRL101 3341 88421598
VRL102 9619 221838656
VRL103 11743 219024610
VRL104 9349 221634835
VRL105 3848 110354811
VRL106 7748 222650337
VRL107 8980 222259271
VRL108 7817 221913531
VRL109 8236 197066713
VRL11 44156 308097688
VRL110 7554 222560070
VRL111 8016 221801264
VRL112 7876 221996862
VRL113 2167 64582248
VRL114 8472 221720974
VRL115 7717 221478850
VRL116 10085 221076679
VRL117 7756 222456833
VRL118 132 3933697
VRL119 7826 219691941
VRL12 115649 146226878
VRL120 7369 218156077
VRL121 8233 222140321
VRL122 3849 114215530
VRL123 7649 221412899
VRL124 7476 222844153
VRL125 8357 222927239
VRL126 7452 219902763
VRL127 129 3821849
VRL128 7999 218657622
VRL129 8956 221510937
VRL13 22922 79899896
VRL130 7517 220783295
VRL131 7369 218150393
VRL132 5477 160935769
VRL133 12365 369630589
VRL134 12390 370296038
VRL135 12393 370567303
VRL136 12384 370286134
VRL137 12382 370211898
VRL138 5593 167207813
VRL139 12391 370378994
VRL14 114077 144990939
VRL140 12393 370390238
VRL141 12395 370424114
VRL142 7993 238860319
VRL143 12409 370814633
VRL144 12404 370667524
VRL145 12392 370155663
VRL146 5866 174053507
VRL147 7445 221929148
VRL148 8145 222360939
VRL149 7443 221837084
VRL15 112598 147959323
VRL150 2892 82045763
VRL151 7950 223054990
VRL152 7477 222039859
VRL153 8030 221956941
VRL154 9149 220900797
VRL155 3868 114677846
VRL156 7582 220651948
VRL157 7408 219835795
VRL158 7413 219735995
VRL159 3616 104126478
VRL16 26345 44252819
VRL160 7439 219166564
VRL161 7913 222360053
VRL162 7714 219782996
VRL163 7646 223042279
VRL164 4241 118448783
VRL165 8018 221615160
VRL166 7453 221528200
VRL167 7363 218046174
VRL168 8084 221250684
VRL169 3625 101148164
VRL17 91104 158477341
VRL170 7443 221912979
VRL171 7417 220600930
VRL172 7578 220769209
VRL173 5232 150618093
VRL174 7602 221899029
VRL175 7485 221829812
VRL176 7584 219375098
VRL177 1975 58437483
VRL178 7592 221944172
VRL179 7833 222012765
VRL18 96736 150201600
VRL180 7434 221023560
VRL181 2324 67858397
VRL182 8083 222985990
VRL183 7948 222962068
VRL184 7846 223349036
VRL185 7603 217303616
VRL186 7364 218005430
VRL187 7534 222130547
VRL188 7635 223063835
VRL189 7923 222845819
VRL19 60927 99655600
VRL190 77 2293520
VRL191 7447 221890174
VRL192 7689 222248733
VRL193 7518 221517696
VRL194 2609 77814141
VRL195 7601 221963502
VRL196 7387 219036349
VRL197 7528 220390136
VRL198 7499 222873947
VRL199 4400 118487811
VRL2 126254 151657215
VRL20 92444 166074125
VRL200 7625 222730458
VRL201 7726 222100458
VRL202 8863 221969734
VRL203 7743 218403965
VRL204 4168 122872718
VRL205 8151 222354845
VRL206 7518 221700640
VRL207 7666 224353449
VRL208 9373 224054980
VRL209 4753 138068361
VRL21 91149 163977181
VRL210 7785 222148360
VRL211 8954 222777442
VRL212 7490 221781729
VRL213 7396 218647975
VRL214 4235 126107623
VRL215 7737 221999786
VRL216 8052 222077225
VRL217 8249 224279999
VRL218 7923 223366492
VRL219 4101 118233898
VRL22 53908 120837270
VRL220 7666 221964418
VRL221 7559 223171500
VRL222 7358 218069222
VRL223 8169 223294008
VRL224 4310 125471268
VRL225 7966 222582501
VRL226 9708 219827322
VRL227 8397 222335237
VRL228 7443 221612139
VRL229 4146 122816511
VRL23 83180 172820474
VRL230 7435 220642111
VRL231 7597 222505266
VRL232 7845 222619098
VRL233 7441 221791712
VRL234 4316 120894038
VRL235 7932 222425846
VRL236 7718 221931980
VRL237 7731 222123115
VRL238 7395 219808636
VRL239 3494 103729716
VRL24 85985 167243426
VRL240 7439 221699608
VRL241 7544 222240486
VRL242 8159 222758102
VRL243 7676 222824007
VRL244 3907 116227221
VRL245 7581 222978926
VRL246 8794 222798463
VRL247 7417 219949713
VRL248 7431 221481143
VRL249 3894 116079121
VRL25 69446 119010763
VRL250 7432 221243364
VRL251 8384 222475899
VRL252 7640 221435331
VRL253 7567 222142752
VRL254 3979 116112401
VRL255 7988 220968167
VRL256 7393 219493693
VRL257 7791 221552436
VRL258 2024 60331983
VRL259 8938 220740716
VRL26 82998 167654810
VRL260 8247 222009452
VRL261 8805 222101557
VRL262 2137 63662028
VRL263 7471 222005652
VRL264 7470 222505538
VRL265 7409 220254852
VRL266 7640 221785085
VRL267 8070 222113696
VRL268 7596 223079857
VRL269 3610 107590278
VRL27 83295 167376071
VRL270 7474 222126840
VRL271 8026 221189822
VRL272 7624 222631107
VRL273 7815 222522651
VRL274 3746 111687343
VRL275 7531 221663277
VRL276 7752 221074094
VRL277 7745 222361675
VRL278 7509 222062997
VRL279 4682 115666112
VRL28 50273 112027640
VRL280 7518 220500802
VRL281 7493 222053552
VRL282 7603 222403175
VRL283 7474 221570879
VRL284 6198 183742114
VRL285 7459 222186884
VRL286 7454 222179797
VRL287 7498 222263197
VRL288 2458 73277761
VRL289 7526 222474058
VRL29 90696 179096239
VRL290 7674 222580820
VRL291 7526 223010632
VRL292 3371 100488333
VRL293 7548 218995367
VRL294 7649 221863710
VRL295 7454 221665646
VRL296 4633 136865842
VRL297 7462 230886752
VRL298 7688 220545205
VRL299 7745 223081156
VRL3 92765 169044088
VRL30 37888 299309348
VRL300 4016 118824799
VRL301 7979 221788244
VRL302 7389 220133549
VRL303 7534 221755402
VRL304 5528 164635077
VRL305 7510 222088821
VRL306 8209 223162165
VRL307 7448 220454041
VRL308 5798 171149372
VRL309 7521 222642364
