Release Notes For GenBank Release 257

GBREL.TXT          Genetic Sequence Data Bank
                         August 15 2023

               NCBI-GenBank Flat File Release 257.0

                    Distribution Release Notes

  246119175 sequences,  2112058517945 bases, for traditional GenBank records
 3442186440 sequences, 22988911970477 bases, for set-based (WGS/TSA/TLS) records

  This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://www.ncbi.nlm.nih.gov/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 257.0
1.2 Cutoff Date
1.3 Important Changes in Release 257.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 257.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use Submission Portal or BankIt for
sending sequence data.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       Email:  [email protected]

Updates and changes to existing GenBank records:

       https://www.ncbi.nlm.nih.gov/genbank/update/
       Email: [email protected]

URLs for GenBank's web-based submission tools:

	Submission Portal    https://submit.ncbi.nlm.nih.gov/
	BankIt               https://www.ncbi.nlm.nih.gov/WebSub/

See Section 1.5 for additional details about submitting data to GenBank.

*****************************************************************************

  GenBank Release 257.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

  GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:

        ftp://ftp.ncbi.nih.gov/genbank/wgs
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	
        ftp://ftp.ncbi.nih.gov/genbank/tsa
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	
        ftp://ftp.ncbi.nih.gov/genbank/tls
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls

See the README files in those areas for more information.

  Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:

	ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/

  Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.

1.2 Cutoff Date

  This full release, 257.0, incorporates data processed by the INSDC databases
as of Wednesday June 14 at 10:57PM EDT. For more recent data, users are
advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotide' database (see Section 6.4 of this document).

1.3 Important Changes in Release 257.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 441 with this release:
  
  - the BCT division is now composed of 1010 files (+35)
  - the ENV division is now composed of   79 files (+1)
  - the INV division is now composed of 1739 files (+175)
  - the MAM division is now composed of  235 files (+1)
  - the PAT division is now composed of  260 files (+6)
  - the PLN division is now composed of 1265 files (+93)
  - the ROD division is now composed of  306 files (-1)
  - the VRL division is now composed of 1022 files (+107)
  - the VRT division is now composed of  423 files (+24)

  The decrease in the number of ROD-division data files was due to the
  suppression of LR862396, a 51-Mbp eukaryotic sequence record. This
  changed the packaging just enough to yield one less data file.

1.4 Upcoming Changes

1.4.1 New allowed values for the /country and /collection_date qualifiers

  The INSDC will begin to mandate inclusion of /country and /collection_date
for sequence submissions, in alignment with its goal of increasing the number
of sequences for which the origin of a sample can be precisely located in
time and space. This requirement is expected to take effect by the end of
December 2024, and further details can be found at:

https://www.insdc.org/news/insdc-spatiotemporal-metadata-minimum-standards-update-03-03-2023/

  Because there are valid circumstances in which the country and/or the
collection date for a sequenced sample cannot be provided, the domain
of allowed values for these two source-feature qualifiers will be expanded
to include a variety of "null terms". They are:

    missing
    not applicable
    not collected
    not provided
    restricted access
    missing: control sample
    missing: sample group
    missing: synthetic construct
    missing: lab stock
    missing: third party data
    missing: data agreement established pre-2023
    missing: endangered species
    missing: human-identifiable

  The timing for introducing these new values is still uncertain, but the
earliest possible date for their appearance is June 15 2023.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank utilizing the tools summarized below.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. General
information for submitting to Genbank is available online:

	https://www.ncbi.nlm.nih.gov/genbank/submit/

  To assist researchers in entering their own sequence data, GenBank
provides Web-based submission tools: Submission Portal and Bankit.

	Submission Portal    https://submit.ncbi.nlm.nih.gov/
	BankIt               https://www.ncbi.nlm.nih.gov/WebSub/

  Submission Portal provides an efficient submission pathway for high
frequency submission types (e.g., 16S rRNA, rRNA-ITS, metazoan COX1,
SARS-CoV-2, etc.).

  BankIt is an easy-to-use program that enables authors to enter one
or more sequences, annotate, and submit to GenBank. BankIt provides
a simple forms-based approach for submitting your sequence and the
relevant associated metadata to GenBank.

  Genbank also provides submission preparation tools which require uploading
via the Submission Portal or email to [email protected] when relevant:

	table2asn: https://www.ncbi.nlm.nih.gov/genbank/table2asn/

  table2asn is a command-line program that automates the creation of sequence
records for submission to GenBank. It is used primarily for submission of
complete genomes and large batches of sequences and is available by FTP
for use on MAC, PC and Unix platforms:

	https://ftp.ncbi.nlm.nih.gov/asn1-converters/by_program/table2asn/

  Genome Workbench offers a rich set of integrated tools for studying
and analyzing genetic data. The Submission Wizard allows you to prepare
submissions of single eukaryotic and prokaryotic genomes. You can also
use Genome Workbench to edit and visualize an ASN.1 file created by table2asn.

	Genome Workbench: https://www.ncbi.nlm.nih.gov/tools/gbench/

  Through the international collaboration of DNA sequence databases,
GenBank submissions are forwarded daily for inclusion in the European
Nucleotide Archive (ENA) and the DNA Databank of Japan (DDBJ).

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.

  SEQUIN.  As of January 2021, Sequin sequence submissions are no longer
accepted by GenBank, and the Sequin application is no longer distributed
by NCBI.  See: https://ncbiinsights.ncbi.nlm.nih.gov/tag/sequin/

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] .

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 7749 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct1000.seq - Bacterial sequence entries, part 1000.
5. gbbct1001.seq - Bacterial sequence entries, part 1001.
6. gbbct1002.seq - Bacterial sequence entries, part 1002.
7. gbbct1003.seq - Bacterial sequence entries, part 1003.
8. gbbct1004.seq - Bacterial sequence entries, part 1004.
9. gbbct1005.seq - Bacterial sequence entries, part 1005.
10. gbbct1006.seq - Bacterial sequence entries, part 1006.
11. gbbct1007.seq - Bacterial sequence entries, part 1007.
12. gbbct1008.seq - Bacterial sequence entries, part 1008.
13. gbbct1009.seq - Bacterial sequence entries, part 1009.
14. gbbct101.seq - Bacterial sequence entries, part 101.
15. gbbct1010.seq - Bacterial sequence entries, part 1010.
16. gbbct102.seq - Bacterial sequence entries, part 102.
17. gbbct103.seq - Bacterial sequence entries, part 103.
18. gbbct104.seq - Bacterial sequence entries, part 104.
19. gbbct105.seq - Bacterial sequence entries, part 105.
20. gbbct106.seq - Bacterial sequence entries, part 106.
21. gbbct107.seq - Bacterial sequence entries, part 107.
22. gbbct108.seq - Bacterial sequence entries, part 108.
23. gbbct109.seq - Bacterial sequence entries, part 109.
24. gbbct11.seq - Bacterial sequence entries, part 11.
25. gbbct110.seq - Bacterial sequence entries, part 110.
26. gbbct111.seq - Bacterial sequence entries, part 111.
27. gbbct112.seq - Bacterial sequence entries, part 112.
28. gbbct113.seq - Bacterial sequence entries, part 113.
29. gbbct114.seq - Bacterial sequence entries, part 114.
30. gbbct115.seq - Bacterial sequence entries, part 115.
31. gbbct116.seq - Bacterial sequence entries, part 116.
32. gbbct117.seq - Bacterial sequence entries, part 117.
33. gbbct118.seq - Bacterial sequence entries, part 118.
34. gbbct119.seq - Bacterial sequence entries, part 119.
35. gbbct12.seq - Bacterial sequence entries, part 12.
36. gbbct120.seq - Bacterial sequence entries, part 120.
37. gbbct121.seq - Bacterial sequence entries, part 121.
38. gbbct122.seq - Bacterial sequence entries, part 122.
39. gbbct123.seq - Bacterial sequence entries, part 123.
40. gbbct124.seq - Bacterial sequence entries, part 124.
41. gbbct125.seq - Bacterial sequence entries, part 125.
42. gbbct126.seq - Bacterial sequence entries, part 126.
43. gbbct127.seq - Bacterial sequence entries, part 127.
44. gbbct128.seq - Bacterial sequence entries, part 128.
45. gbbct129.seq - Bacterial sequence entries, part 129.
46. gbbct13.seq - Bacterial sequence entries, part 13.
47. gbbct130.seq - Bacterial sequence entries, part 130.
48. gbbct131.seq - Bacterial sequence entries, part 131.
49. gbbct132.seq - Bacterial sequence entries, part 132.
50. gbbct133.seq - Bacterial sequence entries, part 133.
51. gbbct134.seq - Bacterial sequence entries, part 134.
52. gbbct135.seq - Bacterial sequence entries, part 135.
53. gbbct136.seq - Bacterial sequence entries, part 136.
54. gbbct137.seq - Bacterial sequence entries, part 137.
55. gbbct138.seq - Bacterial sequence entries, part 138.
56. gbbct139.seq - Bacterial sequence entries, part 139.
57. gbbct14.seq - Bacterial sequence entries, part 14.
58. gbbct140.seq - Bacterial sequence entries, part 140.
59. gbbct141.seq - Bacterial sequence entries, part 141.
60. gbbct142.seq - Bacterial sequence entries, part 142.
61. gbbct143.seq - Bacterial sequence entries, part 143.
62. gbbct144.seq - Bacterial sequence entries, part 144.
63. gbbct145.seq - Bacterial sequence entries, part 145.
64. gbbct146.seq - Bacterial sequence entries, part 146.
65. gbbct147.seq - Bacterial sequence entries, part 147.
66. gbbct148.seq - Bacterial sequence entries, part 148.
67. gbbct149.seq - Bacterial sequence entries, part 149.
68. gbbct15.seq - Bacterial sequence entries, part 15.
69. gbbct150.seq - Bacterial sequence entries, part 150.
70. gbbct151.seq - Bacterial sequence entries, part 151.
71. gbbct152.seq - Bacterial sequence entries, part 152.
72. gbbct153.seq - Bacterial sequence entries, part 153.
73. gbbct154.seq - Bacterial sequence entries, part 154.
74. gbbct155.seq - Bacterial sequence entries, part 155.
75. gbbct156.seq - Bacterial sequence entries, part 156.
76. gbbct157.seq - Bacterial sequence entries, part 157.
77. gbbct158.seq - Bacterial sequence entries, part 158.
78. gbbct159.seq - Bacterial sequence entries, part 159.
79. gbbct16.seq - Bacterial sequence entries, part 16.
80. gbbct160.seq - Bacterial sequence entries, part 160.
81. gbbct161.seq - Bacterial sequence entries, part 161.
82. gbbct162.seq - Bacterial sequence entries, part 162.
83. gbbct163.seq - Bacterial sequence entries, part 163.
84. gbbct164.seq - Bacterial sequence entries, part 164.
85. gbbct165.seq - Bacterial sequence entries, part 165.
86. gbbct166.seq - Bacterial sequence entries, part 166.
87. gbbct167.seq - Bacterial sequence entries, part 167.
88. gbbct168.seq - Bacterial sequence entries, part 168.
89. gbbct169.seq - Bacterial sequence entries, part 169.
90. gbbct17.seq - Bacterial sequence entries, part 17.
91. gbbct170.seq - Bacterial sequence entries, part 170.
92. gbbct171.seq - Bacterial sequence entries, part 171.
93. gbbct172.seq - Bacterial sequence entries, part 172.
94. gbbct173.seq - Bacterial sequence entries, part 173.
95. gbbct174.seq - Bacterial sequence entries, part 174.
96. gbbct175.seq - Bacterial sequence entries, part 175.
97. gbbct176.seq - Bacterial sequence entries, part 176.
98. gbbct177.seq - Bacterial sequence entries, part 177.
99. gbbct178.seq - Bacterial sequence entries, part 178.
100. gbbct179.seq - Bacterial sequence entries, part 179.
101. gbbct18.seq - Bacterial sequence entries, part 18.
102. gbbct180.seq - Bacterial sequence entries, part 180.
103. gbbct181.seq - Bacterial sequence entries, part 181.
104. gbbct182.seq - Bacterial sequence entries, part 182.
105. gbbct183.seq - Bacterial sequence entries, part 183.
106. gbbct184.seq - Bacterial sequence entries, part 184.
107. gbbct185.seq - Bacterial sequence entries, part 185.
108. gbbct186.seq - Bacterial sequence entries, part 186.
109. gbbct187.seq - Bacterial sequence entries, part 187.
110. gbbct188.seq - Bacterial sequence entries, part 188.
111. gbbct189.seq - Bacterial sequence entries, part 189.
112. gbbct19.seq - Bacterial sequence entries, part 19.
113. gbbct190.seq - Bacterial sequence entries, part 190.
114. gbbct191.seq - Bacterial sequence entries, part 191.
115. gbbct192.seq - Bacterial sequence entries, part 192.
116. gbbct193.seq - Bacterial sequence entries, part 193.
117. gbbct194.seq - Bacterial sequence entries, part 194.
118. gbbct195.seq - Bacterial sequence entries, part 195.
119. gbbct196.seq - Bacterial sequence entries, part 196.
120. gbbct197.seq - Bacterial sequence entries, part 197.
121. gbbct198.seq - Bacterial sequence entries, part 198.
122. gbbct199.seq - Bacterial sequence entries, part 199.
123. gbbct2.seq - Bacterial sequence entries, part 2.
124. gbbct20.seq - Bacterial sequence entries, part 20.
125. gbbct200.seq - Bacterial sequence entries, part 200.
126. gbbct201.seq - Bacterial sequence entries, part 201.
127. gbbct202.seq - Bacterial sequence entries, part 202.
128. gbbct203.seq - Bacterial sequence entries, part 203.
129. gbbct204.seq - Bacterial sequence entries, part 204.
130. gbbct205.seq - Bacterial sequence entries, part 205.
131. gbbct206.seq - Bacterial sequence entries, part 206.
132. gbbct207.seq - Bacterial sequence entries, part 207.
133. gbbct208.seq - Bacterial sequence entries, part 208.
134. gbbct209.seq - Bacterial sequence entries, part 209.
135. gbbct21.seq - Bacterial sequence entries, part 21.
136. gbbct210.seq - Bacterial sequence entries, part 210.
137. gbbct211.seq - Bacterial sequence entries, part 211.
138. gbbct212.seq - Bacterial sequence entries, part 212.
139. gbbct213.seq - Bacterial sequence entries, part 213.
140. gbbct214.seq - Bacterial sequence entries, part 214.
141. gbbct215.seq - Bacterial sequence entries, part 215.
142. gbbct216.seq - Bacterial sequence entries, part 216.
143. gbbct217.seq - Bacterial sequence entries, part 217.
144. gbbct218.seq - Bacterial sequence entries, part 218.
145. gbbct219.seq - Bacterial sequence entries, part 219.
146. gbbct22.seq - Bacterial sequence entries, part 22.
147. gbbct220.seq - Bacterial sequence entries, part 220.
148. gbbct221.seq - Bacterial sequence entries, part 221.
149. gbbct222.seq - Bacterial sequence entries, part 222.
150. gbbct223.seq - Bacterial sequence entries, part 223.
151. gbbct224.seq - Bacterial sequence entries, part 224.
152. gbbct225.seq - Bacterial sequence entries, part 225.
153. gbbct226.seq - Bacterial sequence entries, part 226.
154. gbbct227.seq - Bacterial sequence entries, part 227.
155. gbbct228.seq - Bacterial sequence entries, part 228.
156. gbbct229.seq - Bacterial sequence entries, part 229.
157. gbbct23.seq - Bacterial sequence entries, part 23.
158. gbbct230.seq - Bacterial sequence entries, part 230.
159. gbbct231.seq - Bacterial sequence entries, part 231.
160. gbbct232.seq - Bacterial sequence entries, part 232.
161. gbbct233.seq - Bacterial sequence entries, part 233.
162. gbbct234.seq - Bacterial sequence entries, part 234.
163. gbbct235.seq - Bacterial sequence entries, part 235.
164. gbbct236.seq - Bacterial sequence entries, part 236.
165. gbbct237.seq - Bacterial sequence entries, part 237.
166. gbbct238.seq - Bacterial sequence entries, part 238.
167. gbbct239.seq - Bacterial sequence entries, part 239.
168. gbbct24.seq - Bacterial sequence entries, part 24.
169. gbbct240.seq - Bacterial sequence entries, part 240.
170. gbbct241.seq - Bacterial sequence entries, part 241.
171. gbbct242.seq - Bacterial sequence entries, part 242.
172. gbbct243.seq - Bacterial sequence entries, part 243.
173. gbbct244.seq - Bacterial sequence entries, part 244.
174. gbbct245.seq - Bacterial sequence entries, part 245.
175. gbbct246.seq - Bacterial sequence entries, part 246.
176. gbbct247.seq - Bacterial sequence entries, part 247.
177. gbbct248.seq - Bacterial sequence entries, part 248.
178. gbbct249.seq - Bacterial sequence entries, part 249.
179. gbbct25.seq - Bacterial sequence entries, part 25.
180. gbbct250.seq - Bacterial sequence entries, part 250.
181. gbbct251.seq - Bacterial sequence entries, part 251.
182. gbbct252.seq - Bacterial sequence entries, part 252.
183. gbbct253.seq - Bacterial sequence entries, part 253.
184. gbbct254.seq - Bacterial sequence entries, part 254.
185. gbbct255.seq - Bacterial sequence entries, part 255.
186. gbbct256.seq - Bacterial sequence entries, part 256.
187. gbbct257.seq - Bacterial sequence entries, part 257.
188. gbbct258.seq - Bacterial sequence entries, part 258.
189. gbbct259.seq - Bacterial sequence entries, part 259.
190. gbbct26.seq - Bacterial sequence entries, part 26.
191. gbbct260.seq - Bacterial sequence entries, part 260.
192. gbbct261.seq - Bacterial sequence entries, part 261.
193. gbbct262.seq - Bacterial sequence entries, part 262.
194. gbbct263.seq - Bacterial sequence entries, part 263.
195. gbbct264.seq - Bacterial sequence entries, part 264.
196. gbbct265.seq - Bacterial sequence entries, part 265.
197. gbbct266.seq - Bacterial sequence entries, part 266.
198. gbbct267.seq - Bacterial sequence entries, part 267.
199. gbbct268.seq - Bacterial sequence entries, part 268.
200. gbbct269.seq - Bacterial sequence entries, part 269.
201. gbbct27.seq - Bacterial sequence entries, part 27.
202. gbbct270.seq - Bacterial sequence entries, part 270.
203. gbbct271.seq - Bacterial sequence entries, part 271.
204. gbbct272.seq - Bacterial sequence entries, part 272.
205. gbbct273.seq - Bacterial sequence entries, part 273.
206. gbbct274.seq - Bacterial sequence entries, part 274.
207. gbbct275.seq - Bacterial sequence entries, part 275.
208. gbbct276.seq - Bacterial sequence entries, part 276.
209. gbbct277.seq - Bacterial sequence entries, part 277.
210. gbbct278.seq - Bacterial sequence entries, part 278.
211. gbbct279.seq - Bacterial sequence entries, part 279.
212. gbbct28.seq - Bacterial sequence entries, part 28.
213. gbbct280.seq - Bacterial sequence entries, part 280.
214. gbbct281.seq - Bacterial sequence entries, part 281.
215. gbbct282.seq - Bacterial sequence entries, part 282.
216. gbbct283.seq - Bacterial sequence entries, part 283.
217. gbbct284.seq - Bacterial sequence entries, part 284.
218. gbbct285.seq - Bacterial sequence entries, part 285.
219. gbbct286.seq - Bacterial sequence entries, part 286.
220. gbbct287.seq - Bacterial sequence entries, part 287.
221. gbbct288.seq - Bacterial sequence entries, part 288.
222. gbbct289.seq - Bacterial sequence entries, part 289.
223. gbbct29.seq - Bacterial sequence entries, part 29.
224. gbbct290.seq - Bacterial sequence entries, part 290.
225. gbbct291.seq - Bacterial sequence entries, part 291.
226. gbbct292.seq - Bacterial sequence entries, part 292.
227. gbbct293.seq - Bacterial sequence entries, part 293.
228. gbbct294.seq - Bacterial sequence entries, part 294.
229. gbbct295.seq - Bacterial sequence entries, part 295.
230. gbbct296.seq - Bacterial sequence entries, part 296.
231. gbbct297.seq - Bacterial sequence entries, part 297.
232. gbbct298.seq - Bacterial sequence entries, part 298.
233. gbbct299.seq - Bacterial sequence entries, part 299.
234. gbbct3.seq - Bacterial sequence entries, part 3.
235. gbbct30.seq - Bacterial sequence entries, part 30.
236. gbbct300.seq - Bacterial sequence entries, part 300.
237. gbbct301.seq - Bacterial sequence entries, part 301.
238. gbbct302.seq - Bacterial sequence entries, part 302.
239. gbbct303.seq - Bacterial sequence entries, part 303.
240. gbbct304.seq - Bacterial sequence entries, part 304.
241. gbbct305.seq - Bacterial sequence entries, part 305.
242. gbbct306.seq - Bacterial sequence entries, part 306.
243. gbbct307.seq - Bacterial sequence entries, part 307.
244. gbbct308.seq - Bacterial sequence entries, part 308.
245. gbbct309.seq - Bacterial sequence entries, part 309.
246. gbbct31.seq - Bacterial sequence entries, part 31.
247. gbbct310.seq - Bacterial sequence entries, part 310.
248. gbbct311.seq - Bacterial sequence entries, part 311.
249. gbbct312.seq - Bacterial sequence entries, part 312.
250. gbbct313.seq - Bacterial sequence entries, part 313.
251. gbbct314.seq - Bacterial sequence entries, part 314.
252. gbbct315.seq - Bacterial sequence entries, part 315.
253. gbbct316.seq - Bacterial sequence entries, part 316.
254. gbbct317.seq - Bacterial sequence entries, part 317.
255. gbbct318.seq - Bacterial sequence entries, part 318.
256. gbbct319.seq - Bacterial sequence entries, part 319.
257. gbbct32.seq - Bacterial sequence entries, part 32.
258. gbbct320.seq - Bacterial sequence entries, part 320.
259. gbbct321.seq - Bacterial sequence entries, part 321.
260. gbbct322.seq - Bacterial sequence entries, part 322.
261. gbbct323.seq - Bacterial sequence entries, part 323.
262. gbbct324.seq - Bacterial sequence entries, part 324.
263. gbbct325.seq - Bacterial sequence entries, part 325.
264. gbbct326.seq - Bacterial sequence entries, part 326.
265. gbbct327.seq - Bacterial sequence entries, part 327.
266. gbbct328.seq - Bacterial sequence entries, part 328.
267. gbbct329.seq - Bacterial sequence entries, part 329.
268. gbbct33.seq - Bacterial sequence entries, part 33.
269. gbbct330.seq - Bacterial sequence entries, part 330.
270. gbbct331.seq - Bacterial sequence entries, part 331.
271. gbbct332.seq - Bacterial sequence entries, part 332.
272. gbbct333.seq - Bacterial sequence entries, part 333.
273. gbbct334.seq - Bacterial sequence entries, part 334.
274. gbbct335.seq - Bacterial sequence entries, part 335.
275. gbbct336.seq - Bacterial sequence entries, part 336.
276. gbbct337.seq - Bacterial sequence entries, part 337.
277. gbbct338.seq - Bacterial sequence entries, part 338.
278. gbbct339.seq - Bacterial sequence entries, part 339.
279. gbbct34.seq - Bacterial sequence entries, part 34.
280. gbbct340.seq - Bacterial sequence entries, part 340.
281. gbbct341.seq - Bacterial sequence entries, part 341.
282. gbbct342.seq - Bacterial sequence entries, part 342.
283. gbbct343.seq - Bacterial sequence entries, part 343.
284. gbbct344.seq - Bacterial sequence entries, part 344.
285. gbbct345.seq - Bacterial sequence entries, part 345.
286. gbbct346.seq - Bacterial sequence entries, part 346.
287. gbbct347.seq - Bacterial sequence entries, part 347.
288. gbbct348.seq - Bacterial sequence entries, part 348.
289. gbbct349.seq - Bacterial sequence entries, part 349.
290. gbbct35.seq - Bacterial sequence entries, part 35.
291. gbbct350.seq - Bacterial sequence entries, part 350.
292. gbbct351.seq - Bacterial sequence entries, part 351.
293. gbbct352.seq - Bacterial sequence entries, part 352.
294. gbbct353.seq - Bacterial sequence entries, part 353.
295. gbbct354.seq - Bacterial sequence entries, part 354.
296. gbbct355.seq - Bacterial sequence entries, part 355.
297. gbbct356.seq - Bacterial sequence entries, part 356.
298. gbbct357.seq - Bacterial sequence entries, part 357.
299. gbbct358.seq - Bacterial sequence entries, part 358.
300. gbbct359.seq - Bacterial sequence entries, part 359.
301. gbbct36.seq - Bacterial sequence entries, part 36.
302. gbbct360.seq - Bacterial sequence entries, part 360.
303. gbbct361.seq - Bacterial sequence entries, part 361.
304. gbbct362.seq - Bacterial sequence entries, part 362.
305. gbbct363.seq - Bacterial sequence entries, part 363.
306. gbbct364.seq - Bacterial sequence entries, part 364.
307. gbbct365.seq - Bacterial sequence entries, part 365.
308. gbbct366.seq - Bacterial sequence entries, part 366.
309. gbbct367.seq - Bacterial sequence entries, part 367.
310. gbbct368.seq - Bacterial sequence entries, part 368.
311. gbbct369.seq - Bacterial sequence entries, part 369.
312. gbbct37.seq - Bacterial sequence entries, part 37.
313. gbbct370.seq - Bacterial sequence entries, part 370.
314. gbbct371.seq - Bacterial sequence entries, part 371.
315. gbbct372.seq - Bacterial sequence entries, part 372.
316. gbbct373.seq - Bacterial sequence entries, part 373.
317. gbbct374.seq - Bacterial sequence entries, part 374.
318. gbbct375.seq - Bacterial sequence entries, part 375.
319. gbbct376.seq - Bacterial sequence entries, part 376.
320. gbbct377.seq - Bacterial sequence entries, part 377.
321. gbbct378.seq - Bacterial sequence entries, part 378.
322. gbbct379.seq - Bacterial sequence entries, part 379.
323. gbbct38.seq - Bacterial sequence entries, part 38.
324. gbbct380.seq - Bacterial sequence entries, part 380.
325. gbbct381.seq - Bacterial sequence entries, part 381.
326. gbbct382.seq - Bacterial sequence entries, part 382.
327. gbbct383.seq - Bacterial sequence entries, part 383.
328. gbbct384.seq - Bacterial sequence entries, part 384.
329. gbbct385.seq - Bacterial sequence entries, part 385.
330. gbbct386.seq - Bacterial sequence entries, part 386.
331. gbbct387.seq - Bacterial sequence entries, part 387.
332. gbbct388.seq - Bacterial sequence entries, part 388.
333. gbbct389.seq - Bacterial sequence entries, part 389.
334. gbbct39.seq - Bacterial sequence entries, part 39.
335. gbbct390.seq - Bacterial sequence entries, part 390.
336. gbbct391.seq - Bacterial sequence entries, part 391.
337. gbbct392.seq - Bacterial sequence entries, part 392.
338. gbbct393.seq - Bacterial sequence entries, part 393.
339. gbbct394.seq - Bacterial sequence entries, part 394.
340. gbbct395.seq - Bacterial sequence entries, part 395.
341. gbbct396.seq - Bacterial sequence entries, part 396.
342. gbbct397.seq - Bacterial sequence entries, part 397.
343. gbbct398.seq - Bacterial sequence entries, part 398.
344. gbbct399.seq - Bacterial sequence entries, part 399.
345. gbbct4.seq - Bacterial sequence entries, part 4.
346. gbbct40.seq - Bacterial sequence entries, part 40.
347. gbbct400.seq - Bacterial sequence entries, part 400.
348. gbbct401.seq - Bacterial sequence entries, part 401.
349. gbbct402.seq - Bacterial sequence entries, part 402.
350. gbbct403.seq - Bacterial sequence entries, part 403.
351. gbbct404.seq - Bacterial sequence entries, part 404.
352. gbbct405.seq - Bacterial sequence entries, part 405.
353. gbbct406.seq - Bacterial sequence entries, part 406.
354. gbbct407.seq - Bacterial sequence entries, part 407.
355. gbbct408.seq - Bacterial sequence entries, part 408.
356. gbbct409.seq - Bacterial sequence entries, part 409.
357. gbbct41.seq - Bacterial sequence entries, part 41.
358. gbbct410.seq - Bacterial sequence entries, part 410.
359. gbbct411.seq - Bacterial sequence entries, part 411.
360. gbbct412.seq - Bacterial sequence entries, part 412.
361. gbbct413.seq - Bacterial sequence entries, part 413.
362. gbbct414.seq - Bacterial sequence entries, part 414.
363. gbbct415.seq - Bacterial sequence entries, part 415.
364. gbbct416.seq - Bacterial sequence entries, part 416.
365. gbbct417.seq - Bacterial sequence entries, part 417.
366. gbbct418.seq - Bacterial sequence entries, part 418.
367. gbbct419.seq - Bacterial sequence entries, part 419.
368. gbbct42.seq - Bacterial sequence entries, part 42.
369. gbbct420.seq - Bacterial sequence entries, part 420.
370. gbbct421.seq - Bacterial sequence entries, part 421.
371. gbbct422.seq - Bacterial sequence entries, part 422.
372. gbbct423.seq - Bacterial sequence entries, part 423.
373. gbbct424.seq - Bacterial sequence entries, part 424.
374. gbbct425.seq - Bacterial sequence entries, part 425.
375. gbbct426.seq - Bacterial sequence entries, part 426.
376. gbbct427.seq - Bacterial sequence entries, part 427.
377. gbbct428.seq - Bacterial sequence entries, part 428.
378. gbbct429.seq - Bacterial sequence entries, part 429.
379. gbbct43.seq - Bacterial sequence entries, part 43.
380. gbbct430.seq - Bacterial sequence entries, part 430.
381. gbbct431.seq - Bacterial sequence entries, part 431.
382. gbbct432.seq - Bacterial sequence entries, part 432.
383. gbbct433.seq - Bacterial sequence entries, part 433.
384. gbbct434.seq - Bacterial sequence entries, part 434.
385. gbbct435.seq - Bacterial sequence entries, part 435.
386. gbbct436.seq - Bacterial sequence entries, part 436.
387. gbbct437.seq - Bacterial sequence entries, part 437.
388. gbbct438.seq - Bacterial sequence entries, part 438.
389. gbbct439.seq - Bacterial sequence entries, part 439.
390. gbbct44.seq - Bacterial sequence entries, part 44.
391. gbbct440.seq - Bacterial sequence entries, part 440.
392. gbbct441.seq - Bacterial sequence entries, part 441.
393. gbbct442.seq - Bacterial sequence entries, part 442.
394. gbbct443.seq - Bacterial sequence entries, part 443.
395. gbbct444.seq - Bacterial sequence entries, part 444.
396. gbbct445.seq - Bacterial sequence entries, part 445.
397. gbbct446.seq - Bacterial sequence entries, part 446.
398. gbbct447.seq - Bacterial sequence entries, part 447.
399. gbbct448.seq - Bacterial sequence entries, part 448.
400. gbbct449.seq - Bacterial sequence entries, part 449.
401. gbbct45.seq - Bacterial sequence entries, part 45.
402. gbbct450.seq - Bacterial sequence entries, part 450.
403. gbbct451.seq - Bacterial sequence entries, part 451.
404. gbbct452.seq - Bacterial sequence entries, part 452.
405. gbbct453.seq - Bacterial sequence entries, part 453.
406. gbbct454.seq - Bacterial sequence entries, part 454.
407. gbbct455.seq - Bacterial sequence entries, part 455.
408. gbbct456.seq - Bacterial sequence entries, part 456.
409. gbbct457.seq - Bacterial sequence entries, part 457.
410. gbbct458.seq - Bacterial sequence entries, part 458.
411. gbbct459.seq - Bacterial sequence entries, part 459.
412. gbbct46.seq - Bacterial sequence entries, part 46.
413. gbbct460.seq - Bacterial sequence entries, part 460.
414. gbbct461.seq - Bacterial sequence entries, part 461.
415. gbbct462.seq - Bacterial sequence entries, part 462.
416. gbbct463.seq - Bacterial sequence entries, part 463.
417. gbbct464.seq - Bacterial sequence entries, part 464.
418. gbbct465.seq - Bacterial sequence entries, part 465.
419. gbbct466.seq - Bacterial sequence entries, part 466.
420. gbbct467.seq - Bacterial sequence entries, part 467.
421. gbbct468.seq - Bacterial sequence entries, part 468.
422. gbbct469.seq - Bacterial sequence entries, part 469.
423. gbbct47.seq - Bacterial sequence entries, part 47.
424. gbbct470.seq - Bacterial sequence entries, part 470.
425. gbbct471.seq - Bacterial sequence entries, part 471.
426. gbbct472.seq - Bacterial sequence entries, part 472.
427. gbbct473.seq - Bacterial sequence entries, part 473.
428. gbbct474.seq - Bacterial sequence entries, part 474.
429. gbbct475.seq - Bacterial sequence entries, part 475.
430. gbbct476.seq - Bacterial sequence entries, part 476.
431. gbbct477.seq - Bacterial sequence entries, part 477.
432. gbbct478.seq - Bacterial sequence entries, part 478.
433. gbbct479.seq - Bacterial sequence entries, part 479.
434. gbbct48.seq - Bacterial sequence entries, part 48.
435. gbbct480.seq - Bacterial sequence entries, part 480.
436. gbbct481.seq - Bacterial sequence entries, part 481.
437. gbbct482.seq - Bacterial sequence entries, part 482.
438. gbbct483.seq - Bacterial sequence entries, part 483.
439. gbbct484.seq - Bacterial sequence entries, part 484.
440. gbbct485.seq - Bacterial sequence entries, part 485.
441. gbbct486.seq - Bacterial sequence entries, part 486.
442. gbbct487.seq - Bacterial sequence entries, part 487.
443. gbbct488.seq - Bacterial sequence entries, part 488.
444. gbbct489.seq - Bacterial sequence entries, part 489.
445. gbbct49.seq - Bacterial sequence entries, part 49.
446. gbbct490.seq - Bacterial sequence entries, part 490.
447. gbbct491.seq - Bacterial sequence entries, part 491.
448. gbbct492.seq - Bacterial sequence entries, part 492.
449. gbbct493.seq - Bacterial sequence entries, part 493.
450. gbbct494.seq - Bacterial sequence entries, part 494.
451. gbbct495.seq - Bacterial sequence entries, part 495.
452. gbbct496.seq - Bacterial sequence entries, part 496.
453. gbbct497.seq - Bacterial sequence entries, part 497.
454. gbbct498.seq - Bacterial sequence entries, part 498.
455. gbbct499.seq - Bacterial sequence entries, part 499.
456. gbbct5.seq - Bacterial sequence entries, part 5.
457. gbbct50.seq - Bacterial sequence entries, part 50.
458. gbbct500.seq - Bacterial sequence entries, part 500.
459. gbbct501.seq - Bacterial sequence entries, part 501.
460. gbbct502.seq - Bacterial sequence entries, part 502.
461. gbbct503.seq - Bacterial sequence entries, part 503.
462. gbbct504.seq - Bacterial sequence entries, part 504.
463. gbbct505.seq - Bacterial sequence entries, part 505.