VRL31 76211 187742452
VRL310 7609 223431065
VRL311 7540 223134905
VRL312 7422 220611733
VRL313 332 9891018
VRL314 7872 220533989
VRL315 7522 220538701
VRL316 7500 222940418
VRL317 4215 119367209
VRL318 13132 228660828
VRL319 7423 219289137
VRL32 53971 129472950
VRL320 8327 221764975
VRL321 3723 110777080
VRL322 7782 222670832
VRL323 7594 221426324
VRL324 7523 220982268
VRL325 2483 72576206
VRL326 7741 221818081
VRL327 8149 221825133
VRL328 8619 221310657
VRL329 8719 220290670
VRL33 67844 182331234
VRL330 1014 30206686
VRL331 7860 220901574
VRL332 7442 219982061
VRL333 7423 220593491
VRL334 7227 202487600
VRL335 20456 210781305
VRL336 7447 221168592
VRL337 8448 219382142
VRL338 7676 220313918
VRL339 11 328002
VRL34 77927 185691111
VRL340 7347 218645849
VRL341 7524 222180732
VRL342 7539 221311279
VRL343 10899 221445095
VRL344 2184 65022707
VRL345 9192 221037659
VRL346 7836 222386717
VRL347 7407 219675619
VRL348 3060 82408333
VRL349 7493 220923034
VRL35 66331 158180502
VRL350 7637 220093037
VRL351 7591 220809238
VRL352 6782 198918882
VRL353 7585 221945118
VRL354 7537 221788976
VRL355 7390 218837856
VRL356 3401 97967467
VRL357 7604 222600111
VRL358 7683 221803042
VRL359 7407 220551409
VRL36 74911 192649566
VRL360 5471 159299490
VRL361 7832 221810213
VRL362 7522 221264717
VRL363 7427 220112031
VRL364 8197 219788998
VRL365 2270 67615195
VRL366 8936 218207106
VRL367 7982 220995657
VRL368 7467 221452508
VRL369 7362 218478133
VRL37 84339 170456076
VRL370 7739 220877455
VRL371 7490 220079930
VRL372 7876 221355922
VRL373 7541 219806071
VRL374 9916 218991415
VRL375 7852 222381472
VRL376 7475 221622413
VRL377 4916 123094845
VRL378 7661 219979119
VRL379 7559 222341774
VRL38 72050 146465209
VRL380 8046 221739115
VRL381 4514 115082366
VRL382 7603 221875510
VRL383 7858 220986159
VRL384 8062 221761610
VRL385 3490 102554873
VRL386 8056 221359435
VRL387 9365 220218080
VRL388 8354 220188921
VRL389 4524 132666807
VRL39 78685 176992528
VRL390 7626 224042098
VRL391 8808 223392172
VRL392 7933 223131131
VRL393 3638 97868277
VRL394 8980 220617619
VRL395 7623 222967686
VRL396 7758 222753061
VRL397 2655 71654537
VRL398 8449 221923729
VRL399 7527 223098716
VRL4 14208 132999309
VRL40 69896 180529887
VRL400 7987 223191416
VRL401 3472 102542136
VRL402 8714 221820046
VRL403 7622 222782532
VRL404 8315 222437007
VRL405 6913 202267977
VRL406 8241 223517280
VRL407 7721 223282215
VRL408 7678 222016793
VRL409 6626 183260050
VRL41 44834 196984433
VRL410 7883 222794815
VRL411 7890 222582848
VRL412 7548 223789235
VRL413 2821 83790415
VRL414 7581 223758476
VRL415 8888 219786161
VRL416 7714 222321309
VRL417 3894 106891028
VRL418 7820 220874462
VRL419 7900 223610178
VRL42 19777 136448469
VRL420 7591 221415694
VRL421 3249 92846200
VRL422 11843 217801103
VRL423 7483 221393612
VRL424 7730 220945350
VRL425 6640 176303000
VRL426 8703 222365556
VRL427 7565 224080185
VRL428 7735 221351076
VRL429 4699 131669956
VRL43 25037 218111286
VRL430 7814 220195850
VRL431 7527 222697222
VRL432 7391 218988987
VRL433 5815 166901939
VRL434 9781 220127609
VRL435 7598 222646147
VRL436 8926 218654061
VRL437 7784 220851681
VRL438 1779 51020043
VRL439 8169 222410434
VRL44 15225 218660527
VRL440 8058 223228283
VRL441 7673 224515499
VRL442 2990 88395043
VRL443 8374 221555248
VRL444 7532 220414208
VRL445 7636 222890713
VRL446 7842 222723982
VRL447 9331 224109663
VRL448 5870 173961062
VRL449 10218 222067301
VRL45 33981 207634421
VRL450 7534 223037451
VRL451 7465 222420117
VRL452 4518 122673567
VRL453 7881 221092651
VRL454 7602 220398278
VRL455 7840 221480916
VRL456 2349 69816569
VRL457 7722 225381463
VRL458 10136 217752298
VRL459 7510 222026657
VRL46 10943 128336834
VRL460 6103 168278731
VRL461 9486 225265510
VRL462 7800 220165795
VRL463 8440 222875520
VRL464 9645 224407807
VRL465 4309 120023487
VRL466 7887 224870673
VRL467 7766 220489689
VRL468 10739 220397584
VRL469 4077 120979953
VRL47 18960 217938241
VRL470 8255 225203748
VRL471 7539 220851975
VRL472 7729 224131159
VRL473 5220 147751440
VRL474 8024 220877664
VRL475 9198 221604763
VRL476 9050 219440310
VRL477 4553 123633519
VRL478 9770 220624442
VRL479 8031 222114360
VRL48 25444 214843419
VRL480 8691 219426551
VRL481 6300 125276792
VRL482 11911 216910988
VRL483 7438 220046677
VRL484 7845 222774224
VRL485 7314 201045951
VRL486 7887 221051248
VRL487 8022 221416916
VRL488 7743 221315242
VRL489 8393 203554391
VRL49 16786 218105457
VRL490 10070 222475384
VRL491 7678 221134706
VRL492 7591 222095574
VRL493 7624 222752365
VRL494 7750 223105991
VRL495 7487 220456705
VRL496 3458 101796309
VRL497 11946 219277357
VRL498 9759 222162421
VRL499 8188 223620631
VRL5 94614 149040310
VRL50 10556 159080104
VRL500 7570 220951324
VRL501 4643 105802370
VRL502 7518 223526831
VRL503 8187 222592691
VRL504 8097 220493329
VRL505 4092 121761190
VRL506 8034 220927179
VRL507 6724 227891498
VRL508 8175 221412959
VRL509 2441 82889795
VRL51 13552 220679461
VRL510 7762 223660954
VRL511 7588 221589168
VRL512 8109 222987320
VRL513 3410 96559558
VRL514 10058 219415398
VRL515 6622 228202211
VRL516 8174 220227138
VRL517 2581 105575632