464. gbbct506.seq - Bacterial sequence entries, part 506.
465. gbbct507.seq - Bacterial sequence entries, part 507.
466. gbbct508.seq - Bacterial sequence entries, part 508.
467. gbbct509.seq - Bacterial sequence entries, part 509.
468. gbbct51.seq - Bacterial sequence entries, part 51.
469. gbbct510.seq - Bacterial sequence entries, part 510.
470. gbbct511.seq - Bacterial sequence entries, part 511.
471. gbbct512.seq - Bacterial sequence entries, part 512.
472. gbbct513.seq - Bacterial sequence entries, part 513.
473. gbbct514.seq - Bacterial sequence entries, part 514.
474. gbbct515.seq - Bacterial sequence entries, part 515.
475. gbbct516.seq - Bacterial sequence entries, part 516.
476. gbbct517.seq - Bacterial sequence entries, part 517.
477. gbbct518.seq - Bacterial sequence entries, part 518.
478. gbbct519.seq - Bacterial sequence entries, part 519.
479. gbbct52.seq - Bacterial sequence entries, part 52.
480. gbbct520.seq - Bacterial sequence entries, part 520.
481. gbbct521.seq - Bacterial sequence entries, part 521.
482. gbbct522.seq - Bacterial sequence entries, part 522.
483. gbbct523.seq - Bacterial sequence entries, part 523.
484. gbbct524.seq - Bacterial sequence entries, part 524.
485. gbbct525.seq - Bacterial sequence entries, part 525.
486. gbbct526.seq - Bacterial sequence entries, part 526.
487. gbbct527.seq - Bacterial sequence entries, part 527.
488. gbbct528.seq - Bacterial sequence entries, part 528.
489. gbbct529.seq - Bacterial sequence entries, part 529.
490. gbbct53.seq - Bacterial sequence entries, part 53.
491. gbbct530.seq - Bacterial sequence entries, part 530.
492. gbbct531.seq - Bacterial sequence entries, part 531.
493. gbbct532.seq - Bacterial sequence entries, part 532.
494. gbbct533.seq - Bacterial sequence entries, part 533.
495. gbbct534.seq - Bacterial sequence entries, part 534.
496. gbbct535.seq - Bacterial sequence entries, part 535.
497. gbbct536.seq - Bacterial sequence entries, part 536.
498. gbbct537.seq - Bacterial sequence entries, part 537.
499. gbbct538.seq - Bacterial sequence entries, part 538.
500. gbbct539.seq - Bacterial sequence entries, part 539.
501. gbbct54.seq - Bacterial sequence entries, part 54.
502. gbbct540.seq - Bacterial sequence entries, part 540.
503. gbbct541.seq - Bacterial sequence entries, part 541.
504. gbbct542.seq - Bacterial sequence entries, part 542.
505. gbbct543.seq - Bacterial sequence entries, part 543.
506. gbbct544.seq - Bacterial sequence entries, part 544.
507. gbbct545.seq - Bacterial sequence entries, part 545.
508. gbbct546.seq - Bacterial sequence entries, part 546.
509. gbbct547.seq - Bacterial sequence entries, part 547.
510. gbbct548.seq - Bacterial sequence entries, part 548.
511. gbbct549.seq - Bacterial sequence entries, part 549.
512. gbbct55.seq - Bacterial sequence entries, part 55.
513. gbbct550.seq - Bacterial sequence entries, part 550.
514. gbbct551.seq - Bacterial sequence entries, part 551.
515. gbbct552.seq - Bacterial sequence entries, part 552.
516. gbbct553.seq - Bacterial sequence entries, part 553.
517. gbbct554.seq - Bacterial sequence entries, part 554.
518. gbbct555.seq - Bacterial sequence entries, part 555.
519. gbbct556.seq - Bacterial sequence entries, part 556.
520. gbbct557.seq - Bacterial sequence entries, part 557.
521. gbbct558.seq - Bacterial sequence entries, part 558.
522. gbbct559.seq - Bacterial sequence entries, part 559.
523. gbbct56.seq - Bacterial sequence entries, part 56.
524. gbbct560.seq - Bacterial sequence entries, part 560.
525. gbbct561.seq - Bacterial sequence entries, part 561.
526. gbbct562.seq - Bacterial sequence entries, part 562.
527. gbbct563.seq - Bacterial sequence entries, part 563.
528. gbbct564.seq - Bacterial sequence entries, part 564.
529. gbbct565.seq - Bacterial sequence entries, part 565.
530. gbbct566.seq - Bacterial sequence entries, part 566.
531. gbbct567.seq - Bacterial sequence entries, part 567.
532. gbbct568.seq - Bacterial sequence entries, part 568.
533. gbbct569.seq - Bacterial sequence entries, part 569.
534. gbbct57.seq - Bacterial sequence entries, part 57.
535. gbbct570.seq - Bacterial sequence entries, part 570.
536. gbbct571.seq - Bacterial sequence entries, part 571.
537. gbbct572.seq - Bacterial sequence entries, part 572.
538. gbbct573.seq - Bacterial sequence entries, part 573.
539. gbbct574.seq - Bacterial sequence entries, part 574.
540. gbbct575.seq - Bacterial sequence entries, part 575.
541. gbbct576.seq - Bacterial sequence entries, part 576.
542. gbbct577.seq - Bacterial sequence entries, part 577.
543. gbbct578.seq - Bacterial sequence entries, part 578.
544. gbbct579.seq - Bacterial sequence entries, part 579.
545. gbbct58.seq - Bacterial sequence entries, part 58.
546. gbbct580.seq - Bacterial sequence entries, part 580.
547. gbbct581.seq - Bacterial sequence entries, part 581.
548. gbbct582.seq - Bacterial sequence entries, part 582.
549. gbbct583.seq - Bacterial sequence entries, part 583.
550. gbbct584.seq - Bacterial sequence entries, part 584.
551. gbbct585.seq - Bacterial sequence entries, part 585.
552. gbbct586.seq - Bacterial sequence entries, part 586.
553. gbbct587.seq - Bacterial sequence entries, part 587.
554. gbbct588.seq - Bacterial sequence entries, part 588.
555. gbbct589.seq - Bacterial sequence entries, part 589.
556. gbbct59.seq - Bacterial sequence entries, part 59.
557. gbbct590.seq - Bacterial sequence entries, part 590.
558. gbbct591.seq - Bacterial sequence entries, part 591.
559. gbbct592.seq - Bacterial sequence entries, part 592.
560. gbbct593.seq - Bacterial sequence entries, part 593.
561. gbbct594.seq - Bacterial sequence entries, part 594.
562. gbbct595.seq - Bacterial sequence entries, part 595.
563. gbbct596.seq - Bacterial sequence entries, part 596.
564. gbbct597.seq - Bacterial sequence entries, part 597.
565. gbbct598.seq - Bacterial sequence entries, part 598.
566. gbbct599.seq - Bacterial sequence entries, part 599.
567. gbbct6.seq - Bacterial sequence entries, part 6.
568. gbbct60.seq - Bacterial sequence entries, part 60.
569. gbbct600.seq - Bacterial sequence entries, part 600.
570. gbbct601.seq - Bacterial sequence entries, part 601.
571. gbbct602.seq - Bacterial sequence entries, part 602.
572. gbbct603.seq - Bacterial sequence entries, part 603.
573. gbbct604.seq - Bacterial sequence entries, part 604.
574. gbbct605.seq - Bacterial sequence entries, part 605.
575. gbbct606.seq - Bacterial sequence entries, part 606.
576. gbbct607.seq - Bacterial sequence entries, part 607.
577. gbbct608.seq - Bacterial sequence entries, part 608.
578. gbbct609.seq - Bacterial sequence entries, part 609.
579. gbbct61.seq - Bacterial sequence entries, part 61.
580. gbbct610.seq - Bacterial sequence entries, part 610.
581. gbbct611.seq - Bacterial sequence entries, part 611.
582. gbbct612.seq - Bacterial sequence entries, part 612.
583. gbbct613.seq - Bacterial sequence entries, part 613.
584. gbbct614.seq - Bacterial sequence entries, part 614.
585. gbbct615.seq - Bacterial sequence entries, part 615.
586. gbbct616.seq - Bacterial sequence entries, part 616.
587. gbbct617.seq - Bacterial sequence entries, part 617.
588. gbbct618.seq - Bacterial sequence entries, part 618.
589. gbbct619.seq - Bacterial sequence entries, part 619.
590. gbbct62.seq - Bacterial sequence entries, part 62.
591. gbbct620.seq - Bacterial sequence entries, part 620.
592. gbbct621.seq - Bacterial sequence entries, part 621.
593. gbbct622.seq - Bacterial sequence entries, part 622.
594. gbbct623.seq - Bacterial sequence entries, part 623.
595. gbbct624.seq - Bacterial sequence entries, part 624.
596. gbbct625.seq - Bacterial sequence entries, part 625.
597. gbbct626.seq - Bacterial sequence entries, part 626.
598. gbbct627.seq - Bacterial sequence entries, part 627.
599. gbbct628.seq - Bacterial sequence entries, part 628.
600. gbbct629.seq - Bacterial sequence entries, part 629.
601. gbbct63.seq - Bacterial sequence entries, part 63.
602. gbbct630.seq - Bacterial sequence entries, part 630.
603. gbbct631.seq - Bacterial sequence entries, part 631.
604. gbbct632.seq - Bacterial sequence entries, part 632.
605. gbbct633.seq - Bacterial sequence entries, part 633.
606. gbbct634.seq - Bacterial sequence entries, part 634.
607. gbbct635.seq - Bacterial sequence entries, part 635.
608. gbbct636.seq - Bacterial sequence entries, part 636.
609. gbbct637.seq - Bacterial sequence entries, part 637.
610. gbbct638.seq - Bacterial sequence entries, part 638.
611. gbbct639.seq - Bacterial sequence entries, part 639.
612. gbbct64.seq - Bacterial sequence entries, part 64.
613. gbbct640.seq - Bacterial sequence entries, part 640.
614. gbbct641.seq - Bacterial sequence entries, part 641.
615. gbbct642.seq - Bacterial sequence entries, part 642.
616. gbbct643.seq - Bacterial sequence entries, part 643.
617. gbbct644.seq - Bacterial sequence entries, part 644.
618. gbbct645.seq - Bacterial sequence entries, part 645.
619. gbbct646.seq - Bacterial sequence entries, part 646.
620. gbbct647.seq - Bacterial sequence entries, part 647.
621. gbbct648.seq - Bacterial sequence entries, part 648.
622. gbbct649.seq - Bacterial sequence entries, part 649.
623. gbbct65.seq - Bacterial sequence entries, part 65.
624. gbbct650.seq - Bacterial sequence entries, part 650.
625. gbbct651.seq - Bacterial sequence entries, part 651.
626. gbbct652.seq - Bacterial sequence entries, part 652.
627. gbbct653.seq - Bacterial sequence entries, part 653.
628. gbbct654.seq - Bacterial sequence entries, part 654.
629. gbbct655.seq - Bacterial sequence entries, part 655.
630. gbbct656.seq - Bacterial sequence entries, part 656.
631. gbbct657.seq - Bacterial sequence entries, part 657.
632. gbbct658.seq - Bacterial sequence entries, part 658.
633. gbbct659.seq - Bacterial sequence entries, part 659.
634. gbbct66.seq - Bacterial sequence entries, part 66.
635. gbbct660.seq - Bacterial sequence entries, part 660.
636. gbbct661.seq - Bacterial sequence entries, part 661.
637. gbbct662.seq - Bacterial sequence entries, part 662.
638. gbbct663.seq - Bacterial sequence entries, part 663.
639. gbbct664.seq - Bacterial sequence entries, part 664.
640. gbbct665.seq - Bacterial sequence entries, part 665.
641. gbbct666.seq - Bacterial sequence entries, part 666.
642. gbbct667.seq - Bacterial sequence entries, part 667.
643. gbbct668.seq - Bacterial sequence entries, part 668.
644. gbbct669.seq - Bacterial sequence entries, part 669.
645. gbbct67.seq - Bacterial sequence entries, part 67.
646. gbbct670.seq - Bacterial sequence entries, part 670.
647. gbbct671.seq - Bacterial sequence entries, part 671.
648. gbbct672.seq - Bacterial sequence entries, part 672.
649. gbbct673.seq - Bacterial sequence entries, part 673.
650. gbbct674.seq - Bacterial sequence entries, part 674.
651. gbbct675.seq - Bacterial sequence entries, part 675.
652. gbbct676.seq - Bacterial sequence entries, part 676.
653. gbbct677.seq - Bacterial sequence entries, part 677.
654. gbbct678.seq - Bacterial sequence entries, part 678.
655. gbbct679.seq - Bacterial sequence entries, part 679.
656. gbbct68.seq - Bacterial sequence entries, part 68.
657. gbbct680.seq - Bacterial sequence entries, part 680.
658. gbbct681.seq - Bacterial sequence entries, part 681.
659. gbbct682.seq - Bacterial sequence entries, part 682.
660. gbbct683.seq - Bacterial sequence entries, part 683.
661. gbbct684.seq - Bacterial sequence entries, part 684.
662. gbbct685.seq - Bacterial sequence entries, part 685.
663. gbbct686.seq - Bacterial sequence entries, part 686.
664. gbbct687.seq - Bacterial sequence entries, part 687.
665. gbbct688.seq - Bacterial sequence entries, part 688.
666. gbbct689.seq - Bacterial sequence entries, part 689.
667. gbbct69.seq - Bacterial sequence entries, part 69.
668. gbbct690.seq - Bacterial sequence entries, part 690.
669. gbbct691.seq - Bacterial sequence entries, part 691.
670. gbbct692.seq - Bacterial sequence entries, part 692.
671. gbbct693.seq - Bacterial sequence entries, part 693.
672. gbbct694.seq - Bacterial sequence entries, part 694.
673. gbbct695.seq - Bacterial sequence entries, part 695.
674. gbbct696.seq - Bacterial sequence entries, part 696.
675. gbbct697.seq - Bacterial sequence entries, part 697.
676. gbbct698.seq - Bacterial sequence entries, part 698.
677. gbbct699.seq - Bacterial sequence entries, part 699.
678. gbbct7.seq - Bacterial sequence entries, part 7.
679. gbbct70.seq - Bacterial sequence entries, part 70.
680. gbbct700.seq - Bacterial sequence entries, part 700.
681. gbbct701.seq - Bacterial sequence entries, part 701.
682. gbbct702.seq - Bacterial sequence entries, part 702.
683. gbbct703.seq - Bacterial sequence entries, part 703.
684. gbbct704.seq - Bacterial sequence entries, part 704.
685. gbbct705.seq - Bacterial sequence entries, part 705.
686. gbbct706.seq - Bacterial sequence entries, part 706.
687. gbbct707.seq - Bacterial sequence entries, part 707.
688. gbbct708.seq - Bacterial sequence entries, part 708.
689. gbbct709.seq - Bacterial sequence entries, part 709.
690. gbbct71.seq - Bacterial sequence entries, part 71.
691. gbbct710.seq - Bacterial sequence entries, part 710.
692. gbbct711.seq - Bacterial sequence entries, part 711.
693. gbbct712.seq - Bacterial sequence entries, part 712.
694. gbbct713.seq - Bacterial sequence entries, part 713.
695. gbbct714.seq - Bacterial sequence entries, part 714.
696. gbbct715.seq - Bacterial sequence entries, part 715.
697. gbbct716.seq - Bacterial sequence entries, part 716.
698. gbbct717.seq - Bacterial sequence entries, part 717.
699. gbbct718.seq - Bacterial sequence entries, part 718.
700. gbbct719.seq - Bacterial sequence entries, part 719.
701. gbbct72.seq - Bacterial sequence entries, part 72.
702. gbbct720.seq - Bacterial sequence entries, part 720.
703. gbbct721.seq - Bacterial sequence entries, part 721.
704. gbbct722.seq - Bacterial sequence entries, part 722.
705. gbbct723.seq - Bacterial sequence entries, part 723.
706. gbbct724.seq - Bacterial sequence entries, part 724.
707. gbbct725.seq - Bacterial sequence entries, part 725.
708. gbbct726.seq - Bacterial sequence entries, part 726.
709. gbbct727.seq - Bacterial sequence entries, part 727.
710. gbbct728.seq - Bacterial sequence entries, part 728.
711. gbbct729.seq - Bacterial sequence entries, part 729.
712. gbbct73.seq - Bacterial sequence entries, part 73.
713. gbbct730.seq - Bacterial sequence entries, part 730.
714. gbbct731.seq - Bacterial sequence entries, part 731.
715. gbbct732.seq - Bacterial sequence entries, part 732.
716. gbbct733.seq - Bacterial sequence entries, part 733.
717. gbbct734.seq - Bacterial sequence entries, part 734.
718. gbbct735.seq - Bacterial sequence entries, part 735.
719. gbbct736.seq - Bacterial sequence entries, part 736.
720. gbbct737.seq - Bacterial sequence entries, part 737.
721. gbbct738.seq - Bacterial sequence entries, part 738.
722. gbbct739.seq - Bacterial sequence entries, part 739.
723. gbbct74.seq - Bacterial sequence entries, part 74.
724. gbbct740.seq - Bacterial sequence entries, part 740.
725. gbbct741.seq - Bacterial sequence entries, part 741.
726. gbbct742.seq - Bacterial sequence entries, part 742.
727. gbbct743.seq - Bacterial sequence entries, part 743.
728. gbbct744.seq - Bacterial sequence entries, part 744.
729. gbbct745.seq - Bacterial sequence entries, part 745.
730. gbbct746.seq - Bacterial sequence entries, part 746.
731. gbbct747.seq - Bacterial sequence entries, part 747.
732. gbbct748.seq - Bacterial sequence entries, part 748.
733. gbbct749.seq - Bacterial sequence entries, part 749.
734. gbbct75.seq - Bacterial sequence entries, part 75.
735. gbbct750.seq - Bacterial sequence entries, part 750.
736. gbbct751.seq - Bacterial sequence entries, part 751.
737. gbbct752.seq - Bacterial sequence entries, part 752.
738. gbbct753.seq - Bacterial sequence entries, part 753.
739. gbbct754.seq - Bacterial sequence entries, part 754.
740. gbbct755.seq - Bacterial sequence entries, part 755.
741. gbbct756.seq - Bacterial sequence entries, part 756.
742. gbbct757.seq - Bacterial sequence entries, part 757.
743. gbbct758.seq - Bacterial sequence entries, part 758.
744. gbbct759.seq - Bacterial sequence entries, part 759.
745. gbbct76.seq - Bacterial sequence entries, part 76.
746. gbbct760.seq - Bacterial sequence entries, part 760.
747. gbbct761.seq - Bacterial sequence entries, part 761.
748. gbbct762.seq - Bacterial sequence entries, part 762.
749. gbbct763.seq - Bacterial sequence entries, part 763.
750. gbbct764.seq - Bacterial sequence entries, part 764.
751. gbbct765.seq - Bacterial sequence entries, part 765.
752. gbbct766.seq - Bacterial sequence entries, part 766.
753. gbbct767.seq - Bacterial sequence entries, part 767.
754. gbbct768.seq - Bacterial sequence entries, part 768.
755. gbbct769.seq - Bacterial sequence entries, part 769.
756. gbbct77.seq - Bacterial sequence entries, part 77.
757. gbbct770.seq - Bacterial sequence entries, part 770.
758. gbbct771.seq - Bacterial sequence entries, part 771.
759. gbbct772.seq - Bacterial sequence entries, part 772.
760. gbbct773.seq - Bacterial sequence entries, part 773.
761. gbbct774.seq - Bacterial sequence entries, part 774.
762. gbbct775.seq - Bacterial sequence entries, part 775.
763. gbbct776.seq - Bacterial sequence entries, part 776.
764. gbbct777.seq - Bacterial sequence entries, part 777.
765. gbbct778.seq - Bacterial sequence entries, part 778.
766. gbbct779.seq - Bacterial sequence entries, part 779.
767. gbbct78.seq - Bacterial sequence entries, part 78.
768. gbbct780.seq - Bacterial sequence entries, part 780.
769. gbbct781.seq - Bacterial sequence entries, part 781.
770. gbbct782.seq - Bacterial sequence entries, part 782.
771. gbbct783.seq - Bacterial sequence entries, part 783.
772. gbbct784.seq - Bacterial sequence entries, part 784.
773. gbbct785.seq - Bacterial sequence entries, part 785.
774. gbbct786.seq - Bacterial sequence entries, part 786.
775. gbbct787.seq - Bacterial sequence entries, part 787.
776. gbbct788.seq - Bacterial sequence entries, part 788.
777. gbbct789.seq - Bacterial sequence entries, part 789.
778. gbbct79.seq - Bacterial sequence entries, part 79.
779. gbbct790.seq - Bacterial sequence entries, part 790.
780. gbbct791.seq - Bacterial sequence entries, part 791.
781. gbbct792.seq - Bacterial sequence entries, part 792.
782. gbbct793.seq - Bacterial sequence entries, part 793.
783. gbbct794.seq - Bacterial sequence entries, part 794.
784. gbbct795.seq - Bacterial sequence entries, part 795.
785. gbbct796.seq - Bacterial sequence entries, part 796.
786. gbbct797.seq - Bacterial sequence entries, part 797.
787. gbbct798.seq - Bacterial sequence entries, part 798.
788. gbbct799.seq - Bacterial sequence entries, part 799.
789. gbbct8.seq - Bacterial sequence entries, part 8.
790. gbbct80.seq - Bacterial sequence entries, part 80.
791. gbbct800.seq - Bacterial sequence entries, part 800.
792. gbbct801.seq - Bacterial sequence entries, part 801.
793. gbbct802.seq - Bacterial sequence entries, part 802.
794. gbbct803.seq - Bacterial sequence entries, part 803.
795. gbbct804.seq - Bacterial sequence entries, part 804.
796. gbbct805.seq - Bacterial sequence entries, part 805.
797. gbbct806.seq - Bacterial sequence entries, part 806.
798. gbbct807.seq - Bacterial sequence entries, part 807.
799. gbbct808.seq - Bacterial sequence entries, part 808.
800. gbbct809.seq - Bacterial sequence entries, part 809.
801. gbbct81.seq - Bacterial sequence entries, part 81.
802. gbbct810.seq - Bacterial sequence entries, part 810.
803. gbbct811.seq - Bacterial sequence entries, part 811.
804. gbbct812.seq - Bacterial sequence entries, part 812.
805. gbbct813.seq - Bacterial sequence entries, part 813.
806. gbbct814.seq - Bacterial sequence entries, part 814.
807. gbbct815.seq - Bacterial sequence entries, part 815.
808. gbbct816.seq - Bacterial sequence entries, part 816.
809. gbbct817.seq - Bacterial sequence entries, part 817.
810. gbbct818.seq - Bacterial sequence entries, part 818.
811. gbbct819.seq - Bacterial sequence entries, part 819.
812. gbbct82.seq - Bacterial sequence entries, part 82.
813. gbbct820.seq - Bacterial sequence entries, part 820.
814. gbbct821.seq - Bacterial sequence entries, part 821.
815. gbbct822.seq - Bacterial sequence entries, part 822.
816. gbbct823.seq - Bacterial sequence entries, part 823.
817. gbbct824.seq - Bacterial sequence entries, part 824.
818. gbbct825.seq - Bacterial sequence entries, part 825.
819. gbbct826.seq - Bacterial sequence entries, part 826.
820. gbbct827.seq - Bacterial sequence entries, part 827.
821. gbbct828.seq - Bacterial sequence entries, part 828.
822. gbbct829.seq - Bacterial sequence entries, part 829.
823. gbbct83.seq - Bacterial sequence entries, part 83.
824. gbbct830.seq - Bacterial sequence entries, part 830.
825. gbbct831.seq - Bacterial sequence entries, part 831.
826. gbbct832.seq - Bacterial sequence entries, part 832.
827. gbbct833.seq - Bacterial sequence entries, part 833.
828. gbbct834.seq - Bacterial sequence entries, part 834.
829. gbbct835.seq - Bacterial sequence entries, part 835.
830. gbbct836.seq - Bacterial sequence entries, part 836.
831. gbbct837.seq - Bacterial sequence entries, part 837.
832. gbbct838.seq - Bacterial sequence entries, part 838.
833. gbbct839.seq - Bacterial sequence entries, part 839.
834. gbbct84.seq - Bacterial sequence entries, part 84.
835. gbbct840.seq - Bacterial sequence entries, part 840.
836. gbbct841.seq - Bacterial sequence entries, part 841.
837. gbbct842.seq - Bacterial sequence entries, part 842.
838. gbbct843.seq - Bacterial sequence entries, part 843.
839. gbbct844.seq - Bacterial sequence entries, part 844.
840. gbbct845.seq - Bacterial sequence entries, part 845.
841. gbbct846.seq - Bacterial sequence entries, part 846.
842. gbbct847.seq - Bacterial sequence entries, part 847.
843. gbbct848.seq - Bacterial sequence entries, part 848.
844. gbbct849.seq - Bacterial sequence entries, part 849.
845. gbbct85.seq - Bacterial sequence entries, part 85.
846. gbbct850.seq - Bacterial sequence entries, part 850.
847. gbbct851.seq - Bacterial sequence entries, part 851.
848. gbbct852.seq - Bacterial sequence entries, part 852.
849. gbbct853.seq - Bacterial sequence entries, part 853.
850. gbbct854.seq - Bacterial sequence entries, part 854.
851. gbbct855.seq - Bacterial sequence entries, part 855.
852. gbbct856.seq - Bacterial sequence entries, part 856.
853. gbbct857.seq - Bacterial sequence entries, part 857.
854. gbbct858.seq - Bacterial sequence entries, part 858.
855. gbbct859.seq - Bacterial sequence entries, part 859.
856. gbbct86.seq - Bacterial sequence entries, part 86.
857. gbbct860.seq - Bacterial sequence entries, part 860.
858. gbbct861.seq - Bacterial sequence entries, part 861.
859. gbbct862.seq - Bacterial sequence entries, part 862.
860. gbbct863.seq - Bacterial sequence entries, part 863.
861. gbbct864.seq - Bacterial sequence entries, part 864.
862. gbbct865.seq - Bacterial sequence entries, part 865.
863. gbbct866.seq - Bacterial sequence entries, part 866.
864. gbbct867.seq - Bacterial sequence entries, part 867.
865. gbbct868.seq - Bacterial sequence entries, part 868.
866. gbbct869.seq - Bacterial sequence entries, part 869.
867. gbbct87.seq - Bacterial sequence entries, part 87.
868. gbbct870.seq - Bacterial sequence entries, part 870.
869. gbbct871.seq - Bacterial sequence entries, part 871.
870. gbbct872.seq - Bacterial sequence entries, part 872.
871. gbbct873.seq - Bacterial sequence entries, part 873.
872. gbbct874.seq - Bacterial sequence entries, part 874.
873. gbbct875.seq - Bacterial sequence entries, part 875.
874. gbbct876.seq - Bacterial sequence entries, part 876.
875. gbbct877.seq - Bacterial sequence entries, part 877.
876. gbbct878.seq - Bacterial sequence entries, part 878.
877. gbbct879.seq - Bacterial sequence entries, part 879.
878. gbbct88.seq - Bacterial sequence entries, part 88.
879. gbbct880.seq - Bacterial sequence entries, part 880.
880. gbbct881.seq - Bacterial sequence entries, part 881.
881. gbbct882.seq - Bacterial sequence entries, part 882.
882. gbbct883.seq - Bacterial sequence entries, part 883.
883. gbbct884.seq - Bacterial sequence entries, part 884.
884. gbbct885.seq - Bacterial sequence entries, part 885.
885. gbbct886.seq - Bacterial sequence entries, part 886.
886. gbbct887.seq - Bacterial sequence entries, part 887.
887. gbbct888.seq - Bacterial sequence entries, part 888.
888. gbbct889.seq - Bacterial sequence entries, part 889.
889. gbbct89.seq - Bacterial sequence entries, part 89.
890. gbbct890.seq - Bacterial sequence entries, part 890.
891. gbbct891.seq - Bacterial sequence entries, part 891.
892. gbbct892.seq - Bacterial sequence entries, part 892.
893. gbbct893.seq - Bacterial sequence entries, part 893.
894. gbbct894.seq - Bacterial sequence entries, part 894.
895. gbbct895.seq - Bacterial sequence entries, part 895.
896. gbbct896.seq - Bacterial sequence entries, part 896.
897. gbbct897.seq - Bacterial sequence entries, part 897.
898. gbbct898.seq - Bacterial sequence entries, part 898.
899. gbbct899.seq - Bacterial sequence entries, part 899.
900. gbbct9.seq - Bacterial sequence entries, part 9.
901. gbbct90.seq - Bacterial sequence entries, part 90.
902. gbbct900.seq - Bacterial sequence entries, part 900.
903. gbbct901.seq - Bacterial sequence entries, part 901.
904. gbbct902.seq - Bacterial sequence entries, part 902.
905. gbbct903.seq - Bacterial sequence entries, part 903.
906. gbbct904.seq - Bacterial sequence entries, part 904.
907. gbbct905.seq - Bacterial sequence entries, part 905.
908. gbbct906.seq - Bacterial sequence entries, part 906.
909. gbbct907.seq - Bacterial sequence entries, part 907.
910. gbbct908.seq - Bacterial sequence entries, part 908.
911. gbbct909.seq - Bacterial sequence entries, part 909.
912. gbbct91.seq - Bacterial sequence entries, part 91.
913. gbbct910.seq - Bacterial sequence entries, part 910.
914. gbbct911.seq - Bacterial sequence entries, part 911.
915. gbbct912.seq - Bacterial sequence entries, part 912.
916. gbbct913.seq - Bacterial sequence entries, part 913.
917. gbbct914.seq - Bacterial sequence entries, part 914.
918. gbbct915.seq - Bacterial sequence entries, part 915.
919. gbbct916.seq - Bacterial sequence entries, part 916.
920. gbbct917.seq - Bacterial sequence entries, part 917.
921. gbbct918.seq - Bacterial sequence entries, part 918.
922. gbbct919.seq - Bacterial sequence entries, part 919.
923. gbbct92.seq - Bacterial sequence entries, part 92.
924. gbbct920.seq - Bacterial sequence entries, part 920.