VRL518 7716 222896043
VRL519 7606 223292105
VRL52 10271 219495221
VRL520 7805 224740336
VRL521 8063 223463850
VRL522 4744 146140955
VRL523 7564 223408554
VRL524 9931 220755666
VRL525 11076 215044139
VRL526 12215 220723317
VRL527 5733 144390653
VRL528 8890 222543042
VRL529 7568 222167745
VRL53 10146 221288776
VRL530 8270 224907477
VRL531 9630 220908145
VRL532 6283 183251963
VRL533 8175 220858826
VRL534 8287 223440432
VRL535 14458 216046372
VRL536 4774 127837161
VRL537 8287 219721996
VRL538 6904 228611673
VRL539 8541 221040952
VRL54 5686 125128405
VRL540 5155 145156658
VRL541 7813 223801198
VRL542 10884 218103966
VRL543 8261 221490968
VRL544 8476 221296983
VRL545 1596 44818793
VRL546 8278 221226374
VRL547 9204 220067803
VRL548 7513 219984353
VRL549 3230 96224034
VRL55 8930 223413346
VRL550 7657 222829735
VRL551 7414 222643053
VRL552 7858 221595645
VRL553 4207 126328697
VRL554 7438 222689622
VRL555 10370 219033193
VRL556 9497 219170579
VRL557 2890 83702707
VRL558 11413 218810611
VRL559 11302 217293941
VRL56 9719 220778394
VRL560 12420 217612892
VRL561 2988 80717787
VRL562 7750 222241565
VRL563 8013 222491958
VRL564 7956 222554083
VRL565 2522 73117425
VRL566 10663 218813050
VRL567 8044 222288518
VRL568 7597 223045050
VRL569 2756 85123911
VRL57 8673 222231097
VRL570 7213 224250730
VRL571 7712 221515955
VRL572 10749 225550024
VRL573 1769 136712279
VRL574 7406 226157672
VRL575 7989 224112576
VRL576 6982 224936021
VRL577 4906 107958573
VRL578 7580 222038819
VRL579 7704 221581098
VRL58 10135 221599986
VRL580 7617 222637021
VRL581 2632 78023324
VRL582 17126 211741141
VRL583 7981 222947531
VRL584 9171 219993547
VRL585 8200 222906532
VRL586 8389 225217128
VRL587 7337 223399049
VRL588 4811 142840069
VRL589 12227 365288412
VRL59 3705 85728544
VRL590 12346 368941421
VRL591 6276 187460268
VRL592 1904 56895892
VRL593 12412 370879597
VRL594 12615 376530246
VRL595 12642 377214922
VRL596 6339 188939939
VRL597 12640 377031424
VRL598 12732 379414321
VRL599 12742 379705519
VRL6 87218 144399085
VRL60 10333 221277877
VRL600 7006 208976171
VRL601 12705 378687920
VRL602 12643 377173501
VRL603 12483 372706413
VRL604 4321 128968167
VRL605 12508 373197120
VRL606 12547 374422871
VRL607 12589 375497679
VRL608 3607 107762643
VRL609 12492 372907154
VRL61 13671 217820297
VRL610 12432 371444506
VRL611 12406 370719829
VRL612 6392 190947199
VRL613 12420 370922953
VRL614 12405 370740452
VRL615 12392 370374890
VRL616 3443 102906971
VRL617 12465 372209245
VRL618 12442 371607689
VRL619 12298 368780193
VRL62 8780 220929137
VRL620 2807 83891939
VRL621 3626 108345075
VRL622 12555 374690328
VRL623 12414 370927719
VRL624 12155 362514401
VRL625 3015 90112165
VRL626 12422 371167299
VRL627 12261 366451044
VRL628 12386 370106341
VRL629 11574 345921941
VRL63 11234 219334810
VRL630 12375 369587244
VRL631 12426 370070368
VRL632 12382 370091236
VRL633 3497 104528184
VRL634 12290 367379494
VRL635 12510 373034066
VRL636 12366 369235414
VRL637 8841 264243322
VRL638 12371 369579323
VRL639 12404 370568362
VRL64 2759 77746098
VRL640 12559 374844556
VRL641 12370 369706834
VRL642 6824 203639512
VRL643 12355 369205246
VRL644 12438 371525543
VRL645 12371 369747771
VRL646 12440 371544438
VRL647 1317 39327951
VRL648 12301 367635353
VRL649 12375 369821506
VRL65 7489 220957135
VRL650 12374 369794532
VRL651 9924 296600459
VRL652 12407 370784512
VRL653 12355 369256721
VRL654 12356 369269010
VRL655 8777 262289396
VRL656 12392 370309151
VRL657 12364 369530954
VRL658 12373 369795214
VRL659 6051 180847472
VRL66 8122 222117256
VRL660 12089 361310448
VRL661 11884 355177935
VRL662 12279 366995197
VRL663 7714 230555608
VRL664 12411 370765195
VRL665 12372 369759346
VRL666 12259 366137176
VRL667 7053 210795209
VRL668 12357 369313224
VRL669 12289 366969216
VRL67 9183 219391471
VRL670 12387 370184030
VRL671 7087 211408702
VRL672 12642 376819849
VRL673 12413 370848739
VRL674 12505 373281116
VRL675 7137 213189899
VRL676 12399 370471140
VRL677 12266 366416657
VRL678 12477 372419198
VRL679 7077 211504842
VRL68 18462 212966063
VRL680 12361 369377557
VRL681 12364 369524646
VRL682 12442 370747926
VRL683 6845 204575443
VRL684 12316 368095955
VRL685 12268 366636528
VRL686 12464 372783346
VRL687 12559 374551450
VRL688 3319 99197079
VRL689 12386 370181961
VRL69 2407 67358814
VRL690 12401 370610186
VRL691 12379 369973424
VRL692 12384 370093198
VRL693 1867 55773009
VRL694 12301 367383904
VRL695 12550 374275338
VRL696 12552 374427410
VRL697 12537 374049537
VRL698 2388 71233053
VRL699 12532 373945181
VRL7 93295 144789548
VRL70 7833 220551702
VRL700 12438 371547176
VRL701 12432 371343710
VRL702 2869 85746481
VRL703 12435 371487075
VRL704 12258 366176505
VRL705 12302 367406403
VRL706 3135 93622090
VRL707 12410 370655184
VRL708 12484 372501187
VRL709 12479 372365553
VRL71 7784 220899018
VRL710 3147 93972973
VRL711 12505 373118483
VRL712 12409 370500148
VRL713 12442 371477108
VRL714 12437 371357638
VRL715 3781 112755704
VRL716 12405 370311975
VRL717 12360 369281299
VRL718 12384 369854049
VRL719 6359 189961430
VRL72 8152 220594548
VRL720 12395 370229634
VRL721 12365 369305805