925. gbbct921.seq - Bacterial sequence entries, part 921.
926. gbbct922.seq - Bacterial sequence entries, part 922.
927. gbbct923.seq - Bacterial sequence entries, part 923.
928. gbbct924.seq - Bacterial sequence entries, part 924.
929. gbbct925.seq - Bacterial sequence entries, part 925.
930. gbbct926.seq - Bacterial sequence entries, part 926.
931. gbbct927.seq - Bacterial sequence entries, part 927.
932. gbbct928.seq - Bacterial sequence entries, part 928.
933. gbbct929.seq - Bacterial sequence entries, part 929.
934. gbbct93.seq - Bacterial sequence entries, part 93.
935. gbbct930.seq - Bacterial sequence entries, part 930.
936. gbbct931.seq - Bacterial sequence entries, part 931.
937. gbbct932.seq - Bacterial sequence entries, part 932.
938. gbbct933.seq - Bacterial sequence entries, part 933.
939. gbbct934.seq - Bacterial sequence entries, part 934.
940. gbbct935.seq - Bacterial sequence entries, part 935.
941. gbbct936.seq - Bacterial sequence entries, part 936.
942. gbbct937.seq - Bacterial sequence entries, part 937.
943. gbbct938.seq - Bacterial sequence entries, part 938.
944. gbbct939.seq - Bacterial sequence entries, part 939.
945. gbbct94.seq - Bacterial sequence entries, part 94.
946. gbbct940.seq - Bacterial sequence entries, part 940.
947. gbbct941.seq - Bacterial sequence entries, part 941.
948. gbbct942.seq - Bacterial sequence entries, part 942.
949. gbbct943.seq - Bacterial sequence entries, part 943.
950. gbbct944.seq - Bacterial sequence entries, part 944.
951. gbbct945.seq - Bacterial sequence entries, part 945.
952. gbbct946.seq - Bacterial sequence entries, part 946.
953. gbbct947.seq - Bacterial sequence entries, part 947.
954. gbbct948.seq - Bacterial sequence entries, part 948.
955. gbbct949.seq - Bacterial sequence entries, part 949.
956. gbbct95.seq - Bacterial sequence entries, part 95.
957. gbbct950.seq - Bacterial sequence entries, part 950.
958. gbbct951.seq - Bacterial sequence entries, part 951.
959. gbbct952.seq - Bacterial sequence entries, part 952.
960. gbbct953.seq - Bacterial sequence entries, part 953.
961. gbbct954.seq - Bacterial sequence entries, part 954.
962. gbbct955.seq - Bacterial sequence entries, part 955.
963. gbbct956.seq - Bacterial sequence entries, part 956.
964. gbbct957.seq - Bacterial sequence entries, part 957.
965. gbbct958.seq - Bacterial sequence entries, part 958.
966. gbbct959.seq - Bacterial sequence entries, part 959.
967. gbbct96.seq - Bacterial sequence entries, part 96.
968. gbbct960.seq - Bacterial sequence entries, part 960.
969. gbbct961.seq - Bacterial sequence entries, part 961.
970. gbbct962.seq - Bacterial sequence entries, part 962.
971. gbbct963.seq - Bacterial sequence entries, part 963.
972. gbbct964.seq - Bacterial sequence entries, part 964.
973. gbbct965.seq - Bacterial sequence entries, part 965.
974. gbbct966.seq - Bacterial sequence entries, part 966.
975. gbbct967.seq - Bacterial sequence entries, part 967.
976. gbbct968.seq - Bacterial sequence entries, part 968.
977. gbbct969.seq - Bacterial sequence entries, part 969.
978. gbbct97.seq - Bacterial sequence entries, part 97.
979. gbbct970.seq - Bacterial sequence entries, part 970.
980. gbbct971.seq - Bacterial sequence entries, part 971.
981. gbbct972.seq - Bacterial sequence entries, part 972.
982. gbbct973.seq - Bacterial sequence entries, part 973.
983. gbbct974.seq - Bacterial sequence entries, part 974.
984. gbbct975.seq - Bacterial sequence entries, part 975.
985. gbbct976.seq - Bacterial sequence entries, part 976.
986. gbbct977.seq - Bacterial sequence entries, part 977.
987. gbbct978.seq - Bacterial sequence entries, part 978.
988. gbbct979.seq - Bacterial sequence entries, part 979.
989. gbbct98.seq - Bacterial sequence entries, part 98.
990. gbbct980.seq - Bacterial sequence entries, part 980.
991. gbbct981.seq - Bacterial sequence entries, part 981.
992. gbbct982.seq - Bacterial sequence entries, part 982.
993. gbbct983.seq - Bacterial sequence entries, part 983.
994. gbbct984.seq - Bacterial sequence entries, part 984.
995. gbbct985.seq - Bacterial sequence entries, part 985.
996. gbbct986.seq - Bacterial sequence entries, part 986.
997. gbbct987.seq - Bacterial sequence entries, part 987.
998. gbbct988.seq - Bacterial sequence entries, part 988.
999. gbbct989.seq - Bacterial sequence entries, part 989.
1000. gbbct99.seq - Bacterial sequence entries, part 99.
1001. gbbct990.seq - Bacterial sequence entries, part 990.
1002. gbbct991.seq - Bacterial sequence entries, part 991.
1003. gbbct992.seq - Bacterial sequence entries, part 992.
1004. gbbct993.seq - Bacterial sequence entries, part 993.
1005. gbbct994.seq - Bacterial sequence entries, part 994.
1006. gbbct995.seq - Bacterial sequence entries, part 995.
1007. gbbct996.seq - Bacterial sequence entries, part 996.
1008. gbbct997.seq - Bacterial sequence entries, part 997.
1009. gbbct998.seq - Bacterial sequence entries, part 998.
1010. gbbct999.seq - Bacterial sequence entries, part 999.
1011. gbchg.txt - Accession numbers of entries updated since the previous release.
1012. gbcon1.seq - Constructed sequence entries, part 1.
1013. gbcon10.seq - Constructed sequence entries, part 10.
1014. gbcon100.seq - Constructed sequence entries, part 100.
1015. gbcon101.seq - Constructed sequence entries, part 101.
1016. gbcon102.seq - Constructed sequence entries, part 102.
1017. gbcon103.seq - Constructed sequence entries, part 103.
1018. gbcon104.seq - Constructed sequence entries, part 104.
1019. gbcon105.seq - Constructed sequence entries, part 105.
1020. gbcon106.seq - Constructed sequence entries, part 106.
1021. gbcon107.seq - Constructed sequence entries, part 107.
1022. gbcon108.seq - Constructed sequence entries, part 108.
1023. gbcon109.seq - Constructed sequence entries, part 109.
1024. gbcon11.seq - Constructed sequence entries, part 11.
1025. gbcon110.seq - Constructed sequence entries, part 110.
1026. gbcon111.seq - Constructed sequence entries, part 111.
1027. gbcon112.seq - Constructed sequence entries, part 112.
1028. gbcon113.seq - Constructed sequence entries, part 113.
1029. gbcon114.seq - Constructed sequence entries, part 114.
1030. gbcon115.seq - Constructed sequence entries, part 115.
1031. gbcon116.seq - Constructed sequence entries, part 116.
1032. gbcon117.seq - Constructed sequence entries, part 117.
1033. gbcon118.seq - Constructed sequence entries, part 118.
1034. gbcon119.seq - Constructed sequence entries, part 119.
1035. gbcon12.seq - Constructed sequence entries, part 12.
1036. gbcon120.seq - Constructed sequence entries, part 120.
1037. gbcon121.seq - Constructed sequence entries, part 121.
1038. gbcon122.seq - Constructed sequence entries, part 122.
1039. gbcon123.seq - Constructed sequence entries, part 123.
1040. gbcon124.seq - Constructed sequence entries, part 124.
1041. gbcon125.seq - Constructed sequence entries, part 125.
1042. gbcon126.seq - Constructed sequence entries, part 126.
1043. gbcon127.seq - Constructed sequence entries, part 127.
1044. gbcon128.seq - Constructed sequence entries, part 128.
1045. gbcon129.seq - Constructed sequence entries, part 129.
1046. gbcon13.seq - Constructed sequence entries, part 13.
1047. gbcon130.seq - Constructed sequence entries, part 130.
1048. gbcon131.seq - Constructed sequence entries, part 131.
1049. gbcon132.seq - Constructed sequence entries, part 132.
1050. gbcon133.seq - Constructed sequence entries, part 133.
1051. gbcon134.seq - Constructed sequence entries, part 134.
1052. gbcon135.seq - Constructed sequence entries, part 135.
1053. gbcon136.seq - Constructed sequence entries, part 136.
1054. gbcon137.seq - Constructed sequence entries, part 137.
1055. gbcon138.seq - Constructed sequence entries, part 138.
1056. gbcon139.seq - Constructed sequence entries, part 139.
1057. gbcon14.seq - Constructed sequence entries, part 14.
1058. gbcon140.seq - Constructed sequence entries, part 140.
1059. gbcon141.seq - Constructed sequence entries, part 141.
1060. gbcon142.seq - Constructed sequence entries, part 142.
1061. gbcon143.seq - Constructed sequence entries, part 143.
1062. gbcon144.seq - Constructed sequence entries, part 144.
1063. gbcon145.seq - Constructed sequence entries, part 145.
1064. gbcon146.seq - Constructed sequence entries, part 146.
1065. gbcon147.seq - Constructed sequence entries, part 147.
1066. gbcon148.seq - Constructed sequence entries, part 148.
1067. gbcon149.seq - Constructed sequence entries, part 149.
1068. gbcon15.seq - Constructed sequence entries, part 15.
1069. gbcon150.seq - Constructed sequence entries, part 150.
1070. gbcon151.seq - Constructed sequence entries, part 151.
1071. gbcon152.seq - Constructed sequence entries, part 152.
1072. gbcon153.seq - Constructed sequence entries, part 153.
1073. gbcon154.seq - Constructed sequence entries, part 154.
1074. gbcon155.seq - Constructed sequence entries, part 155.
1075. gbcon156.seq - Constructed sequence entries, part 156.
1076. gbcon157.seq - Constructed sequence entries, part 157.
1077. gbcon158.seq - Constructed sequence entries, part 158.
1078. gbcon159.seq - Constructed sequence entries, part 159.
1079. gbcon16.seq - Constructed sequence entries, part 16.
1080. gbcon160.seq - Constructed sequence entries, part 160.
1081. gbcon161.seq - Constructed sequence entries, part 161.
1082. gbcon162.seq - Constructed sequence entries, part 162.
1083. gbcon163.seq - Constructed sequence entries, part 163.
1084. gbcon164.seq - Constructed sequence entries, part 164.
1085. gbcon165.seq - Constructed sequence entries, part 165.
1086. gbcon166.seq - Constructed sequence entries, part 166.
1087. gbcon167.seq - Constructed sequence entries, part 167.
1088. gbcon168.seq - Constructed sequence entries, part 168.
1089. gbcon169.seq - Constructed sequence entries, part 169.
1090. gbcon17.seq - Constructed sequence entries, part 17.
1091. gbcon170.seq - Constructed sequence entries, part 170.
1092. gbcon171.seq - Constructed sequence entries, part 171.
1093. gbcon172.seq - Constructed sequence entries, part 172.
1094. gbcon173.seq - Constructed sequence entries, part 173.
1095. gbcon174.seq - Constructed sequence entries, part 174.
1096. gbcon175.seq - Constructed sequence entries, part 175.
1097. gbcon176.seq - Constructed sequence entries, part 176.
1098. gbcon177.seq - Constructed sequence entries, part 177.
1099. gbcon178.seq - Constructed sequence entries, part 178.
1100. gbcon179.seq - Constructed sequence entries, part 179.
1101. gbcon18.seq - Constructed sequence entries, part 18.
1102. gbcon180.seq - Constructed sequence entries, part 180.
1103. gbcon181.seq - Constructed sequence entries, part 181.
1104. gbcon182.seq - Constructed sequence entries, part 182.
1105. gbcon183.seq - Constructed sequence entries, part 183.
1106. gbcon184.seq - Constructed sequence entries, part 184.
1107. gbcon185.seq - Constructed sequence entries, part 185.
1108. gbcon186.seq - Constructed sequence entries, part 186.
1109. gbcon187.seq - Constructed sequence entries, part 187.
1110. gbcon188.seq - Constructed sequence entries, part 188.
1111. gbcon189.seq - Constructed sequence entries, part 189.
1112. gbcon19.seq - Constructed sequence entries, part 19.
1113. gbcon190.seq - Constructed sequence entries, part 190.
1114. gbcon191.seq - Constructed sequence entries, part 191.
1115. gbcon192.seq - Constructed sequence entries, part 192.
1116. gbcon193.seq - Constructed sequence entries, part 193.
1117. gbcon194.seq - Constructed sequence entries, part 194.
1118. gbcon195.seq - Constructed sequence entries, part 195.
1119. gbcon196.seq - Constructed sequence entries, part 196.
1120. gbcon197.seq - Constructed sequence entries, part 197.
1121. gbcon198.seq - Constructed sequence entries, part 198.
1122. gbcon199.seq - Constructed sequence entries, part 199.
1123. gbcon2.seq - Constructed sequence entries, part 2.
1124. gbcon20.seq - Constructed sequence entries, part 20.
1125. gbcon200.seq - Constructed sequence entries, part 200.
1126. gbcon201.seq - Constructed sequence entries, part 201.
1127. gbcon202.seq - Constructed sequence entries, part 202.
1128. gbcon203.seq - Constructed sequence entries, part 203.
1129. gbcon204.seq - Constructed sequence entries, part 204.
1130. gbcon205.seq - Constructed sequence entries, part 205.
1131. gbcon206.seq - Constructed sequence entries, part 206.
1132. gbcon207.seq - Constructed sequence entries, part 207.
1133. gbcon208.seq - Constructed sequence entries, part 208.
1134. gbcon209.seq - Constructed sequence entries, part 209.
1135. gbcon21.seq - Constructed sequence entries, part 21.
1136. gbcon210.seq - Constructed sequence entries, part 210.
1137. gbcon211.seq - Constructed sequence entries, part 211.
1138. gbcon212.seq - Constructed sequence entries, part 212.
1139. gbcon213.seq - Constructed sequence entries, part 213.
1140. gbcon214.seq - Constructed sequence entries, part 214.
1141. gbcon215.seq - Constructed sequence entries, part 215.
1142. gbcon216.seq - Constructed sequence entries, part 216.
1143. gbcon217.seq - Constructed sequence entries, part 217.
1144. gbcon218.seq - Constructed sequence entries, part 218.
1145. gbcon219.seq - Constructed sequence entries, part 219.
1146. gbcon22.seq - Constructed sequence entries, part 22.
1147. gbcon220.seq - Constructed sequence entries, part 220.
1148. gbcon221.seq - Constructed sequence entries, part 221.
1149. gbcon222.seq - Constructed sequence entries, part 222.
1150. gbcon223.seq - Constructed sequence entries, part 223.
1151. gbcon224.seq - Constructed sequence entries, part 224.
1152. gbcon225.seq - Constructed sequence entries, part 225.
1153. gbcon226.seq - Constructed sequence entries, part 226.
1154. gbcon227.seq - Constructed sequence entries, part 227.
1155. gbcon228.seq - Constructed sequence entries, part 228.
1156. gbcon229.seq - Constructed sequence entries, part 229.
1157. gbcon23.seq - Constructed sequence entries, part 23.
1158. gbcon230.seq - Constructed sequence entries, part 230.
1159. gbcon231.seq - Constructed sequence entries, part 231.
1160. gbcon232.seq - Constructed sequence entries, part 232.
1161. gbcon233.seq - Constructed sequence entries, part 233.
1162. gbcon234.seq - Constructed sequence entries, part 234.
1163. gbcon235.seq - Constructed sequence entries, part 235.
1164. gbcon236.seq - Constructed sequence entries, part 236.
1165. gbcon24.seq - Constructed sequence entries, part 24.
1166. gbcon25.seq - Constructed sequence entries, part 25.
1167. gbcon26.seq - Constructed sequence entries, part 26.
1168. gbcon27.seq - Constructed sequence entries, part 27.
1169. gbcon28.seq - Constructed sequence entries, part 28.
1170. gbcon29.seq - Constructed sequence entries, part 29.
1171. gbcon3.seq - Constructed sequence entries, part 3.
1172. gbcon30.seq - Constructed sequence entries, part 30.
1173. gbcon31.seq - Constructed sequence entries, part 31.
1174. gbcon32.seq - Constructed sequence entries, part 32.
1175. gbcon33.seq - Constructed sequence entries, part 33.
1176. gbcon34.seq - Constructed sequence entries, part 34.
1177. gbcon35.seq - Constructed sequence entries, part 35.
1178. gbcon36.seq - Constructed sequence entries, part 36.
1179. gbcon37.seq - Constructed sequence entries, part 37.
1180. gbcon38.seq - Constructed sequence entries, part 38.
1181. gbcon39.seq - Constructed sequence entries, part 39.
1182. gbcon4.seq - Constructed sequence entries, part 4.
1183. gbcon40.seq - Constructed sequence entries, part 40.
1184. gbcon41.seq - Constructed sequence entries, part 41.
1185. gbcon42.seq - Constructed sequence entries, part 42.
1186. gbcon43.seq - Constructed sequence entries, part 43.
1187. gbcon44.seq - Constructed sequence entries, part 44.
1188. gbcon45.seq - Constructed sequence entries, part 45.
1189. gbcon46.seq - Constructed sequence entries, part 46.
1190. gbcon47.seq - Constructed sequence entries, part 47.
1191. gbcon48.seq - Constructed sequence entries, part 48.
1192. gbcon49.seq - Constructed sequence entries, part 49.
1193. gbcon5.seq - Constructed sequence entries, part 5.
1194. gbcon50.seq - Constructed sequence entries, part 50.
1195. gbcon51.seq - Constructed sequence entries, part 51.
1196. gbcon52.seq - Constructed sequence entries, part 52.
1197. gbcon53.seq - Constructed sequence entries, part 53.
1198. gbcon54.seq - Constructed sequence entries, part 54.
1199. gbcon55.seq - Constructed sequence entries, part 55.
1200. gbcon56.seq - Constructed sequence entries, part 56.
1201. gbcon57.seq - Constructed sequence entries, part 57.
1202. gbcon58.seq - Constructed sequence entries, part 58.
1203. gbcon59.seq - Constructed sequence entries, part 59.
1204. gbcon6.seq - Constructed sequence entries, part 6.
1205. gbcon60.seq - Constructed sequence entries, part 60.
1206. gbcon61.seq - Constructed sequence entries, part 61.
1207. gbcon62.seq - Constructed sequence entries, part 62.
1208. gbcon63.seq - Constructed sequence entries, part 63.
1209. gbcon64.seq - Constructed sequence entries, part 64.
1210. gbcon65.seq - Constructed sequence entries, part 65.
1211. gbcon66.seq - Constructed sequence entries, part 66.
1212. gbcon67.seq - Constructed sequence entries, part 67.
1213. gbcon68.seq - Constructed sequence entries, part 68.
1214. gbcon69.seq - Constructed sequence entries, part 69.
1215. gbcon7.seq - Constructed sequence entries, part 7.
1216. gbcon70.seq - Constructed sequence entries, part 70.
1217. gbcon71.seq - Constructed sequence entries, part 71.
1218. gbcon72.seq - Constructed sequence entries, part 72.
1219. gbcon73.seq - Constructed sequence entries, part 73.
1220. gbcon74.seq - Constructed sequence entries, part 74.
1221. gbcon75.seq - Constructed sequence entries, part 75.
1222. gbcon76.seq - Constructed sequence entries, part 76.
1223. gbcon77.seq - Constructed sequence entries, part 77.
1224. gbcon78.seq - Constructed sequence entries, part 78.
1225. gbcon79.seq - Constructed sequence entries, part 79.
1226. gbcon8.seq - Constructed sequence entries, part 8.
1227. gbcon80.seq - Constructed sequence entries, part 80.
1228. gbcon81.seq - Constructed sequence entries, part 81.
1229. gbcon82.seq - Constructed sequence entries, part 82.
1230. gbcon83.seq - Constructed sequence entries, part 83.
1231. gbcon84.seq - Constructed sequence entries, part 84.
1232. gbcon85.seq - Constructed sequence entries, part 85.
1233. gbcon86.seq - Constructed sequence entries, part 86.
1234. gbcon87.seq - Constructed sequence entries, part 87.
1235. gbcon88.seq - Constructed sequence entries, part 88.
1236. gbcon89.seq - Constructed sequence entries, part 89.
1237. gbcon9.seq - Constructed sequence entries, part 9.
1238. gbcon90.seq - Constructed sequence entries, part 90.
1239. gbcon91.seq - Constructed sequence entries, part 91.
1240. gbcon92.seq - Constructed sequence entries, part 92.
1241. gbcon93.seq - Constructed sequence entries, part 93.
1242. gbcon94.seq - Constructed sequence entries, part 94.
1243. gbcon95.seq - Constructed sequence entries, part 95.
1244. gbcon96.seq - Constructed sequence entries, part 96.
1245. gbcon97.seq - Constructed sequence entries, part 97.
1246. gbcon98.seq - Constructed sequence entries, part 98.
1247. gbcon99.seq - Constructed sequence entries, part 99.
1248. gbdel.txt - Accession numbers of entries deleted since the previous release.
1249. gbenv1.seq - Environmental sampling sequence entries, part 1.
1250. gbenv10.seq - Environmental sampling sequence entries, part 10.
1251. gbenv11.seq - Environmental sampling sequence entries, part 11.
1252. gbenv12.seq - Environmental sampling sequence entries, part 12.
1253. gbenv13.seq - Environmental sampling sequence entries, part 13.
1254. gbenv14.seq - Environmental sampling sequence entries, part 14.
1255. gbenv15.seq - Environmental sampling sequence entries, part 15.
1256. gbenv16.seq - Environmental sampling sequence entries, part 16.
1257. gbenv17.seq - Environmental sampling sequence entries, part 17.
1258. gbenv18.seq - Environmental sampling sequence entries, part 18.
1259. gbenv19.seq - Environmental sampling sequence entries, part 19.
1260. gbenv2.seq - Environmental sampling sequence entries, part 2.
1261. gbenv20.seq - Environmental sampling sequence entries, part 20.
1262. gbenv21.seq - Environmental sampling sequence entries, part 21.
1263. gbenv22.seq - Environmental sampling sequence entries, part 22.
1264. gbenv23.seq - Environmental sampling sequence entries, part 23.
1265. gbenv24.seq - Environmental sampling sequence entries, part 24.
1266. gbenv25.seq - Environmental sampling sequence entries, part 25.
1267. gbenv26.seq - Environmental sampling sequence entries, part 26.
1268. gbenv27.seq - Environmental sampling sequence entries, part 27.
1269. gbenv28.seq - Environmental sampling sequence entries, part 28.
1270. gbenv29.seq - Environmental sampling sequence entries, part 29.
1271. gbenv3.seq - Environmental sampling sequence entries, part 3.
1272. gbenv30.seq - Environmental sampling sequence entries, part 30.
1273. gbenv31.seq - Environmental sampling sequence entries, part 31.
1274. gbenv32.seq - Environmental sampling sequence entries, part 32.
1275. gbenv33.seq - Environmental sampling sequence entries, part 33.
1276. gbenv34.seq - Environmental sampling sequence entries, part 34.
1277. gbenv35.seq - Environmental sampling sequence entries, part 35.
1278. gbenv36.seq - Environmental sampling sequence entries, part 36.
1279. gbenv37.seq - Environmental sampling sequence entries, part 37.
1280. gbenv38.seq - Environmental sampling sequence entries, part 38.
1281. gbenv39.seq - Environmental sampling sequence entries, part 39.
1282. gbenv4.seq - Environmental sampling sequence entries, part 4.
1283. gbenv40.seq - Environmental sampling sequence entries, part 40.
1284. gbenv41.seq - Environmental sampling sequence entries, part 41.
1285. gbenv42.seq - Environmental sampling sequence entries, part 42.
1286. gbenv43.seq - Environmental sampling sequence entries, part 43.
1287. gbenv44.seq - Environmental sampling sequence entries, part 44.
1288. gbenv45.seq - Environmental sampling sequence entries, part 45.
1289. gbenv46.seq - Environmental sampling sequence entries, part 46.
1290. gbenv47.seq - Environmental sampling sequence entries, part 47.
1291. gbenv48.seq - Environmental sampling sequence entries, part 48.
1292. gbenv49.seq - Environmental sampling sequence entries, part 49.
1293. gbenv5.seq - Environmental sampling sequence entries, part 5.
1294. gbenv50.seq - Environmental sampling sequence entries, part 50.
1295. gbenv51.seq - Environmental sampling sequence entries, part 51.
1296. gbenv52.seq - Environmental sampling sequence entries, part 52.
1297. gbenv53.seq - Environmental sampling sequence entries, part 53.
1298. gbenv54.seq - Environmental sampling sequence entries, part 54.
1299. gbenv55.seq - Environmental sampling sequence entries, part 55.
1300. gbenv56.seq - Environmental sampling sequence entries, part 56.
1301. gbenv57.seq - Environmental sampling sequence entries, part 57.
1302. gbenv58.seq - Environmental sampling sequence entries, part 58.
1303. gbenv59.seq - Environmental sampling sequence entries, part 59.
1304. gbenv6.seq - Environmental sampling sequence entries, part 6.
1305. gbenv60.seq - Environmental sampling sequence entries, part 60.
1306. gbenv61.seq - Environmental sampling sequence entries, part 61.
1307. gbenv62.seq - Environmental sampling sequence entries, part 62.
1308. gbenv63.seq - Environmental sampling sequence entries, part 63.
1309. gbenv64.seq - Environmental sampling sequence entries, part 64.
1310. gbenv65.seq - Environmental sampling sequence entries, part 65.
1311. gbenv66.seq - Environmental sampling sequence entries, part 66.
1312. gbenv67.seq - Environmental sampling sequence entries, part 67.
1313. gbenv68.seq - Environmental sampling sequence entries, part 68.
1314. gbenv69.seq - Environmental sampling sequence entries, part 69.
1315. gbenv7.seq - Environmental sampling sequence entries, part 7.
1316. gbenv70.seq - Environmental sampling sequence entries, part 70.
1317. gbenv71.seq - Environmental sampling sequence entries, part 71.
1318. gbenv72.seq - Environmental sampling sequence entries, part 72.
1319. gbenv73.seq - Environmental sampling sequence entries, part 73.
1320. gbenv74.seq - Environmental sampling sequence entries, part 74.
1321. gbenv75.seq - Environmental sampling sequence entries, part 75.
1322. gbenv76.seq - Environmental sampling sequence entries, part 76.
1323. gbenv77.seq - Environmental sampling sequence entries, part 77.
1324. gbenv78.seq - Environmental sampling sequence entries, part 78.
1325. gbenv79.seq - Environmental sampling sequence entries, part 79.
1326. gbenv8.seq - Environmental sampling sequence entries, part 8.
1327. gbenv9.seq - Environmental sampling sequence entries, part 9.
1328. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
1329. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
1330. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
1331. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
1332. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
1333. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
1334. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
1335. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
1336. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
1337. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
1338. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
1339. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
1340. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
1341. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
1342. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
1343. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
1344. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
1345. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
1346. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
1347. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
1348. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
1349. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
1350. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
1351. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
1352. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
1353. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
1354. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
1355. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
1356. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
1357. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