VRL722 12383 369899001
VRL723 12444 371429644
VRL724 7791 232502932
VRL725 12428 370979309
VRL726 12384 369891372
VRL727 12285 367053622
VRL728 9766 291789623
VRL729 12308 367710741
VRL73 6564 181778065
VRL730 12334 368397736
VRL731 12285 367031666
VRL732 12330 368243385
VRL733 12357 368937027
VRL734 12387 369756709
VRL735 3050 90995278
VRL736 12442 371007882
VRL737 12491 372604647
VRL738 12391 369892899
VRL739 12408 370401443
VRL74 7901 221549511
VRL740 12344 368740280
VRL741 11673 348701602
VRL742 12350 368927677
VRL743 12344 368707921
VRL744 12333 368409714
VRL745 12357 369116539
VRL746 9588 286407295
VRL747 12365 369336304
VRL748 12388 370054264
VRL749 12351 368933176
VRL75 8381 220327625
VRL750 12427 371266861
VRL751 1933 57749601
VRL752 12507 371999097
VRL753 12608 376763669
VRL754 12363 369283713
VRL755 12386 369981680
VRL756 12423 371107319
VRL757 8027 239817106
VRL758 12517 373993532
VRL759 12452 371997010
VRL76 8592 219122184
VRL760 12367 369381332
VRL761 12365 369309011
VRL762 9008 269045593
VRL763 12357 369035921
VRL764 12360 369145522
VRL765 12380 369724084
VRL766 12385 369871384
VRL767 511 15259797
VRL768 12402 370323978
VRL769 12394 370098595
VRL77 6066 159811921
VRL770 12400 370271347
VRL771 12389 369959481
VRL772 477 14245091
VRL773 12389 369931542
VRL774 12339 368481167
VRL775 11996 358391372
VRL776 12212 364776539
VRL777 1075 32100221
VRL778 12430 370989262
VRL779 12374 369441369
VRL78 12602 218833993
VRL780 12388 369857564
VRL781 12389 369851260
VRL782 189 5642761
VRL783 12388 369823940
VRL784 12387 369786148
VRL785 12379 369541045
VRL786 5944 177430808
VRL787 12394 369997892
VRL788 12387 369750475
VRL789 12420 370832409
VRL79 8508 219374941
VRL790 12431 371166287
VRL791 1209 36089414
VRL792 12387 369753999
VRL793 12388 369776843
VRL794 12483 372119079
VRL795 12629 376026179
VRL796 1428 42558388
VRL797 12524 373531063
VRL798 12566 375479102
VRL799 12465 372226910
VRL8 130384 141203908
VRL80 8498 221580835
VRL800 4701 140399172
VRL801 12443 371533319
VRL802 12504 373504973
VRL803 12511 373698901
VRL804 4630 138326641
VRL805 12347 368630587
VRL806 12378 369590507
VRL807 12459 372113703
VRL808 4823 144147287
VRL809 12478 372588042
VRL81 5190 144508847
VRL810 12091 360881248
VRL811 11960 356922165
VRL812 5291 157900502
VRL813 12329 368021537
VRL814 12126 361953336
VRL815 11936 355894357
VRL816 5460 162048613
VRL817 12559 372526740
VRL818 12612 376060865
VRL819 12579 375177317
VRL82 7494 220776619
VRL820 4819 143097402
VRL821 12661 377367760
VRL822 12677 377211160
VRL823 12575 375048112
VRL824 4878 145579361
VRL825 12563 374659621
VRL826 12676 376897762
VRL827 12667 377071326
VRL828 12671 376634034
VRL829 12610 375761388
VRL83 7764 222319378
VRL830 5179 154268247
VRL831 12575 374391466
VRL832 12656 376712451
VRL833 12693 377049011
VRL834 9331 278108905
VRL835 12611 375700195
VRL836 12648 377038761
VRL837 12637 376569502
VRL838 2912 86671014
VRL839 12688 377654081
VRL84 7733 222815648
VRL840 12480 372030712
VRL841 12388 369647071
VRL842 7658 228216518
VRL843 12711 377697134
VRL844 12717 378060655
VRL845 12584 375667745
VRL846 12440 371227884
VRL847 12579 375195181
VRL848 12580 376026955
VRL849 1859 55544587
VRL85 779 19259541
VRL850 12584 375895188
VRL851 12515 373750517
VRL852 12550 377126918
VRL853 7128 212910721
VRL854 12229 365150996
VRL855 11891 354918332
VRL856 12450 367319094
VRL857 12487 372862569
VRL858 4721 140719922
VRL859 12596 376135993
VRL86 8454 222035740
VRL860 12569 375433420
VRL861 12546 374726965
VRL862 12474 372449000
VRL863 3644 108873254
VRL864 12558 375168086
VRL865 12543 374623190
VRL866 12574 375649348
VRL867 12572 375543219
VRL868 12474 372478646
VRL869 12393 370118166
VRL87 7792 222046252
VRL870 12354 369073317
VRL871 12443 371478523
VRL872 10488 313166766
VRL873 12480 373707764
VRL874 12439 371958977
VRL875 12449 371971369
VRL876 4924 147047808
VRL877 12208 370121709
VRL878 12337 368189597
VRL879 12194 365753201
VRL88 7421 220936425
VRL880 3989 113145540
VRL881 12724 368112185
VRL882 12554 368470863
VRL883 12734 364609395
VRL884 12553 363130052
VRL885 12643 368480290
VRL886 34239 164475837
VRL89 3087 81676429
VRL9 70179 88422464
VRL90 7994 222011807
VRL91 9317 221734392
VRL92 7851 220714154
VRL93 3506 84827707
VRL94 9350 218994649
VRL95 8387 221840470
VRL96 8457 223059939
VRL97 4266 101087748
VRL98 9828 222606680
VRL99 9776 223137505
VRT1 70113 272305903
VRT10 37396 74041240
VRT100 1 839681426
VRT101 1 825560060
VRT102 1 595904407
VRT103 1 486875112
VRT104 1 387033265
VRT105 1 371528181
VRT106 1 313513962
VRT107 1 277530821
VRT108 1 268302114
VRT109 3 319484498
VRT11 18698 27611025
VRT110 5 386368861
VRT111 7 393936069
VRT112 7 384166854
VRT113 1 46063367
VRT114 7 344525641
VRT115 6 384186008
VRT116 8 388949147
VRT117 332 334400544
VRT118 1 222115097
VRT119 3 377547369
VRT12 5986 380511905
VRT120 10 383496928
VRT121 33 389650655
VRT122 6 59236435
VRT123 1 772932187
VRT124 1 662004353
VRT125 1 535506559
VRT126 1 376147139
VRT127 1 364230008
VRT128 1 346409914
VRT129 1 311292523
VRT13 3363 217068541
VRT130 1 247732340
VRT131 1 228143320