1358. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
1359. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
1360. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
1361. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
1362. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
1363. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
1364. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
1365. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
1366. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
1367. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
1368. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
1369. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
1370. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
1371. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
1372. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
1373. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
1374. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
1375. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
1376. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
1377. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
1378. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
1379. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
1380. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
1381. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
1382. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
1383. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
1384. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
1385. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
1386. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
1387. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
1388. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
1389. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
1390. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
1391. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
1392. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
1393. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
1394. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
1395. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
1396. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
1397. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
1398. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
1399. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
1400. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
1401. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
1402. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
1403. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
1404. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
1405. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
1406. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
1407. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
1408. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
1409. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
1410. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
1411. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
1412. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
1413. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
1414. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
1415. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
1416. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
1417. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
1418. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
1419. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
1420. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
1421. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
1422. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
1423. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
1424. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
1425. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
1426. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
1427. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
1428. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
1429. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
1430. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
1431. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
1432. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
1433. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
1434. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
1435. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
1436. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
1437. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
1438. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
1439. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
1440. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
1441. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
1442. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
1443. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
1444. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
1445. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
1446. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
1447. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
1448. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
1449. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
1450. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
1451. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
1452. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
1453. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
1454. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
1455. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
1456. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
1457. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
1458. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
1459. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
1460. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
1461. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
1462. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
1463. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
1464. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
1465. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
1466. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
1467. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
1468. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
1469. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
1470. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
1471. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
1472. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
1473. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
1474. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
1475. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
1476. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
1477. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
1478. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
1479. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
1480. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
1481. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
1482. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
1483. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
1484. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
1485. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
1486. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
1487. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
1488. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
1489. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
1490. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
1491. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
1492. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
1493. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
1494. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
1495. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
1496. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
1497. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
1498. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
1499. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
1500. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
1501. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
1502. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
1503. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
1504. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
1505. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
1506. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
1507. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
1508. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
1509. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
1510. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
1511. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
1512. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
1513. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
1514. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
1515. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
1516. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
1517. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
1518. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
1519. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
1520. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
1521. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
1522. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
1523. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
1524. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
1525. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
1526. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
1527. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
1528. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
1529. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
1530. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
1531. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
1532. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
1533. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
1534. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
1535. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
1536. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
1537. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
1538. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
1539. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
1540. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
1541. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
1542. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
1543. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
1544. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
1545. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
1546. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
1547. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
1548. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
1549. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
1550. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
1551. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
1552. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
1553. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
1554. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
1555. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1556. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1557. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1558. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1559. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1560. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1561. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1562. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1563. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1564. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1565. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1566. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1567. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1568. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1569. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1570. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1571. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1572. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1573. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1574. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1575. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1576. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1577. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1578. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1579. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1580. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1581. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1582. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1583. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1584. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1585. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1586. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1587. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1588. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1589. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1590. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1591. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1592. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1593. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1594. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1595. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1596. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1597. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1598. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1599. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1600. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1601. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1602. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1603. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1604. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1605. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1606. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1607. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1608. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1609. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1610. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1611. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1612. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1613. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1614. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1615. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1616. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1617. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1618. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1619. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1620. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1621. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1622. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1623. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1624. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1625. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1626. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1627. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1628. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1629. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1630. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1631. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1632. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1633. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1634. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1635. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1636. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1637. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1638. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1639. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1640. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1641. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1642. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1643. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1644. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1645. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1646. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1647. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1648. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1649. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1650. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1651. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1652. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1653. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1654. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1655. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1656. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1657. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1658. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1659. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1660. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1661. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1662. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1663. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1664. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1665. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1666. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1667. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1668. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1669. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1670. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1671. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1672. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1673. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1674. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1675. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1676. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1677. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1678. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1679. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1680. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1681. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1682. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1683. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1684. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1685. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1686. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1687. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1688. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1689. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1690. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1691. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1692. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1693. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1694. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1695. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1696. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1697. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1698. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1699. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1700. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1701. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1702. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1703. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1704. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1705. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1706. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1707. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1708. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1709. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1710. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1711. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1712. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1713. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1714. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1715. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1716. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1717. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1718. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1719. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1720. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1721. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1722. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1723. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1724. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1725. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1726. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1727. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1728. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1729. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1730. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1731. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1732. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1733. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1734. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1735. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1736. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1737. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1738. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1739. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1740. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1741. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1742. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1743. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1744. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1745. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1746. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1747. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1748. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1749. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1750. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1751. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1752. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1753. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1754. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1755. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
1756. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
1757. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
1758. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
1759. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
1760. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
1761. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1762. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
1763. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
1764. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
1765. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
1766. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
1767. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
1768. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
1769. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
1770. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
1771. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
1772. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1773. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1774. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
1775. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
1776. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
1777. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
1778. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
1779. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
1780. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
1781. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
1782. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
1783. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
1784. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1785. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
1786. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
1787. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
1788. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
1789. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
1790. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
1791. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
1792. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
1793. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
1794. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
1795. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1796. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
1797. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
1798. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
1799. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
1800. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
1801. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
1802. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
1803. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
1804. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
1805. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
1806. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1807. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
1808. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
1809. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
1810. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
1811. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