VRT132 1 221182781
VRT133 2 321892640
VRT134 490 332426844
VRT135 12 378048109
VRT136 9 378909870
VRT137 6 345737823
VRT138 2 137693511
VRT139 7 385107928
VRT14 4685 4674270
VRT140 8 360581972
VRT141 10 364952837
VRT142 4 133261911
VRT143 8 359905961
VRT144 5 370674748
VRT145 9 378247816
VRT146 6 166907986
VRT147 14 379842153
VRT148 15 375595384
VRT149 41 289507176
VRT15 1171 26255719
VRT150 11 366984719
VRT151 14 374291772
VRT152 10 185283047
VRT153 1 550518975
VRT154 1 529596002
VRT155 1 413748038
VRT156 1 326378286
VRT157 1 272612222
VRT158 1 260396842
VRT159 1 197956435
VRT16 293 13983146
VRT160 2 384149701
VRT161 2 288058306
VRT162 4 353983664
VRT163 461 371881983
VRT164 2 310725315
VRT165 2 280326572
VRT166 3 371471404
VRT167 3 354148189
VRT168 3 303679844
VRT169 4 341249946
VRT17 37 392789976
VRT170 382 371460784
VRT171 13 392880011
VRT172 13 164097178
VRT173 1 313568160
VRT174 1 289498315
VRT175 1 277254249
VRT176 1 244324502
VRT177 1 233859027
VRT178 1 225974235
VRT179 1 211674833
VRT18 13 392458500
VRT180 1 199962141
VRT181 2 390673241
VRT182 2 334991523
VRT183 2 324316137
VRT184 2 292002398
VRT185 1 133841611
VRT186 3 336899598
VRT187 28 389500106
VRT188 6 332993899
VRT189 6 378599539
VRT19 12 379958897
VRT190 1 47256133
VRT191 6 330076811
VRT192 7 362796652
VRT193 8 365387335
VRT194 20 273534543
VRT195 9 378632578
VRT196 11 392575991
VRT197 205 341394663
VRT198 7 347210350
VRT199 7 370650631
VRT2 72833 271627248
VRT20 11 316368323
VRT200 8 391548385
VRT201 6 385659507
VRT202 7 341110862
VRT203 1 55350661
VRT204 8 387616857
VRT205 3 259325358
VRT206 5 392602723
VRT207 41 394037361
VRT208 3 148003845
VRT209 7 387415360
VRT21 13 385338369
VRT210 7 365756282
VRT211 6 352657526
VRT212 5 346047628
VRT213 2 134650353
VRT214 5 356250620
VRT215 6 374573269
VRT216 6 364137996
VRT217 7 343458516
VRT218 2 121348818
VRT219 7 358240592
VRT22 14 372163844
VRT220 8 383435354
VRT221 8 365970383
VRT222 6 357597984
VRT223 7 355728138
VRT224 8 362648569
VRT225 7 390172982
VRT226 8 391413434
VRT227 8 377681388
VRT228 1 42933508
VRT229 100 376541917
VRT23 14 352781625
VRT230 20 391000381
VRT231 13 383659375
VRT232 58 386123281
VRT233 11 394338841
VRT234 11 274288418
VRT235 1 843366180
VRT236 1 842558404
VRT237 1 707956555
VRT238 1 635713434
VRT239 1 567300182
VRT24 19 384683297
VRT240 1 439630435
VRT241 1 236595445
VRT242 1 231667822
VRT243 2 382351630
VRT244 2 103223822
VRT245 1 690654357
VRT246 1 541439571
VRT247 1 495417988
VRT248 1 481763206
VRT249 1 429350720
VRT25 16 379729070
VRT250 1 224823088
VRT251 1 212589178
VRT252 2 374746477
VRT253 2 318111367
VRT254 32 270969991
VRT255 2 352563619
VRT256 7 386835620
VRT257 4317 352826229
VRT258 19 370712563
VRT259 15986 152828107
VRT26 16 381718727
VRT260 139086 132687892
VRT261 144373 126125546
VRT262 137636 133391625
VRT263 3688 4822512
VRT264 131663 139566747
VRT265 129365 143274251
VRT266 68932 112543394
VRT267 3 351846198
VRT268 5 374381301
VRT269 16 387558511
VRT27 2 51507477
VRT270 48 262478695
VRT271 14 376657571
VRT272 16 394062851
VRT273 16 377073984
VRT274 8 278699154
VRT275 13 345916081
VRT276 3 386677656
VRT277 5 363840571
VRT278 25 336198071
VRT279 10 365551181
VRT28 6 344600068
VRT280 392 383359217
VRT281 3 345650541
VRT282 4 347682430
VRT283 8 375481157
VRT284 12 376742698
VRT285 33 366827136
VRT286 11 349043615
VRT287 35 386781479
VRT288 3 345588977
VRT289 4 349532575
VRT29 7 384846875
VRT290 6 304738240
VRT291 7 374752607
VRT292 9 383055365
VRT293 13 380263163
VRT294 17 345430885
VRT295 9 382470915
VRT296 10 392600820
VRT297 9 279911807
VRT298 9 254611438
VRT299 100 239145530
VRT3 9032 335126292
VRT30 7 359521465
VRT300 14 353408674
VRT301 9 362327333
VRT302 12 386562662
VRT303 37 393359699
VRT304 1 197209046
VRT305 4 354626559
VRT306 14 388834320
VRT307 19 380393320
VRT308 6 393746332
VRT309 3 88205163
VRT31 6 265537261
VRT310 141 344731629
VRT311 5 347463485
VRT312 7 380950384
VRT313 7 382163289
VRT314 1 41123832
VRT315 1534 370418439
VRT316 13 372631033
VRT317 17 382625440
VRT318 14 376221586
VRT319 15 384701428
VRT32 2 352172328
VRT320 24 309028163
VRT321 1 359753992
VRT322 1 294454259
VRT323 2 339959923
VRT324 4 389503140
VRT325 17 386338679
VRT326 15 391956294
VRT327 9 391549346
VRT328 8 381532502
VRT329 10 359729387
VRT33 7 389373598
VRT330 16 366027269
VRT331 14 376088571
VRT332 7 235869622
VRT333 61 293806910
VRT334 25 392090725
VRT335 2 90346900
VRT336 10 381757438
VRT337 13 384001666
VRT338 18 378998104
VRT339 14 354514736
VRT34 59 363015420
VRT340 15 389607510
VRT341 7 359846472
VRT342 10 392276936
VRT343 11 351492602
VRT344 12 385397876
VRT345 11 360161366
VRT346 6 387856588
VRT347 6 342298758
VRT348 7 364180089
VRT349 6 278597912
VRT35 147 10842596
VRT350 4 383566318
VRT351 4 341682881
VRT352 5 369366758
VRT353 1 168556870
VRT354 4 366711607
VRT355 12 382161691
VRT356 28 370268341
VRT357 12961 360884198
VRT36 586 15797052
VRT37 2343 67436863
VRT38 19198 357652178
VRT39 54123 304773887
VRT4 3 141387178
VRT40 158603 137245213
VRT41 18234 13422472
VRT42 117659 200729232
VRT43 84329 68323463
VRT44 156212 129530496
VRT45 40532 26950319
VRT46 185410 123432350
VRT47 149925 106560414
VRT48 168325 113432690
VRT49 8466 7259693
VRT5 8 354279535
VRT50 133023 105741590
VRT51 156325 117905073
VRT52 142330 87480876
VRT53 188487 120064093
VRT54 103270 61401582
VRT55 157454 119334885
VRT56 160425 124637286
VRT57 4584 370883383
VRT58 326 389273252
VRT59 1595 387372006
VRT6 11 387350249
VRT60 93755 270827182
VRT61 145106 21008965
VRT62 75789 25336814
VRT63 13375 365641119
VRT64 20 379347618
VRT65 269 392772876
VRT66 3056 391160250
VRT67 3483 231235844
VRT68 6925 378855996
VRT69 16 388667304
VRT7 11 393947221
VRT70 16 378559418
VRT71 12 379509384
VRT72 7 285874095
VRT73 12 385137967
VRT74 18 367776429
VRT75 16 386329687
VRT76 229 277860126
VRT77 17 367327734
VRT78 15 385834222
VRT79 7 149460915
VRT8 30744 333424138
VRT80 1 356776219
VRT81 1 350268637
VRT82 1 316334699
VRT83 1 337490635
VRT84 1 252032905
VRT85 1 217689105
VRT86 1 199443007
VRT87 1 198537509
VRT88 2 368166310
VRT89 2 330550494
VRT9 74952 70630383
VRT90 1 146904662
VRT91 3 319096504
VRT92 7 379783228
VRT93 11 374771935
VRT94 13 379441801
VRT95 3 70710155
VRT96 16 344076996
VRT97 10 385210617
VRT98 15 392781064
VRT99 22 370094349
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 255.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:
Entries Bases Species
1943413 229691484246 Triticum aestivum
6863868 204171782411 Severe acute respiratory syndrome coronavirus 2
1347472 105141378851 Hordeum vulgare subsp. vulgare
10040502 43630433741 Mus musculus
27702323 28029146433 Homo sapiens
29695 21127951335 Avena sativa
164336 18022798309 Escherichia coli
2242661 13394347983 Bos taurus
2640145 13130307722 Arabidopsis thaliana
29145 13017315115 Klebsiella pneumoniae
1731898 12313005750 Danio rerio
188 11554707082 Sambucus nigra
23111 9981539743 Triticum turgidum subsp. durum
4220072 7414503624 Zea mays
42 7085853300 Meconema thalassinum
125 6924307246 Avena insularis
21582 6750832728 Secale cereale
2203214 6551043724 Rattus norvegicus
271 6294548360 Aegilops sharonensis
457 5920483689 Aegilops longissima
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting. Also note that this table is limited
to 'traditional', non-set-based (WGS/TSA/TLS) GenBank records.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
187 Dec 2011 135117731375 146413798
188 Feb 2012 137384889783 149819246
189 Apr 2012 139266481398 151824421
190 Jun 2012 141343240755 154130210
191 Aug 2012 143081765233 156424033
192 Oct 2012 145430961262 157889737
193 Dec 2012 148390863904 161140325
194 Feb 2013 150141354858 162886727
195 Apr 2013 151178979155 164136731
196 Jun 2013 152599230112 165740164
197 Aug 2013 154192921011 167295840
198 Oct 2013 155176494699 168335396
199 Dec 2013 156230531562 169331407
200 Feb 2014 157943793171 171123749
201 Apr 2014 159813411760 171744486
202 Jun 2014 161822845643 173353076
203 Aug 2014 165722980375 174108750
204 Oct 2014 181563676918 178322253
205 Dec 2014 184938063614 179295769
206 Feb 2015 187893826750 181336445
207 Apr 2015 189739230107 182188746
208 Jun 2015 193921042946 185019352
209 Aug 2015 199823644287 187066846
210 Oct 2015 202237081559 188372017
211 Dec 2015 203939111071 189232925
212 Feb 2016 207018196067 190250235
213 Apr 2016 211423912047 193739511
214 Jun 2016 213200907819 194463572
215 Aug 2016 217971437647 196120831
216 Oct 2016 220731315250 197390691
217 Dec 2016 224973060433 198565475
218 Feb 2017 228719437638 199341377
219 Apr 2017 231824951552 200877884
220 Jun 2017 234997362623 201663568
221 Aug 2017 240343378258 203180606
222 Oct 2017 244914705468 203953682
223 Dec 2017 249722163594 206293625
224 Feb 2018 253630708098 207040555
225 Apr 2018 260189141631 208452303
226 Jun 2018 263957884539 209775348
227 Aug 2018 260806936411 208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
228 Oct 2018 279668290132 209656636
229 Dec 2018 285688542186 211281415
230 Feb 2019 303709510632 212260377
231 Apr 2019 321680566570 212775414
232 Jun 2019 329835282370 213383758
233 Aug 2019 366733917629 213865349
234 Oct 2019 386197018538 216763706
235 Dec 2019 388417258009 215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
236 Feb 2020 399376854872 216214215
237 Apr 2020 415770027949 216531829
238 Jun 2020 427823258901 217122233
239 Aug 2020 654057069549 218642238
240 Oct 2020 698688094046 219055207
241 Dec 2020 723003822007 221467827
242 Feb 2021 776291211106 226241476
243 Apr 2021 832400799511 227123201
244 Jun 2021 866009790959 227888889
245 Aug 2021 940513260726 231982592
246 Oct 2021 1014763752113 233642893
247 Dec 2021 1053275115030 234557297
248 Feb 2022 1173984081721 236338284
249 Apr 2022 1266154890918 237520318
250 Jun 2022 1395628631187 239017893
251 Aug 2022 1492800704497 239915786
252 Oct 2022 1562963366851 240539282
253 Dec 2022 1635594138493 241015745
254 Feb 2023 1731302248418 241830635
255 Apr 2023 1826746318813 242554936
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
187 Dec 2011 239868309609 73729553
188 Feb 2012 261370512675 78656704
189 Apr 2012 272693351548 80905298
190 Jun 2012 287577367116 82076779