1812. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
1813. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
1814. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
1815. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
1816. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
1817. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1818. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
1819. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
1820. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
1821. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
1822. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
1823. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
1824. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
1825. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
1826. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
1827. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
1828. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1829. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
1830. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
1831. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
1832. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
1833. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
1834. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
1835. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
1836. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
1837. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
1838. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
1839. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1840. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
1841. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
1842. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
1843. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
1844. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
1845. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
1846. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
1847. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
1848. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
1849. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
1850. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1851. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
1852. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
1853. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
1854. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
1855. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
1856. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
1857. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
1858. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
1859. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
1860. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1861. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1862. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1863. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1864. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1865. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1866. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1867. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1868. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1869. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1870. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1871. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1872. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1873. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1874. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1875. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1876. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1877. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1878. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1879. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1880. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1881. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1882. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1883. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1884. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1885. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1886. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1887. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1888. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1889. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1890. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1891. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1892. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1893. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1894. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1895. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1896. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1897. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1898. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1899. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1900. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1901. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1902. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1903. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1904. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1905. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1906. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1907. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1908. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1909. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1910. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1911. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1912. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1913. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1914. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1915. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1916. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1917. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1918. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1919. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1920. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1921. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1922. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1923. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1924. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1925. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1926. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1927. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1928. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1929. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1930. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1931. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1932. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1933. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1934. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1935. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1936. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1937. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1938. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1939. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1940. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1941. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1942. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1943. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1944. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1945. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1946. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1947. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1948. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1949. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1950. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1951. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1952. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1953. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1954. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1955. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1956. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1957. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1958. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1959. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1960. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1961. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1962. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1963. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1964. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1965. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1966. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1967. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1968. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1969. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1970. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1971. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1972. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1973. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1974. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1975. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1976. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1977. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1978. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1979. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1980. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1981. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1982. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1983. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1984. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1985. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1986. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1987. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1988. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1989. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1990. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1991. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1992. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1993. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1994. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1995. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1996. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1997. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1998. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1999. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
2000. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
2001. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
2002. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
2003. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
2004. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
2005. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
2006. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
2007. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
2008. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
2009. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
2010. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
2011. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
2012. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
2013. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
2014. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
2015. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
2016. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
2017. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
2018. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
2019. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
2020. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
2021. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
2022. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
2023. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
2024. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
2025. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
2026. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
2027. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
2028. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
2029. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
2030. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
2031. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
2032. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
2033. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
2034. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
2035. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
2036. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
2037. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
2038. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
2039. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
2040. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
2041. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
2042. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
2043. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
2044. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
2045. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
2046. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
2047. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
2048. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
2049. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
2050. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
2051. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
2052. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
2053. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
2054. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
2055. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
2056. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
2057. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
2058. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
2059. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
2060. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
2061. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
2062. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
2063. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
2064. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
2065. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
2066. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
2067. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
2068. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
2069. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
2070. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
2071. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
2072. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
2073. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
2074. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
2075. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
2076. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
2077. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
2078. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
2079. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
2080. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
2081. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
2082. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
2083. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
2084. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
2085. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
2086. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
2087. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
2088. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
2089. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
2090. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
2091. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
2092. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
2093. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
2094. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
2095. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
2096. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
2097. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
2098. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
2099. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
2100. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
2101. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
2102. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
2103. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
2104. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
2105. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
2106. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
2107. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
2108. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
2109. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
2110. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
2111. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
2112. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
2113. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
2114. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
2115. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
2116. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
2117. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
2118. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
2119. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
2120. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
2121. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
2122. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
2123. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
2124. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
2125. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
2126. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
2127. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
2128. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
2129. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
2130. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
2131. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
2132. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
2133. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
2134. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
2135. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
2136. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
2137. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
2138. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
2139. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
2140. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
2141. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
2142. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
2143. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
2144. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
2145. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
2146. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
2147. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
2148. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
2149. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
2150. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
2151. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
2152. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
2153. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
2154. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
2155. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
2156. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
2157. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
2158. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
2159. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
2160. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
2161. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
2162. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
2163. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
2164. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
2165. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
2166. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
2167. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
2168. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
2169. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
2170. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
2171. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
2172. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
2173. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
2174. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
2175. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
2176. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
2177. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
2178. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
2179. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
2180. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
2181. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
2182. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
2183. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
2184. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
2185. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
2186. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
2187. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
2188. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
2189. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
2190. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
2191. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
2192. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
2193. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
2194. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
2195. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
2196. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
2197. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
2198. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
2199. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
2200. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
2201. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
2202. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
2203. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
2204. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
2205. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
2206. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
2207. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
2208. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
2209. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
2210. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
2211. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
2212. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
2213. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
2214. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
2215. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
2216. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
2217. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
2218. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
2219. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
2220. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
2221. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
2222. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
2223. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
2224. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
2225. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
2226. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
2227. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
2228. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
2229. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
2230. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
2231. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
2232. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
2233. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
2234. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
2235. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
2236. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
2237. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
2238. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
2239. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
2240. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
2241. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
2242. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
2243. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
2244. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
2245. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
2246. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
2247. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
2248. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
2249. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
2250. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
2251. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
2252. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
2253. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
2254. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
2255. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
2256. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
2257. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
2258. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
2259. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
2260. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
2261. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
2262. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
2263. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
2264. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
2265. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