191 Aug 2012 308196411905 84020064
192 Oct 2012 333881846451 86480509
193 Dec 2012 356002922838 92767765
194 Feb 2013 390900990416 103101291
195 Apr 2013 418026593606 110509314
196 Jun 2013 453829752320 112488036
197 Aug 2013 500420412665 124812020
198 Oct 2013 535842167741 130203205
199 Dec 2013 556764321498 133818570
200 Feb 2014 591378698544 139725795
201 Apr 2014 621015432437 143446790
202 Jun 2014 719581958743 175779064
203 Aug 2014 774052098731 189080419
204 Oct 2014 805549167708 196049974
205 Dec 2014 848977922022 200301550
206 Feb 2015 873281414087 205465046
207 Apr 2015 969102906813 243779199
208 Jun 2015 1038937210221 258702138
209 Aug 2015 1163275601001 302955543
210 Oct 2015 1222635267498 309198943
211 Dec 2015 1297865618365 317122157
212 Feb 2016 1399865495608 333012760
213 Apr 2016 1452207704949 338922537
214 Jun 2016 1556175944648 350278081
215 Aug 2016 1637224970324 359796497
216 Oct 2016 1676238489250 363213315
217 Dec 2016 1817189565845 395301176
218 Feb 2017 1892966308635 409490397
219 Apr 2017 2035032639807 451840147
220 Jun 2017 2164683993369 487891767
221 Aug 2017 2242294609510 499965722
222 Oct 2017 2318156361999 508825331
223 Dec 2017 2466098053327 551063065
224 Feb 2018 2608532210351 564286852
225 Apr 2018 2784740996536 621379029
226 Jun 2018 2944617324086 639804105
227 Aug 2018 3204855013281 665309765
228 Oct 2018 3444172142207 722438528
229 Dec 2018 3656719423096 773773190
230 Feb 2019 4164513961679 945019312
231 Apr 2019 4421986382065 993732214
232 Jun 2019 4847677297950 1022913321
233 Aug 2019 5585922333160 1075272215
234 Oct 2019 5985250251028 1097629174
235 Dec 2019 6277551200690 1127023870
236 Feb 2020 6968991265752 1206720688
237 Apr 2020 7788133221338 1267547429
238 Jun 2020 8114046262158 1302852615
239 Aug 2020 8841649410652 1408122887
240 Oct 2020 9215815569509 1432874252
241 Dec 2020 11830842428018 1517995689
242 Feb 2021 12270717209612 1563938043
243 Apr 2021 12732048052023 1590670459
244 Jun 2021 13442974346437 1632796606
245 Aug 2021 13888187863722 1653427055
246 Oct 2021 14599101574547 1721064101
247 Dec 2021 14922033922302 1734664952
248 Feb 2022 15428122140820 1750505007
249 Apr 2022 16071520702170 1781374217
250 Jun 2022 16710373006600 1796349114
251 Aug 2022 17511809676629 2024099677
252 Oct 2022 18231960808828 2167900306
253 Dec 2022 19086596616569 2241439349
254 Feb 2023 20116642176263 2337838461
255 Apr 2023 20926504760221 2440470464
The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.
TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).
Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.
Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tsa
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.
Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.
Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.
Release Date Base Pairs Entries
201 Apr 2014 23632325832 29734989
202 Jun 2014 31707343431 38011942
203 Aug 2014 33676182560 40556905
204 Oct 2014 36279458440 43567759
205 Dec 2014 46056420903 62635617
206 Feb 2015 49765340047 66706014
207 Apr 2015 55796332435 71989588
208 Jun 2015 60697472570 76974601
209 Aug 2015 69360654413 87827013
210 Oct 2015 70917172944 81790031
211 Dec 2015 77583339176 87488539
212 Feb 2016 81932555094 92132318
213 Apr 2016 87811163676 98147566
214 Jun 2016 94413958919 104677061
215 Aug 2016 103399742586 113179607
216 Oct 2016 113209225762 124199597
217 Dec 2016 125328824508 142094337
218 Feb 2017 133517212104 151431485
219 Apr 2017 149038907599 165068542
220 Jun 2017 158112969073 176812130
221 Aug 2017 167045663417 186777106
222 Oct 2017 172909268535 192754804
223 Dec 2017 181394660188 201559502
224 Feb 2018 193940551226 214324264
225 Apr 2018 205232396043 227364990
226 Jun 2018 216556686631 238788334
227 Aug 2018 225520004678 249295386
228 Oct 2018 235875573598 259927414
229 Dec 2018 248592892188 274845473
230 Feb 2019 263936885705 294772430
231 Apr 2019 277118019688 311247136
232 Jun 2019 285390240861 319927264
233 Aug 2019 294727165179 331347807
234 Oct 2019 305371891408 342811151
235 Dec 2019 325433016129 367193844
236 Feb 2020 340994289065 386644871
237 Apr 2020 349692751528 396392280
238 Jun 2020 359947709062 409725050
239 Aug 2020 366968951160 417524567
240 Oct 2020 382996662270 435968379
241 Dec 2020 392206975386 446397378
242 Feb 2021 407605409948 463151000
243 Apr 2021 425076483459 481154920
244 Jun 2021 436594941165 494641358
245 Aug 2021 440578422611 498305045
246 Oct 2021 449891016597 508319391
247 Dec 2021 455870853358 514158576
248 Feb 2022 465013156502 524464601
249 Apr 2022 474421076448 534770586
250 Jun 2022 485056129761 546991572
251 Aug 2022 497501380386 560196830
252 Oct 2022 511476787957 574020080
253 Dec 2022 611850391049 649918843
254 Feb 2023 630615054587 672261981
255 Apr 2023 636291358227 678332682
The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.
Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
ftp://ftp.ncbi.nih.gov/genbank/tls
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.
Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.
Release Date Base Pairs Entries
217 Dec 2016 584697919 1268690
218 Feb 2017 636923295 1438349
219 Apr 2017 636923295 1438349 (unchanged)
220 Jun 2017 824191338 1628475
221 Aug 2017 824191338 1628475 (unchanged)
222 Oct 2017 2993818315 9479460
223 Dec 2017 4458042616 12695198
224 Feb 2018 4531966831 12819978
225 Apr 2018 5612769448 14782654
226 Jun 2018 5896511468 15393041
227 Aug 2018 6077824493 15822538
228 Oct 2018 8435112913 20752288
229 Dec 2018 8511829281 20924588
230 Feb 2019 9146836085 23259929
231 Apr 2019 9623321565 24240761
232 Jun 2019 10182427815 25530139
233 Aug 2019 10531800829 26363945
234 Oct 2019 10848455369 27460978
235 Dec 2019 11280596614 28227180
236 Feb 2020 13669678196 34037371
237 Apr 2020 24615270313 65521132
238 Jun 2020 27500635128 75063181
239 Aug 2020 27825059498 75682157
240 Oct 2020 28814798868 78177358
241 Dec 2020 33036509446 88039152
242 Feb 2021 33634122995 90130561
243 Apr 2021 37998534461 102395753
244 Jun 2021 38198113354 102662929
245 Aug 2021 39930167315 106995218
246 Oct 2021 40168874815 107569935
247 Dec 2021 41143480750 109379021
248 Feb 2022 41321107981 109809966
249 Apr 2022 41324192343 109820387
250 Jun 2022 41999358847 111142107
251 Aug 2022 43852280645 115103527
252 Oct 2022 43860512749 115123306
253 Dec 2022 44009657455 115552377
254 Feb 2023 46465508548 121067644
255 Apr 2023 46567924833 121186672
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
April 15 2023
NCBI-GenBank Flat File Release 255.0
Bacterial Sequences (Part 1)
51396 loci, 92682287 bases, from 51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.
NOTE : Presentation of GI sequence identifiers in the GenBank
flatfile format was discontinued as of March 2017.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, possibly 'LINEAGE'. But because changes like this can be
very disruptive for customers, implementation has not yet been scheduled.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
3.4.4.1 : Important notice about parsing the LOCUS line
Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.
Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.
Consider this LOCUS line for a typical complete bacterial genome:
LOCUS CP032762 5868661 bp DNA circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:
LOCUS AZZZAA02123456789 9999999999 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:
LOCUS AZZZAA0212345678910000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:
LOCUS AZZZAA02123456789 10000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.
3.4.4.2 : Data elements of the LOCUS line
The data elements of the LOCUS line format and their typical/historical
column positions are as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus Name (usually identical to the Accession Number)
29-29 space
30-40 Sequence Length, right-justified
41-41 space
42-43 'bp'
44-44 space
45-47 Strandedness : spaces (if not known), ss- (single-stranded),
ds- (double-stranded), or ms- (mixed-stranded)
48-53 Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA).
Left justified.
54-55 space
56-63 Molecule Topology : 'linear' followed by two spaces,
or 'circular'
64-64 space
65-67 Division Code
68-68 space
69-79 Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.
The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :
LOCUS HUMPDNRC 273 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S125 polymorphic dinucleotide repeat.
ACCESSION L10620
LOCUS HUMPDNRG 169 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S114 polymorphic dinucleotide repeat.
ACCESSION L10624
But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:
LOCUS AF035771 1357 bp mRNA linear PRI 30-JUN-1998
DEFINITION Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
complete cds.
ACCESSION AF035771
The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :
PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags)
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites)
GSS - GSS sequences (Genome Survey Sequences)
HTG - HTGS sequences (High Throughput Genomic sequences)
HTC - HTC sequences (High Throughput cDNA sequences)
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences
The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1
^^^^^^^^^^
Compound
Accession.Version
Number
A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:
http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS ANHA01000001 503 bp DNA linear BCT 23-NOV-2012
DEFINITION Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION ANHA01000001 ANHA01000000
VERSION ANHA01000001.1
DBLINK BioProject: PRJNA177352
BioSample: SAMN01795900
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK BioProject:PRJNA174162,PRJNA999998,PRJNA999999
And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.
As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".
DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:
http://www.ncbi.nlm.nih.gov/bioproject
At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:
http://www.ncbi.nlm.nih.gov/books/NBK54016/
DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:
http://www.ncbi.nlm.nih.gov/assembly
At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:
http://www.ncbi.nlm.nih.gov/assembly/help/
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:
http://www.insdc.org/documents/feature-table
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.2
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
The list of valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.3
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, as of June 2022 the `/exception' qualifier has only four
allowed values: 'RNA editing', 'reasons given in citation', 'rearrangement
required for product', and 'annotated by transcript or proteomic data'.
These are known as controlled vocabulary qualifier values. Controlled
qualifier values are case sensitive.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS KZ271580 141308 bp DNA linear CON 17-AUG-2017
DEFINITION Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION KZ271580 LQNL01000000
VERSION KZ271580.1
DBLINK BioProject: PRJNA230512
BioSample: SAMN04226856
KEYWORDS WGS; HIGH_QUALITY_DRAFT.
...
mRNA complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/product="hypothetical protein"
CDS complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/codon_start=1
/product="hypothetical protein"
/protein_id="OZC04795.1"
/db_xref="GI:1233056989"
/translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Scaffold/CON-division join() sequence
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.
The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] .
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Sayers E, Cavanaugh M, Clark K, Ostell J, Pruitt K,
Karsch-Mizrachi I, "GenBank", Nucleic Acids Research,
Volume 47, Issue D1, January 2019, pp. D94-D99
PMID: 30365038
PMCID: PMC6323954
DOI: 10.1093/nar/gky989
The following statement is an example of how one might cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'
(1) Sayers, E. et al, Nucleic Acids Res. 47(D1):D94-D99 (2019)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: Simply direct your web browser of choice to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] .
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Genome Workbench can be used to submit revisions to
previous submissions. In addition, suggestions and corrections can
be sent by electronic mail to: [email protected]. Please be
certain to indicate the primary accession number of the entry to which
your comments apply; it is helpful if you also give the entry name and
the current contents of any data field for which you are recommending
a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
Vincent Calhoun, Andreina Castillo Siri, Larry Chlumsky, Karen Clark,
Scott Durkin, Michel Eschenbrenner, Michael Fetchko, Linda Frisse,
Andrea Gocke, Anjanette Johnston, Erica Lam,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Augustus Tilley,
Beverly Underwood, and Linda Yankie
Data Management and Preparation
Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
Sergiy Gotvyanskyy, Eugene Gribov, Sergei Kalashnikov, Jonathan Kans,
Leonid Khotomliansky, Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh,
Alex Kotliarov, Frank Ludwig, Vasuki Palanigobu, Anton Perkov,
Andriy Petrow, Sergey Petrunin, Dmitrii Saprykin, Wenyao Shi, Denis Sinyakov,
Thomas Smith, Vladimir Soussov, Vitaly Stakhovsky, Elena Starchenko,
Hanzhen Sun, Andrei Vereshchagin, Jewen Xiao, Liwei Zhou
Database Administration
Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
Benjamin Slade, Constantin Vasilyev
Customer Support
David Brodsky, Hanguan Liu, Cooper Park, Monica Romiti, Eric Sayers,
Majda Valjavec-Gratian
Project Direction
Steve Sherry : Director, NCBI
Kim Pruitt : Branch Chief, NCBI/IEB
Eugene Yaschenko : Chief Technology Officer, NCBI/IRB
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