2266. gbinv1.seq - Invertebrate sequence entries, part 1.
2267. gbinv10.seq - Invertebrate sequence entries, part 10.
2268. gbinv100.seq - Invertebrate sequence entries, part 100.
2269. gbinv1000.seq - Invertebrate sequence entries, part 1000.
2270. gbinv1001.seq - Invertebrate sequence entries, part 1001.
2271. gbinv1002.seq - Invertebrate sequence entries, part 1002.
2272. gbinv1003.seq - Invertebrate sequence entries, part 1003.
2273. gbinv1004.seq - Invertebrate sequence entries, part 1004.
2274. gbinv1005.seq - Invertebrate sequence entries, part 1005.
2275. gbinv1006.seq - Invertebrate sequence entries, part 1006.
2276. gbinv1007.seq - Invertebrate sequence entries, part 1007.
2277. gbinv1008.seq - Invertebrate sequence entries, part 1008.
2278. gbinv1009.seq - Invertebrate sequence entries, part 1009.
2279. gbinv101.seq - Invertebrate sequence entries, part 101.
2280. gbinv1010.seq - Invertebrate sequence entries, part 1010.
2281. gbinv1011.seq - Invertebrate sequence entries, part 1011.
2282. gbinv1012.seq - Invertebrate sequence entries, part 1012.
2283. gbinv1013.seq - Invertebrate sequence entries, part 1013.
2284. gbinv1014.seq - Invertebrate sequence entries, part 1014.
2285. gbinv1015.seq - Invertebrate sequence entries, part 1015.
2286. gbinv1016.seq - Invertebrate sequence entries, part 1016.
2287. gbinv1017.seq - Invertebrate sequence entries, part 1017.
2288. gbinv1018.seq - Invertebrate sequence entries, part 1018.
2289. gbinv1019.seq - Invertebrate sequence entries, part 1019.
2290. gbinv102.seq - Invertebrate sequence entries, part 102.
2291. gbinv1020.seq - Invertebrate sequence entries, part 1020.
2292. gbinv1021.seq - Invertebrate sequence entries, part 1021.
2293. gbinv1022.seq - Invertebrate sequence entries, part 1022.
2294. gbinv1023.seq - Invertebrate sequence entries, part 1023.
2295. gbinv1024.seq - Invertebrate sequence entries, part 1024.
2296. gbinv1025.seq - Invertebrate sequence entries, part 1025.
2297. gbinv1026.seq - Invertebrate sequence entries, part 1026.
2298. gbinv1027.seq - Invertebrate sequence entries, part 1027.
2299. gbinv1028.seq - Invertebrate sequence entries, part 1028.
2300. gbinv1029.seq - Invertebrate sequence entries, part 1029.
2301. gbinv103.seq - Invertebrate sequence entries, part 103.
2302. gbinv1030.seq - Invertebrate sequence entries, part 1030.
2303. gbinv1031.seq - Invertebrate sequence entries, part 1031.
2304. gbinv1032.seq - Invertebrate sequence entries, part 1032.
2305. gbinv1033.seq - Invertebrate sequence entries, part 1033.
2306. gbinv1034.seq - Invertebrate sequence entries, part 1034.
2307. gbinv1035.seq - Invertebrate sequence entries, part 1035.
2308. gbinv1036.seq - Invertebrate sequence entries, part 1036.
2309. gbinv1037.seq - Invertebrate sequence entries, part 1037.
2310. gbinv1038.seq - Invertebrate sequence entries, part 1038.
2311. gbinv1039.seq - Invertebrate sequence entries, part 1039.
2312. gbinv104.seq - Invertebrate sequence entries, part 104.
2313. gbinv1040.seq - Invertebrate sequence entries, part 1040.
2314. gbinv1041.seq - Invertebrate sequence entries, part 1041.
2315. gbinv1042.seq - Invertebrate sequence entries, part 1042.
2316. gbinv1043.seq - Invertebrate sequence entries, part 1043.
2317. gbinv1044.seq - Invertebrate sequence entries, part 1044.
2318. gbinv1045.seq - Invertebrate sequence entries, part 1045.
2319. gbinv1046.seq - Invertebrate sequence entries, part 1046.
2320. gbinv1047.seq - Invertebrate sequence entries, part 1047.
2321. gbinv1048.seq - Invertebrate sequence entries, part 1048.
2322. gbinv1049.seq - Invertebrate sequence entries, part 1049.
2323. gbinv105.seq - Invertebrate sequence entries, part 105.
2324. gbinv1050.seq - Invertebrate sequence entries, part 1050.
2325. gbinv1051.seq - Invertebrate sequence entries, part 1051.
2326. gbinv1052.seq - Invertebrate sequence entries, part 1052.
2327. gbinv1053.seq - Invertebrate sequence entries, part 1053.
2328. gbinv1054.seq - Invertebrate sequence entries, part 1054.
2329. gbinv1055.seq - Invertebrate sequence entries, part 1055.
2330. gbinv1056.seq - Invertebrate sequence entries, part 1056.
2331. gbinv1057.seq - Invertebrate sequence entries, part 1057.
2332. gbinv1058.seq - Invertebrate sequence entries, part 1058.
2333. gbinv1059.seq - Invertebrate sequence entries, part 1059.
2334. gbinv106.seq - Invertebrate sequence entries, part 106.
2335. gbinv1060.seq - Invertebrate sequence entries, part 1060.
2336. gbinv1061.seq - Invertebrate sequence entries, part 1061.
2337. gbinv1062.seq - Invertebrate sequence entries, part 1062.
2338. gbinv1063.seq - Invertebrate sequence entries, part 1063.
2339. gbinv1064.seq - Invertebrate sequence entries, part 1064.
2340. gbinv1065.seq - Invertebrate sequence entries, part 1065.
2341. gbinv1066.seq - Invertebrate sequence entries, part 1066.
2342. gbinv1067.seq - Invertebrate sequence entries, part 1067.
2343. gbinv1068.seq - Invertebrate sequence entries, part 1068.
2344. gbinv1069.seq - Invertebrate sequence entries, part 1069.
2345. gbinv107.seq - Invertebrate sequence entries, part 107.
2346. gbinv1070.seq - Invertebrate sequence entries, part 1070.
2347. gbinv1071.seq - Invertebrate sequence entries, part 1071.
2348. gbinv1072.seq - Invertebrate sequence entries, part 1072.
2349. gbinv1073.seq - Invertebrate sequence entries, part 1073.
2350. gbinv1074.seq - Invertebrate sequence entries, part 1074.
2351. gbinv1075.seq - Invertebrate sequence entries, part 1075.
2352. gbinv1076.seq - Invertebrate sequence entries, part 1076.
2353. gbinv1077.seq - Invertebrate sequence entries, part 1077.
2354. gbinv1078.seq - Invertebrate sequence entries, part 1078.
2355. gbinv1079.seq - Invertebrate sequence entries, part 1079.
2356. gbinv108.seq - Invertebrate sequence entries, part 108.
2357. gbinv1080.seq - Invertebrate sequence entries, part 1080.
2358. gbinv1081.seq - Invertebrate sequence entries, part 1081.
2359. gbinv1082.seq - Invertebrate sequence entries, part 1082.
2360. gbinv1083.seq - Invertebrate sequence entries, part 1083.
2361. gbinv1084.seq - Invertebrate sequence entries, part 1084.
2362. gbinv1085.seq - Invertebrate sequence entries, part 1085.
2363. gbinv1086.seq - Invertebrate sequence entries, part 1086.
2364. gbinv1087.seq - Invertebrate sequence entries, part 1087.
2365. gbinv1088.seq - Invertebrate sequence entries, part 1088.
2366. gbinv1089.seq - Invertebrate sequence entries, part 1089.
2367. gbinv109.seq - Invertebrate sequence entries, part 109.
2368. gbinv1090.seq - Invertebrate sequence entries, part 1090.
2369. gbinv1091.seq - Invertebrate sequence entries, part 1091.
2370. gbinv1092.seq - Invertebrate sequence entries, part 1092.
2371. gbinv1093.seq - Invertebrate sequence entries, part 1093.
2372. gbinv1094.seq - Invertebrate sequence entries, part 1094.
2373. gbinv1095.seq - Invertebrate sequence entries, part 1095.
2374. gbinv1096.seq - Invertebrate sequence entries, part 1096.
2375. gbinv1097.seq - Invertebrate sequence entries, part 1097.
2376. gbinv1098.seq - Invertebrate sequence entries, part 1098.
2377. gbinv1099.seq - Invertebrate sequence entries, part 1099.
2378. gbinv11.seq - Invertebrate sequence entries, part 11.
2379. gbinv110.seq - Invertebrate sequence entries, part 110.
2380. gbinv1100.seq - Invertebrate sequence entries, part 1100.
2381. gbinv1101.seq - Invertebrate sequence entries, part 1101.
2382. gbinv1102.seq - Invertebrate sequence entries, part 1102.
2383. gbinv1103.seq - Invertebrate sequence entries, part 1103.
2384. gbinv1104.seq - Invertebrate sequence entries, part 1104.
2385. gbinv1105.seq - Invertebrate sequence entries, part 1105.
2386. gbinv1106.seq - Invertebrate sequence entries, part 1106.
2387. gbinv1107.seq - Invertebrate sequence entries, part 1107.
2388. gbinv1108.seq - Invertebrate sequence entries, part 1108.
2389. gbinv1109.seq - Invertebrate sequence entries, part 1109.
2390. gbinv111.seq - Invertebrate sequence entries, part 111.
2391. gbinv1110.seq - Invertebrate sequence entries, part 1110.
2392. gbinv1111.seq - Invertebrate sequence entries, part 1111.
2393. gbinv1112.seq - Invertebrate sequence entries, part 1112.
2394. gbinv1113.seq - Invertebrate sequence entries, part 1113.
2395. gbinv1114.seq - Invertebrate sequence entries, part 1114.
2396. gbinv1115.seq - Invertebrate sequence entries, part 1115.
2397. gbinv1116.seq - Invertebrate sequence entries, part 1116.
2398. gbinv1117.seq - Invertebrate sequence entries, part 1117.
2399. gbinv1118.seq - Invertebrate sequence entries, part 1118.
2400. gbinv1119.seq - Invertebrate sequence entries, part 1119.
2401. gbinv112.seq - Invertebrate sequence entries, part 112.
2402. gbinv1120.seq - Invertebrate sequence entries, part 1120.
2403. gbinv1121.seq - Invertebrate sequence entries, part 1121.
2404. gbinv1122.seq - Invertebrate sequence entries, part 1122.
2405. gbinv1123.seq - Invertebrate sequence entries, part 1123.
2406. gbinv1124.seq - Invertebrate sequence entries, part 1124.
2407. gbinv1125.seq - Invertebrate sequence entries, part 1125.
2408. gbinv1126.seq - Invertebrate sequence entries, part 1126.
2409. gbinv1127.seq - Invertebrate sequence entries, part 1127.
2410. gbinv1128.seq - Invertebrate sequence entries, part 1128.
2411. gbinv1129.seq - Invertebrate sequence entries, part 1129.
2412. gbinv113.seq - Invertebrate sequence entries, part 113.
2413. gbinv1130.seq - Invertebrate sequence entries, part 1130.
2414. gbinv1131.seq - Invertebrate sequence entries, part 1131.
2415. gbinv1132.seq - Invertebrate sequence entries, part 1132.
2416. gbinv1133.seq - Invertebrate sequence entries, part 1133.
2417. gbinv1134.seq - Invertebrate sequence entries, part 1134.
2418. gbinv1135.seq - Invertebrate sequence entries, part 1135.
2419. gbinv1136.seq - Invertebrate sequence entries, part 1136.
2420. gbinv1137.seq - Invertebrate sequence entries, part 1137.
2421. gbinv1138.seq - Invertebrate sequence entries, part 1138.
2422. gbinv1139.seq - Invertebrate sequence entries, part 1139.
2423. gbinv114.seq - Invertebrate sequence entries, part 114.
2424. gbinv1140.seq - Invertebrate sequence entries, part 1140.
2425. gbinv1141.seq - Invertebrate sequence entries, part 1141.
2426. gbinv1142.seq - Invertebrate sequence entries, part 1142.
2427. gbinv1143.seq - Invertebrate sequence entries, part 1143.
2428. gbinv1144.seq - Invertebrate sequence entries, part 1144.
2429. gbinv1145.seq - Invertebrate sequence entries, part 1145.
2430. gbinv1146.seq - Invertebrate sequence entries, part 1146.
2431. gbinv1147.seq - Invertebrate sequence entries, part 1147.
2432. gbinv1148.seq - Invertebrate sequence entries, part 1148.
2433. gbinv1149.seq - Invertebrate sequence entries, part 1149.
2434. gbinv115.seq - Invertebrate sequence entries, part 115.
2435. gbinv1150.seq - Invertebrate sequence entries, part 1150.
2436. gbinv1151.seq - Invertebrate sequence entries, part 1151.
2437. gbinv1152.seq - Invertebrate sequence entries, part 1152.
2438. gbinv1153.seq - Invertebrate sequence entries, part 1153.
2439. gbinv1154.seq - Invertebrate sequence entries, part 1154.
2440. gbinv1155.seq - Invertebrate sequence entries, part 1155.
2441. gbinv1156.seq - Invertebrate sequence entries, part 1156.
2442. gbinv1157.seq - Invertebrate sequence entries, part 1157.
2443. gbinv1158.seq - Invertebrate sequence entries, part 1158.
2444. gbinv1159.seq - Invertebrate sequence entries, part 1159.
2445. gbinv116.seq - Invertebrate sequence entries, part 116.
2446. gbinv1160.seq - Invertebrate sequence entries, part 1160.
2447. gbinv1161.seq - Invertebrate sequence entries, part 1161.
2448. gbinv1162.seq - Invertebrate sequence entries, part 1162.
2449. gbinv1163.seq - Invertebrate sequence entries, part 1163.
2450. gbinv1164.seq - Invertebrate sequence entries, part 1164.
2451. gbinv1165.seq - Invertebrate sequence entries, part 1165.
2452. gbinv1166.seq - Invertebrate sequence entries, part 1166.
2453. gbinv1167.seq - Invertebrate sequence entries, part 1167.
2454. gbinv1168.seq - Invertebrate sequence entries, part 1168.
2455. gbinv1169.seq - Invertebrate sequence entries, part 1169.
2456. gbinv117.seq - Invertebrate sequence entries, part 117.
2457. gbinv1170.seq - Invertebrate sequence entries, part 1170.
2458. gbinv1171.seq - Invertebrate sequence entries, part 1171.
2459. gbinv1172.seq - Invertebrate sequence entries, part 1172.
2460. gbinv1173.seq - Invertebrate sequence entries, part 1173.
2461. gbinv1174.seq - Invertebrate sequence entries, part 1174.
2462. gbinv1175.seq - Invertebrate sequence entries, part 1175.
2463. gbinv1176.seq - Invertebrate sequence entries, part 1176.
2464. gbinv1177.seq - Invertebrate sequence entries, part 1177.
2465. gbinv1178.seq - Invertebrate sequence entries, part 1178.
2466. gbinv1179.seq - Invertebrate sequence entries, part 1179.
2467. gbinv118.seq - Invertebrate sequence entries, part 118.
2468. gbinv1180.seq - Invertebrate sequence entries, part 1180.
2469. gbinv1181.seq - Invertebrate sequence entries, part 1181.
2470. gbinv1182.seq - Invertebrate sequence entries, part 1182.
2471. gbinv1183.seq - Invertebrate sequence entries, part 1183.
2472. gbinv1184.seq - Invertebrate sequence entries, part 1184.
2473. gbinv1185.seq - Invertebrate sequence entries, part 1185.
2474. gbinv1186.seq - Invertebrate sequence entries, part 1186.
2475. gbinv1187.seq - Invertebrate sequence entries, part 1187.
2476. gbinv1188.seq - Invertebrate sequence entries, part 1188.
2477. gbinv1189.seq - Invertebrate sequence entries, part 1189.
2478. gbinv119.seq - Invertebrate sequence entries, part 119.
2479. gbinv1190.seq - Invertebrate sequence entries, part 1190.
2480. gbinv1191.seq - Invertebrate sequence entries, part 1191.
2481. gbinv1192.seq - Invertebrate sequence entries, part 1192.
2482. gbinv1193.seq - Invertebrate sequence entries, part 1193.
2483. gbinv1194.seq - Invertebrate sequence entries, part 1194.
2484. gbinv1195.seq - Invertebrate sequence entries, part 1195.
2485. gbinv1196.seq - Invertebrate sequence entries, part 1196.
2486. gbinv1197.seq - Invertebrate sequence entries, part 1197.
2487. gbinv1198.seq - Invertebrate sequence entries, part 1198.
2488. gbinv1199.seq - Invertebrate sequence entries, part 1199.
2489. gbinv12.seq - Invertebrate sequence entries, part 12.
2490. gbinv120.seq - Invertebrate sequence entries, part 120.
2491. gbinv1200.seq - Invertebrate sequence entries, part 1200.
2492. gbinv1201.seq - Invertebrate sequence entries, part 1201.
2493. gbinv1202.seq - Invertebrate sequence entries, part 1202.
2494. gbinv1203.seq - Invertebrate sequence entries, part 1203.
2495. gbinv1204.seq - Invertebrate sequence entries, part 1204.
2496. gbinv1205.seq - Invertebrate sequence entries, part 1205.
2497. gbinv1206.seq - Invertebrate sequence entries, part 1206.
2498. gbinv1207.seq - Invertebrate sequence entries, part 1207.
2499. gbinv1208.seq - Invertebrate sequence entries, part 1208.
2500. gbinv1209.seq - Invertebrate sequence entries, part 1209.
2501. gbinv121.seq - Invertebrate sequence entries, part 121.
2502. gbinv1210.seq - Invertebrate sequence entries, part 1210.
2503. gbinv1211.seq - Invertebrate sequence entries, part 1211.
2504. gbinv1212.seq - Invertebrate sequence entries, part 1212.
2505. gbinv1213.seq - Invertebrate sequence entries, part 1213.
2506. gbinv1214.seq - Invertebrate sequence entries, part 1214.
2507. gbinv1215.seq - Invertebrate sequence entries, part 1215.
2508. gbinv1216.seq - Invertebrate sequence entries, part 1216.
2509. gbinv1217.seq - Invertebrate sequence entries, part 1217.
2510. gbinv1218.seq - Invertebrate sequence entries, part 1218.
2511. gbinv1219.seq - Invertebrate sequence entries, part 1219.
2512. gbinv122.seq - Invertebrate sequence entries, part 122.
2513. gbinv1220.seq - Invertebrate sequence entries, part 1220.
2514. gbinv1221.seq - Invertebrate sequence entries, part 1221.
2515. gbinv1222.seq - Invertebrate sequence entries, part 1222.
2516. gbinv1223.seq - Invertebrate sequence entries, part 1223.
2517. gbinv1224.seq - Invertebrate sequence entries, part 1224.
2518. gbinv1225.seq - Invertebrate sequence entries, part 1225.
2519. gbinv1226.seq - Invertebrate sequence entries, part 1226.
2520. gbinv1227.seq - Invertebrate sequence entries, part 1227.
2521. gbinv1228.seq - Invertebrate sequence entries, part 1228.
2522. gbinv1229.seq - Invertebrate sequence entries, part 1229.
2523. gbinv123.seq - Invertebrate sequence entries, part 123.
2524. gbinv1230.seq - Invertebrate sequence entries, part 1230.
2525. gbinv1231.seq - Invertebrate sequence entries, part 1231.
2526. gbinv1232.seq - Invertebrate sequence entries, part 1232.
2527. gbinv1233.seq - Invertebrate sequence entries, part 1233.
2528. gbinv1234.seq - Invertebrate sequence entries, part 1234.
2529. gbinv1235.seq - Invertebrate sequence entries, part 1235.
2530. gbinv1236.seq - Invertebrate sequence entries, part 1236.
2531. gbinv1237.seq - Invertebrate sequence entries, part 1237.
2532. gbinv1238.seq - Invertebrate sequence entries, part 1238.
2533. gbinv1239.seq - Invertebrate sequence entries, part 1239.
2534. gbinv124.seq - Invertebrate sequence entries, part 124.
2535. gbinv1240.seq - Invertebrate sequence entries, part 1240.
2536. gbinv1241.seq - Invertebrate sequence entries, part 1241.
2537. gbinv1242.seq - Invertebrate sequence entries, part 1242.
2538. gbinv1243.seq - Invertebrate sequence entries, part 1243.
2539. gbinv1244.seq - Invertebrate sequence entries, part 1244.
2540. gbinv1245.seq - Invertebrate sequence entries, part 1245.
2541. gbinv1246.seq - Invertebrate sequence entries, part 1246.
2542. gbinv1247.seq - Invertebrate sequence entries, part 1247.
2543. gbinv1248.seq - Invertebrate sequence entries, part 1248.
2544. gbinv1249.seq - Invertebrate sequence entries, part 1249.
2545. gbinv125.seq - Invertebrate sequence entries, part 125.
2546. gbinv1250.seq - Invertebrate sequence entries, part 1250.
2547. gbinv1251.seq - Invertebrate sequence entries, part 1251.
2548. gbinv1252.seq - Invertebrate sequence entries, part 1252.
2549. gbinv1253.seq - Invertebrate sequence entries, part 1253.
2550. gbinv1254.seq - Invertebrate sequence entries, part 1254.
2551. gbinv1255.seq - Invertebrate sequence entries, part 1255.
2552. gbinv1256.seq - Invertebrate sequence entries, part 1256.
2553. gbinv1257.seq - Invertebrate sequence entries, part 1257.
2554. gbinv1258.seq - Invertebrate sequence entries, part 1258.
2555. gbinv1259.seq - Invertebrate sequence entries, part 1259.
2556. gbinv126.seq - Invertebrate sequence entries, part 126.
2557. gbinv1260.seq - Invertebrate sequence entries, part 1260.
2558. gbinv1261.seq - Invertebrate sequence entries, part 1261.
2559. gbinv1262.seq - Invertebrate sequence entries, part 1262.
2560. gbinv1263.seq - Invertebrate sequence entries, part 1263.
2561. gbinv1264.seq - Invertebrate sequence entries, part 1264.
2562. gbinv1265.seq - Invertebrate sequence entries, part 1265.
2563. gbinv1266.seq - Invertebrate sequence entries, part 1266.
2564. gbinv1267.seq - Invertebrate sequence entries, part 1267.
2565. gbinv1268.seq - Invertebrate sequence entries, part 1268.
2566. gbinv1269.seq - Invertebrate sequence entries, part 1269.
2567. gbinv127.seq - Invertebrate sequence entries, part 127.
2568. gbinv1270.seq - Invertebrate sequence entries, part 1270.
2569. gbinv1271.seq - Invertebrate sequence entries, part 1271.
2570. gbinv1272.seq - Invertebrate sequence entries, part 1272.
2571. gbinv1273.seq - Invertebrate sequence entries, part 1273.
2572. gbinv1274.seq - Invertebrate sequence entries, part 1274.
2573. gbinv1275.seq - Invertebrate sequence entries, part 1275.
2574. gbinv1276.seq - Invertebrate sequence entries, part 1276.
2575. gbinv1277.seq - Invertebrate sequence entries, part 1277.
2576. gbinv1278.seq - Invertebrate sequence entries, part 1278.
2577. gbinv1279.seq - Invertebrate sequence entries, part 1279.
2578. gbinv128.seq - Invertebrate sequence entries, part 128.
2579. gbinv1280.seq - Invertebrate sequence entries, part 1280.
2580. gbinv1281.seq - Invertebrate sequence entries, part 1281.
2581. gbinv1282.seq - Invertebrate sequence entries, part 1282.
2582. gbinv1283.seq - Invertebrate sequence entries, part 1283.
2583. gbinv1284.seq - Invertebrate sequence entries, part 1284.
2584. gbinv1285.seq - Invertebrate sequence entries, part 1285.
2585. gbinv1286.seq - Invertebrate sequence entries, part 1286.
2586. gbinv1287.seq - Invertebrate sequence entries, part 1287.
2587. gbinv1288.seq - Invertebrate sequence entries, part 1288.
2588. gbinv1289.seq - Invertebrate sequence entries, part 1289.
2589. gbinv129.seq - Invertebrate sequence entries, part 129.
2590. gbinv1290.seq - Invertebrate sequence entries, part 1290.
2591. gbinv1291.seq - Invertebrate sequence entries, part 1291.
2592. gbinv1292.seq - Invertebrate sequence entries, part 1292.
2593. gbinv1293.seq - Invertebrate sequence entries, part 1293.
2594. gbinv1294.seq - Invertebrate sequence entries, part 1294.
2595. gbinv1295.seq - Invertebrate sequence entries, part 1295.
2596. gbinv1296.seq - Invertebrate sequence entries, part 1296.
2597. gbinv1297.seq - Invertebrate sequence entries, part 1297.
2598. gbinv1298.seq - Invertebrate sequence entries, part 1298.
2599. gbinv1299.seq - Invertebrate sequence entries, part 1299.
2600. gbinv13.seq - Invertebrate sequence entries, part 13.
2601. gbinv130.seq - Invertebrate sequence entries, part 130.
2602. gbinv1300.seq - Invertebrate sequence entries, part 1300.
2603. gbinv1301.seq - Invertebrate sequence entries, part 1301.
2604. gbinv1302.seq - Invertebrate sequence entries, part 1302.
2605. gbinv1303.seq - Invertebrate sequence entries, part 1303.
2606. gbinv1304.seq - Invertebrate sequence entries, part 1304.
2607. gbinv1305.seq - Invertebrate sequence entries, part 1305.
2608. gbinv1306.seq - Invertebrate sequence entries, part 1306.
2609. gbinv1307.seq - Invertebrate sequence entries, part 1307.
2610. gbinv1308.seq - Invertebrate sequence entries, part 1308.
2611. gbinv1309.seq - Invertebrate sequence entries, part 1309.
2612. gbinv131.seq - Invertebrate sequence entries, part 131.
2613. gbinv1310.seq - Invertebrate sequence entries, part 1310.
2614. gbinv1311.seq - Invertebrate sequence entries, part 1311.
2615. gbinv1312.seq - Invertebrate sequence entries, part 1312.
2616. gbinv1313.seq - Invertebrate sequence entries, part 1313.
2617. gbinv1314.seq - Invertebrate sequence entries, part 1314.
2618. gbinv1315.seq - Invertebrate sequence entries, part 1315.
2619. gbinv1316.seq - Invertebrate sequence entries, part 1316.
2620. gbinv1317.seq - Invertebrate sequence entries, part 1317.
2621. gbinv1318.seq - Invertebrate sequence entries, part 1318.
2622. gbinv1319.seq - Invertebrate sequence entries, part 1319.
2623. gbinv132.seq - Invertebrate sequence entries, part 132.
2624. gbinv1320.seq - Invertebrate sequence entries, part 1320.
2625. gbinv1321.seq - Invertebrate sequence entries, part 1321.
2626. gbinv1322.seq - Invertebrate sequence entries, part 1322.
2627. gbinv1323.seq - Invertebrate sequence entries, part 1323.
2628. gbinv1324.seq - Invertebrate sequence entries, part 1324.
2629. gbinv1325.seq - Invertebrate sequence entries, part 1325.
2630. gbinv1326.seq - Invertebrate sequence entries, part 1326.
2631. gbinv1327.seq - Invertebrate sequence entries, part 1327.
2632. gbinv1328.seq - Invertebrate sequence entries, part 1328.
2633. gbinv1329.seq - Invertebrate sequence entries, part 1329.
2634. gbinv133.seq - Invertebrate sequence entries, part 133.
2635. gbinv1330.seq - Invertebrate sequence entries, part 1330.
2636. gbinv1331.seq - Invertebrate sequence entries, part 1331.
2637. gbinv1332.seq - Invertebrate sequence entries, part 1332.
2638. gbinv1333.seq - Invertebrate sequence entries, part 1333.
2639. gbinv1334.seq - Invertebrate sequence entries, part 1334.
2640. gbinv1335.seq - Invertebrate sequence entries, part 1335.
2641. gbinv1336.seq - Invertebrate sequence entries, part 1336.
2642. gbinv1337.seq - Invertebrate sequence entries, part 1337.
2643. gbinv1338.seq - Invertebrate sequence entries, part 1338.
2644. gbinv1339.seq - Invertebrate sequence entries, part 1339.
2645. gbinv134.seq - Invertebrate sequence entries, part 134.
2646. gbinv1340.seq - Invertebrate sequence entries, part 1340.
2647. gbinv1341.seq - Invertebrate sequence entries, part 1341.
2648. gbinv1342.seq - Invertebrate sequence entries, part 1342.
2649. gbinv1343.seq - Invertebrate sequence entries, part 1343.
2650. gbinv1344.seq - Invertebrate sequence entries, part 1344.
2651. gbinv1345.seq - Invertebrate sequence entries, part 1345.
2652. gbinv1346.seq - Invertebrate sequence entries, part 1346.
2653. gbinv1347.seq - Invertebrate sequence entries, part 1347.
2654. gbinv1348.seq - Invertebrate sequence entries, part 1348.
2655. gbinv1349.seq - Invertebrate sequence entries, part 1349.
2656. gbinv135.seq - Invertebrate sequence entries, part 135.
2657. gbinv1350.seq - Invertebrate sequence entries, part 1350.
2658. gbinv1351.seq - Invertebrate sequence entries, part 1351.
2659. gbinv1352.seq - Invertebrate sequence entries, part 1352.
2660. gbinv1353.seq - Invertebrate sequence entries, part 1353.
2661. gbinv1354.seq - Invertebrate sequence entries, part 1354.
2662. gbinv1355.seq - Invertebrate sequence entries, part 1355.
2663. gbinv1356.seq - Invertebrate sequence entries, part 1356.
2664. gbinv1357.seq - Invertebrate sequence entries, part 1357.
2665. gbinv1358.seq - Invertebrate sequence entries, part 1358.
2666. gbinv1359.seq - Invertebrate sequence entries, part 1359.
2667. gbinv136.seq - Invertebrate sequence entries, part 136.
2668. gbinv1360.seq - Invertebrate sequence entries, part 1360.
2669. gbinv1361.seq - Invertebrate sequence entries, part 1361.
2670. gbinv1362.seq - Invertebrate sequence entries, part 1362.
2671. gbinv1363.seq - Invertebrate sequence entries, part 1363.
2672. gbinv1364.seq - Invertebrate sequence entries, part 1364.
2673. gbinv1365.seq - Invertebrate sequence entries, part 1365.
2674. gbinv1366.seq - Invertebrate sequence entries, part 1366.
2675. gbinv1367.seq - Invertebrate sequence entries, part 1367.
2676. gbinv1368.seq - Invertebrate sequence entries, part 1368.
2677. gbinv1369.seq - Invertebrate sequence entries, part 1369.
2678. gbinv137.seq - Invertebrate sequence entries, part 137.
2679. gbinv1370.seq - Invertebrate sequence entries, part 1370.
2680. gbinv1371.seq - Invertebrate sequence entries, part 1371.
2681. gbinv1372.seq - Invertebrate sequence entries, part 1372.
2682. gbinv1373.seq - Invertebrate sequence entries, part 1373.
2683. gbinv1374.seq - Invertebrate sequence entries, part 1374.
2684. gbinv1375.seq - Invertebrate sequence entries, part 1375.
2685. gbinv1376.seq - Invertebrate sequence entries, part 1376.
2686. gbinv1377.seq - Invertebrate sequence entries, part 1377.
2687. gbinv1378.seq - Invertebrate sequence entries, part 1378.
2688. gbinv1379.seq - Invertebrate sequence entries, part 1379.
2689. gbinv138.seq - Invertebrate sequence entries, part 138.
2690. gbinv1380.seq - Invertebrate sequence entries, part 1380.
2691. gbinv1381.seq - Invertebrate sequence entries, part 1381.
2692. gbinv1382.seq - Invertebrate sequence entries, part 1382.
2693. gbinv1383.seq - Invertebrate sequence entries, part 1383.
2694. gbinv1384.seq - Invertebrate sequence entries, part 1384.
2695. gbinv1385.seq - Invertebrate sequence entries, part 1385.
2696. gbinv1386.seq - Invertebrate sequence entries, part 1386.
2697. gbinv1387.seq - Invertebrate sequence entries, part 1387.
2698. gbinv1388.seq - Invertebrate sequence entries, part 1388.
2699. gbinv1389.seq - Invertebrate sequence entries, part 1389.
2700. gbinv139.seq - Invertebrate sequence entries, part 139.
2701. gbinv1390.seq - Invertebrate sequence entries, part 1390.
2702. gbinv1391.seq - Invertebrate sequence entries, part 1391.
2703. gbinv1392.seq - Invertebrate sequence entries, part 1392.
2704. gbinv1393.seq - Invertebrate sequence entries, part 1393.
2705. gbinv1394.seq - Invertebrate sequence entries, part 1394.
2706. gbinv1395.seq - Invertebrate sequence entries, part 1395.
2707. gbinv1396.seq - Invertebrate sequence entries, part 1396.
2708. gbinv1397.seq - Invertebrate sequence entries, part 1397.
2709. gbinv1398.seq - Invertebrate sequence entries, part 1398.
2710. gbinv1399.seq - Invertebrate sequence entries, part 1399.
2711. gbinv14.seq - Invertebrate sequence entries, part 14.
2712. gbinv140.seq - Invertebrate sequence entries, part 140.
2713. gbinv1400.seq - Invertebrate sequence entries, part 1400.
2714. gbinv1401.seq - Invertebrate sequence entries, part 1401.
2715. gbinv1402.seq - Invertebrate sequence entries, part 1402.
2716. gbinv1403.seq - Invertebrate sequence entries, part 1403.
2717. gbinv1404.seq - Invertebrate sequence entries, part 1404.
2718. gbinv1405.seq - Invertebrate sequence entries, part 1405.
2719. gbinv1406.seq - Invertebrate sequence entries, part 1406.
2720. gbinv1407.seq - Invertebrate sequence entries, part 1407.
2721. gbinv1408.seq - Invertebrate sequence entries, part 1408.
2722. gbinv1409.seq - Invertebrate sequence entries, part 1409.
2723. gbinv141.seq - Invertebrate sequence entries, part 141.
2724. gbinv1410.seq - Invertebrate sequence entries, part 1410.
2725. gbinv1411.seq - Invertebrate sequence entries, part 1411.
2726. gbinv1412.seq - Invertebrate sequence entries, part 1412.
2727. gbinv1413.seq - Invertebrate sequence entries, part 1413.
2728. gbinv1414.seq - Invertebrate sequence entries, part 1414.
2729. gbinv1415.seq - Invertebrate sequence entries, part 1415.
2730. gbinv1416.seq - Invertebrate sequence entries, part 1416.
2731. gbinv1417.seq - Invertebrate sequence entries, part 1417.
2732. gbinv1418.seq - Invertebrate sequence entries, part 1418.
2733. gbinv1419.seq - Invertebrate sequence entries, part 1419.
2734. gbinv142.seq - Invertebrate sequence entries, part 142.
2735. gbinv1420.seq - Invertebrate sequence entries, part 1420.
2736. gbinv1421.seq - Invertebrate sequence entries, part 1421.
2737. gbinv1422.seq - Invertebrate sequence entries, part 1422.
2738. gbinv1423.seq - Invertebrate sequence entries, part 1423.
2739. gbinv1424.seq - Invertebrate sequence entries, part 1424.
2740. gbinv1425.seq - Invertebrate sequence entries, part 1425.
2741. gbinv1426.seq - Invertebrate sequence entries, part 1426.
2742. gbinv1427.seq - Invertebrate sequence entries, part 1427.
2743. gbinv1428.seq - Invertebrate sequence entries, part 1428.
2744. gbinv1429.seq - Invertebrate sequence entries, part 1429.
2745. gbinv143.seq - Invertebrate sequence entries, part 143.
2746. gbinv1430.seq - Invertebrate sequence entries, part 1430.
2747. gbinv1431.seq - Invertebrate sequence entries, part 1431.
2748. gbinv1432.seq - Invertebrate sequence entries, part 1432.
2749. gbinv1433.seq - Invertebrate sequence entries, part 1433.
2750. gbinv1434.seq - Invertebrate sequence entries, part 1434.
2751. gbinv1435.seq - Invertebrate sequence entries, part 1435.
2752. gbinv1436.seq - Invertebrate sequence entries, part 1436.
2753. gbinv1437.seq - Invertebrate sequence entries, part 1437.
2754. gbinv1438.seq - Invertebrate sequence entries, part 1438.
2755. gbinv1439.seq - Invertebrate sequence entries, part 1439.
2756. gbinv144.seq - Invertebrate sequence entries, part 144.
2757. gbinv1440.seq - Invertebrate sequence entries, part 1440.
2758. gbinv1441.seq - Invertebrate sequence entries, part 1441.
2759. gbinv1442.seq - Invertebrate sequence entries, part 1442.
2760. gbinv1443.seq - Invertebrate sequence entries, part 1443.
2761. gbinv1444.seq - Invertebrate sequence entries, part 1444.
2762. gbinv1445.seq - Invertebrate sequence entries, part 1445.
2763. gbinv1446.seq - Invertebrate sequence entries, part 1446.
2764. gbinv1447.seq - Invertebrate sequence entries, part 1447.
2765. gbinv1448.seq - Invertebrate sequence entries, part 1448.
2766. gbinv1449.seq - Invertebrate sequence entries, part 1449.
2767. gbinv145.seq - Invertebrate sequence entries, part 145.
2768. gbinv1450.seq - Invertebrate sequence entries, part 1450.
2769. gbinv1451.seq - Invertebrate sequence entries, part 1451.
2770. gbinv1452.seq - Invertebrate sequence entries, part 1452.
2771. gbinv1453.seq - Invertebrate sequence entries, part 1453.
2772. gbinv1454.seq - Invertebrate sequence entries, part 1454.
2773. gbinv1455.seq - Invertebrate sequence entries, part 1455.
2774. gbinv1456.seq - Invertebrate sequence entries, part 1456.
2775. gbinv1457.seq - Invertebrate sequence entries, part 1457.
2776. gbinv1458.seq - Invertebrate sequence entries, part 1458.
2777. gbinv1459.seq - Invertebrate sequence entries, part 1459.
2778. gbinv146.seq - Invertebrate sequence entries, part 146.
2779. gbinv1460.seq - Invertebrate sequence entries, part 1460.
2780. gbinv1461.seq - Invertebrate sequence entries, part 1461.
2781. gbinv1462.seq - Invertebrate sequence entries, part 1462.
2782. gbinv1463.seq - Invertebrate sequence entries, part 1463.
2783. gbinv1464.seq - Invertebrate sequence entries, part 1464.
2784. gbinv1465.seq - Invertebrate sequence entries, part 1465.
2785. gbinv1466.seq - Invertebrate sequence entries, part 1466.
2786. gbinv1467.seq - Invertebrate sequence entries, part 1467.
2787. gbinv1468.seq - Invertebrate sequence entries, part 1468.
2788. gbinv1469.seq - Invertebrate sequence entries, part 1469.
2789. gbinv147.seq - Invertebrate sequence entries, part 147.
2790. gbinv1470.seq - Invertebrate sequence entries, part 1470.
2791. gbinv1471.seq - Invertebrate sequence entries, part 1471.
2792. gbinv1472.seq - Invertebrate sequence entries, part 1472.
2793. gbinv1473.seq - Invertebrate sequence entries, part 1473.
2794. gbinv1474.seq - Invertebrate sequence entries, part 1474.
2795. gbinv1475.seq - Invertebrate sequence entries, part 1475.
2796. gbinv1476.seq - Invertebrate sequence entries, part 1476.
2797. gbinv1477.seq - Invertebrate sequence entries, part 1477.
2798. gbinv1478.seq - Invertebrate sequence entries, part 1478.
2799. gbinv1479.seq - Invertebrate sequence entries, part 1479.
2800. gbinv148.seq - Invertebrate sequence entries, part 148.
2801. gbinv1480.seq - Invertebrate sequence entries, part 1480.
2802. gbinv1481.seq - Invertebrate sequence entries, part 1481.
2803. gbinv1482.seq - Invertebrate sequence entries, part 1482.
2804. gbinv1483.seq - Invertebrate sequence entries, part 1483.
2805. gbinv1484.seq - Invertebrate sequence entries, part 1484.
2806. gbinv1485.seq - Invertebrate sequence entries, part 1485.
2807. gbinv1486.seq - Invertebrate sequence entries, part 1486.
2808. gbinv1487.seq - Invertebrate sequence entries, part 1487.
2809. gbinv1488.seq - Invertebrate sequence entries, part 1488.
2810. gbinv1489.seq - Invertebrate sequence entries, part 1489.
2811. gbinv149.seq - Invertebrate sequence entries, part 149.
2812. gbinv1490.seq - Invertebrate sequence entries, part 1490.
2813. gbinv1491.seq - Invertebrate sequence entries, part 1491.
2814. gbinv1492.seq - Invertebrate sequence entries, part 1492.
2815. gbinv1493.seq - Invertebrate sequence entries, part 1493.
2816. gbinv1494.seq - Invertebrate sequence entries, part 1494.
2817. gbinv1495.seq - Invertebrate sequence entries, part 1495.
2818. gbinv1496.seq - Invertebrate sequence entries, part 1496.
2819. gbinv1497.seq - Invertebrate sequence entries, part 1497.
2820. gbinv1498.seq - Invertebrate sequence entries, part 1498.
2821. gbinv1499.seq - Invertebrate sequence entries, part 1499.
2822. gbinv15.seq - Invertebrate sequence entries, part 15.
2823. gbinv150.seq - Invertebrate sequence entries, part 150.
2824. gbinv1500.seq - Invertebrate sequence entries, part 1500.
2825. gbinv1501.seq - Invertebrate sequence entries, part 1501.
2826. gbinv1502.seq - Invertebrate sequence entries, part 1502.
2827. gbinv1503.seq - Invertebrate sequence entries, part 1503.
2828. gbinv1504.seq - Invertebrate sequence entries, part 1504.
2829. gbinv1505.seq - Invertebrate sequence entries, part 1505.
2830. gbinv1506.seq - Invertebrate sequence entries, part 1506.
2831. gbinv1507.seq - Invertebrate sequence entries, part 1507.
2832. gbinv1508.seq - Invertebrate sequence entries, part 1508.
2833. gbinv1509.seq - Invertebrate sequence entries, part 1509.
2834. gbinv151.seq - Invertebrate sequence entries, part 151.
2835. gbinv1510.seq - Invertebrate sequence entries, part 1510.
2836. gbinv1511.seq - Invertebrate sequence entries, part 1511.
2837. gbinv1512.seq - Invertebrate sequence entries, part 1512.
2838. gbinv1513.seq - Invertebrate sequence entries, part 1513.
2839. gbinv1514.seq - Invertebrate sequence entries, part 1514.
2840. gbinv1515.seq - Invertebrate sequence entries, part 1515.
2841. gbinv1516.seq - Invertebrate sequence entries, part 1516.
2842. gbinv1517.seq - Invertebrate sequence entries, part 1517.
2843. gbinv1518.seq - Invertebrate sequence entries, part 1518.
2844. gbinv1519.seq - Invertebrate sequence entries, part 1519.
2845. gbinv152.seq - Invertebrate sequence entries, part 152.
2846. gbinv1520.seq - Invertebrate sequence entries, part 1520.
2847. gbinv1521.seq - Invertebrate sequence entries, part 1521.
2848. gbinv1522.seq - Invertebrate sequence entries, part 1522.
2849. gbinv1523.seq - Invertebrate sequence entries, part 1523.
2850. gbinv1524.seq - Invertebrate sequence entries, part 1524.
2851. gbinv1525.seq - Invertebrate sequence entries, part 1525.
2852. gbinv1526.seq - Invertebrate sequence entries, part 1526.
2853. gbinv1527.seq - Invertebrate sequence entries, part 1527.
2854. gbinv1528.seq - Invertebrate sequence entries, part 1528.
2855. gbinv1529.seq - Invertebrate sequence entries, part 1529.
2856. gbinv153.seq - Invertebrate sequence entries, part 153.
2857. gbinv1530.seq - Invertebrate sequence entries, part 1530.
2858. gbinv1531.seq - Invertebrate sequence entries, part 1531.
2859. gbinv1532.seq - Invertebrate sequence entries, part 1532.
2860. gbinv1533.seq - Invertebrate sequence entries, part 1533.
2861. gbinv1534.seq - Invertebrate sequence entries, part 1534.
2862. gbinv1535.seq - Invertebrate sequence entries, part 1535.
2863. gbinv1536.seq - Invertebrate sequence entries, part 1536.
2864. gbinv1537.seq - Invertebrate sequence entries, part 1537.
2865. gbinv1538.seq - Invertebrate sequence entries, part 1538.
2866. gbinv1539.seq - Invertebrate sequence entries, part 1539.
2867. gbinv154.seq - Invertebrate sequence entries, part 154.
2868. gbinv1540.seq - Invertebrate sequence entries, part 1540.
2869. gbinv1541.seq - Invertebrate sequence entries, part 1541.
2870. gbinv1542.seq - Invertebrate sequence entries, part 1542.
2871. gbinv1543.seq - Invertebrate sequence entries, part 1543.
2872. gbinv1544.seq - Invertebrate sequence entries, part 1544.
2873. gbinv1545.seq - Invertebrate sequence entries, part 1545.
2874. gbinv1546.seq - Invertebrate sequence entries, part 1546.
2875. gbinv1547.seq - Invertebrate sequence entries, part 1547.
2876. gbinv1548.seq - Invertebrate sequence entries, part 1548.
2877. gbinv1549.seq - Invertebrate sequence entries, part 1549.
2878. gbinv155.seq - Invertebrate sequence entries, part 155.
2879. gbinv1550.seq - Invertebrate sequence entries, part 1550.
2880. gbinv1551.seq - Invertebrate sequence entries, part 1551.
2881. gbinv1552.seq - Invertebrate sequence entries, part 1552.
2882. gbinv1553.seq - Invertebrate sequence entries, part 1553.
2883. gbinv1554.seq - Invertebrate sequence entries, part 1554.
2884. gbinv1555.seq - Invertebrate sequence entries, part 1555.
2885. gbinv1556.seq - Invertebrate sequence entries, part 1556.
2886. gbinv1557.seq - Invertebrate sequence entries, part 1557.
2887. gbinv1558.seq - Invertebrate sequence entries, part 1558.
2888. gbinv1559.seq - Invertebrate sequence entries, part 1559.
2889. gbinv156.seq - Invertebrate sequence entries, part 156.
2890. gbinv1560.seq - Invertebrate sequence entries, part 1560.
2891. gbinv1561.seq - Invertebrate sequence entries, part 1561.
2892. gbinv1562.seq - Invertebrate sequence entries, part 1562.
2893. gbinv1563.seq - Invertebrate sequence entries, part 1563.
2894. gbinv1564.seq - Invertebrate sequence entries, part 1564.
2895. gbinv1565.seq - Invertebrate sequence entries, part 1565.
2896. gbinv1566.seq - Invertebrate sequence entries, part 1566.
2897. gbinv1567.seq - Invertebrate sequence entries, part 1567.
2898. gbinv1568.seq - Invertebrate sequence entries, part 1568.
2899. gbinv1569.seq - Invertebrate sequence entries, part 1569.
2900. gbinv157.seq - Invertebrate sequence entries, part 157.
2901. gbinv1570.seq - Invertebrate sequence entries, part 1570.
2902. gbinv1571.seq - Invertebrate sequence entries, part 1571.
2903. gbinv1572.seq - Invertebrate sequence entries, part 1572.
2904. gbinv1573.seq - Invertebrate sequence entries, part 1573.
2905. gbinv1574.seq - Invertebrate sequence entries, part 1574.
2906. gbinv1575.seq - Invertebrate sequence entries, part 1575.
2907. gbinv1576.seq - Invertebrate sequence entries, part 1576.
2908. gbinv1577.seq - Invertebrate sequence entries, part 1577.
2909. gbinv1578.seq - Invertebrate sequence entries, part 1578.
2910. gbinv1579.seq - Invertebrate sequence entries, part 1579.
2911. gbinv158.seq - Invertebrate sequence entries, part 158.
2912. gbinv1580.seq - Invertebrate sequence entries, part 1580.
2913. gbinv1581.seq - Invertebrate sequence entries, part 1581.
2914. gbinv1582.seq - Invertebrate sequence entries, part 1582.
2915. gbinv1583.seq - Invertebrate sequence entries, part 1583.
2916. gbinv1584.seq - Invertebrate sequence entries, part 1584.
2917. gbinv1585.seq - Invertebrate sequence entries, part 1585.
2918. gbinv1586.seq - Invertebrate sequence entries, part 1586.
2919. gbinv1587.seq - Invertebrate sequence entries, part 1587.
2920. gbinv1588.seq - Invertebrate sequence entries, part 1588.
2921. gbinv1589.seq - Invertebrate sequence entries, part 1589.
2922. gbinv159.seq - Invertebrate sequence entries, part 159.
2923. gbinv1590.seq - Invertebrate sequence entries, part 1590.
2924. gbinv1591.seq - Invertebrate sequence entries, part 1591.
2925. gbinv1592.seq - Invertebrate sequence entries, part 1592.
2926. gbinv1593.seq - Invertebrate sequence entries, part 1593.
2927. gbinv1594.seq - Invertebrate sequence entries, part 1594.
2928. gbinv1595.seq - Invertebrate sequence entries, part 1595.
2929. gbinv1596.seq - Invertebrate sequence entries, part 1596.
2930. gbinv1597.seq - Invertebrate sequence entries, part 1597.
2931. gbinv1598.seq - Invertebrate sequence entries, part 1598.
2932. gbinv1599.seq - Invertebrate sequence entries, part 1599.
2933. gbinv16.seq - Invertebrate sequence entries, part 16.
2934. gbinv160.seq - Invertebrate sequence entries, part 160.
2935. gbinv1600.seq - Invertebrate sequence entries, part 1600.
2936. gbinv1601.seq - Invertebrate sequence entries, part 1601.
2937. gbinv1602.seq - Invertebrate sequence entries, part 1602.
2938. gbinv1603.seq - Invertebrate sequence entries, part 1603.
2939. gbinv1604.seq - Invertebrate sequence entries, part 1604.
2940. gbinv1605.seq - Invertebrate sequence entries, part 1605.
2941. gbinv1606.seq - Invertebrate sequence entries, part 1606.
2942. gbinv1607.seq - Invertebrate sequence entries, part 1607.
2943. gbinv1608.seq - Invertebrate sequence entries, part 1608.
2944. gbinv1609.seq - Invertebrate sequence entries, part 1609.
2945. gbinv161.seq - Invertebrate sequence entries, part 161.
2946. gbinv1610.seq - Invertebrate sequence entries, part 1610.
2947. gbinv1611.seq - Invertebrate sequence entries, part 1611.
2948. gbinv1612.seq - Invertebrate sequence entries, part 1612.
2949. gbinv1613.seq - Invertebrate sequence entries, part 1613.
2950. gbinv1614.seq - Invertebrate sequence entries, part 1614.
2951. gbinv1615.seq - Invertebrate sequence entries, part 1615.
2952. gbinv1616.seq - Invertebrate sequence entries, part 1616.
2953. gbinv1617.seq - Invertebrate sequence entries, part 1617.
2954. gbinv1618.seq - Invertebrate sequence entries, part 1618.
2955. gbinv1619.seq - Invertebrate sequence entries, part 1619.
2956. gbinv162.seq - Invertebrate sequence entries, part 162.
2957. gbinv1620.seq - Invertebrate sequence entries, part 1620.
2958. gbinv1621.seq - Invertebrate sequence entries, part 1621.
2959. gbinv1622.seq - Invertebrate sequence entries, part 1622.
2960. gbinv1623.seq - Invertebrate sequence entries, part 1623.
2961. gbinv1624.seq - Invertebrate sequence entries, part 1624.
2962. gbinv1625.seq - Invertebrate sequence entries, part 1625.
2963. gbinv1626.seq - Invertebrate sequence entries, part 1626.
2964. gbinv1627.seq - Invertebrate sequence entries, part 1627.
2965. gbinv1628.seq - Invertebrate sequence entries, part 1628.
2966. gbinv1629.seq - Invertebrate sequence entries, part 1629.
2967. gbinv163.seq - Invertebrate sequence entries, part 163.
2968. gbinv1630.seq - Invertebrate sequence entries, part 1630.
2969. gbinv1631.seq - Invertebrate sequence entries, part 1631.
2970. gbinv1632.seq - Invertebrate sequence entries, part 1632.
2971. gbinv1633.seq - Invertebrate sequence entries, part 1633.
2972. gbinv1634.seq - Invertebrate sequence entries, part 1634.
2973. gbinv1635.seq - Invertebrate sequence entries, part 1635.
2974. gbinv1636.seq - Invertebrate sequence entries, part 1636.
2975. gbinv1637.seq - Invertebrate sequence entries, part 1637.
2976. gbinv1638.seq - Invertebrate sequence entries, part 1638.
2977. gbinv1639.seq - Invertebrate sequence entries, part 1639.
2978. gbinv164.seq - Invertebrate sequence entries, part 164.
2979. gbinv1640.seq - Invertebrate sequence entries, part 1640.
2980. gbinv1641.seq - Invertebrate sequence entries, part 1641.
2981. gbinv1642.seq - Invertebrate sequence entries, part 1642.
2982. gbinv1643.seq - Invertebrate sequence entries, part 1643.
2983. gbinv1644.seq - Invertebrate sequence entries, part 1644.
2984. gbinv1645.seq - Invertebrate sequence entries, part 1645.
2985. gbinv1646.seq - Invertebrate sequence entries, part 1646.
2986. gbinv1647.seq - Invertebrate sequence entries, part 1647.
2987. gbinv1648.seq - Invertebrate sequence entries, part 1648.
2988. gbinv1649.seq - Invertebrate sequence entries, part 1649.
2989. gbinv165.seq - Invertebrate sequence entries, part 165.
2990. gbinv1650.seq - Invertebrate sequence entries, part 1650.
2991. gbinv1651.seq - Invertebrate sequence entries, part 1651.
2992. gbinv1652.seq - Invertebrate sequence entries, part 1652.
2993. gbinv1653.seq - Invertebrate sequence entries, part 1653.
2994. gbinv1654.seq - Invertebrate sequence entries, part 1654.
2995. gbinv1655.seq - Invertebrate sequence entries, part 1655.
2996. gbinv1656.seq - Invertebrate sequence entries, part 1656.
2997. gbinv1657.seq - Invertebrate sequence entries, part 1657.
2998. gbinv1658.seq - Invertebrate sequence entries, part 1658.
2999. gbinv1659.seq - Invertebrate sequence entries, part 1659.
3000. gbinv166.seq - Invertebrate sequence entries, part 166.
3001. gbinv1660.seq - Invertebrate sequence entries, part 1660.
3002. gbinv1661.seq - Invertebrate sequence entries, part 1661.
3003. gbinv1662.seq - Invertebrate sequence entries, part 1662.
3004. gbinv1663.seq - Invertebrate sequence entries, part 1663.
3005. gbinv1664.seq - Invertebrate sequence entries, part 1664.
3006. gbinv1665.seq - Invertebrate sequence entries, part 1665.
3007. gbinv1666.seq - Invertebrate sequence entries, part 1666.
3008. gbinv1667.seq - Invertebrate sequence entries, part 1667.
3009. gbinv1668.seq - Invertebrate sequence entries, part 1668.
3010. gbinv1669.seq - Invertebrate sequence entries, part 1669.
3011. gbinv167.seq - Invertebrate sequence entries, part 167.
3012. gbinv1670.seq - Invertebrate sequence entries, part 1670.
3013. gbinv1671.seq - Invertebrate sequence entries, part 1671.
3014. gbinv1672.seq - Invertebrate sequence entries, part 1672.
3015. gbinv1673.seq - Invertebrate sequence entries, part 1673.
3016. gbinv1674.seq - Invertebrate sequence entries, part 1674.
3017. gbinv1675.seq - Invertebrate sequence entries, part 1675.
3018. gbinv1676.seq - Invertebrate sequence entries, part 1676.
3019. gbinv1677.seq - Invertebrate sequence entries, part 1677.
3020. gbinv1678.seq - Invertebrate sequence entries, part 1678.
3021. gbinv1679.seq - Invertebrate sequence entries, part 1679.
3022. gbinv168.seq - Invertebrate sequence entries, part 168.
3023. gbinv1680.seq - Invertebrate sequence entries, part 1680.
3024. gbinv1681.seq - Invertebrate sequence entries, part 1681.
3025. gbinv1682.seq - Invertebrate sequence entries, part 1682.
3026. gbinv1683.seq - Invertebrate sequence entries, part 1683.
3027. gbinv1684.seq - Invertebrate sequence entries, part 1684.
3028. gbinv1685.seq - Invertebrate sequence entries, part 1685.
3029. gbinv1686.seq - Invertebrate sequence entries, part 1686.
3030. gbinv1687.seq - Invertebrate sequence entries, part 1687.
3031. gbinv1688.seq - Invertebrate sequence entries, part 1688.
3032. gbinv1689.seq - Invertebrate sequence entries, part 1689.
3033. gbinv169.seq - Invertebrate sequence entries, part 169.
3034. gbinv1690.seq - Invertebrate sequence entries, part 1690.
3035. gbinv1691.seq - Invertebrate sequence entries, part 1691.
3036. gbinv1692.seq - Invertebrate sequence entries, part 1692.
3037. gbinv1693.seq - Invertebrate sequence entries, part 1693.
3038. gbinv1694.seq - Invertebrate sequence entries, part 1694.
3039. gbinv1695.seq - Invertebrate sequence entries, part 1695.
3040. gbinv1696.seq - Invertebrate sequence entries, part 1696.
3041. gbinv1697.seq - Invertebrate sequence entries, part 1697.
3042. gbinv1698.seq - Invertebrate sequence entries, part 1698.
3043. gbinv1699.seq - Invertebrate sequence entries, part 1699.
3044. gbinv17.seq - Invertebrate sequence entries, part 17.
3045. gbinv170.seq - Invertebrate sequence entries, part 170.
3046. gbinv1700.seq - Invertebrate sequence entries, part 1700.
3047. gbinv1701.seq - Invertebrate sequence entries, part 1701.
3048. gbinv1702.seq - Invertebrate sequence entries, part 1702.
3049. gbinv1703.seq - Invertebrate sequence entries, part 1703.
3050. gbinv1704.seq - Invertebrate sequence entries, part 1704.
3051. gbinv1705.seq - Invertebrate sequence entries, part 1705.
3052. gbinv1706.seq - Invertebrate sequence entries, part 1706.
3053. gbinv1707.seq - Invertebrate sequence entries, part 1707.
3054. gbinv1708.seq - Invertebrate sequence entries, part 1708.
3055. gbinv1709.seq - Invertebrate sequence entries, part 1709.
3056. gbinv171.seq - Invertebrate sequence entries, part 171.
3057. gbinv1710.seq - Invertebrate sequence entries, part 1710.
3058. gbinv1711.seq - Invertebrate sequence entries, part 1711.
3059. gbinv1712.seq - Invertebrate sequence entries, part 1712.
3060. gbinv1713.seq - Invertebrate sequence entries, part 1713.
3061. gbinv1714.seq - Invertebrate sequence entries, part 1714.
3062. gbinv1715.seq - Invertebrate sequence entries, part 1715.
3063. gbinv1716.seq - Invertebrate sequence entries, part 1716.
3064. gbinv1717.seq - Invertebrate sequence entries, part 1717.
3065. gbinv1718.seq - Invertebrate sequence entries, part 1718.
3066. gbinv1719.seq - Invertebrate sequence entries, part 1719.
3067. gbinv172.seq - Invertebrate sequence entries, part 172.
3068. gbinv1720.seq - Invertebrate sequence entries, part 1720.
3069. gbinv1721.seq - Invertebrate sequence entries, part 1721.
3070. gbinv1722.seq - Invertebrate sequence entries, part 1722.
3071. gbinv1723.seq - Invertebrate sequence entries, part 1723.
3072. gbinv1724.seq - Invertebrate sequence entries, part 1724.
3073. gbinv1725.seq - Invertebrate sequence entries, part 1725.
3074. gbinv1726.seq - Invertebrate sequence entries, part 1726.
3075. gbinv1727.seq - Invertebrate sequence entries, part 1727.
3076. gbinv1728.seq - Invertebrate sequence entries, part 1728.
3077. gbinv1729.seq - Invertebrate sequence entries, part 1729.
3078. gbinv173.seq - Invertebrate sequence entries, part 173.
3079. gbinv1730.seq - Invertebrate sequence entries, part 1730.
3080. gbinv1731.seq - Invertebrate sequence entries, part 1731.
3081. gbinv1732.seq - Invertebrate sequence entries, part 1732.
3082. gbinv1733.seq - Invertebrate sequence entries, part 1733.
3083. gbinv1734.seq - Invertebrate sequence entries, part 1734.
3084. gbinv1735.seq - Invertebrate sequence entries, part 1735.
3085. gbinv1736.seq - Invertebrate sequence entries, part 1736.
3086. gbinv1737.seq - Invertebrate sequence entries, part 1737.
3087. gbinv1738.seq - Invertebrate sequence entries, part 1738.
3088. gbinv1739.seq - Invertebrate sequence entries, part 1739.
3089. gbinv174.seq - Invertebrate sequence entries, part 174.
3090. gbinv175.seq - Invertebrate sequence entries, part 175.
3091. gbinv176.seq - Invertebrate sequence entries, part 176.
3092. gbinv177.seq - Invertebrate sequence entries, part 177.
3093. gbinv178.seq - Invertebrate sequence entries, part 178.
3094. gbinv179.seq - Invertebrate sequence entries, part 179.
3095. gbinv18.seq - Invertebrate sequence entries, part 18.
3096. gbinv180.seq - Invertebrate sequence entries, part 180.
3097. gbinv181.seq - Invertebrate sequence entries, part 181.
3098. gbinv182.seq - Invertebrate sequence entries, part 182.
3099. gbinv183.seq - Invertebrate sequence entries, part 183.
3100. gbinv184.seq - Invertebrate sequence entries, part 184.
3101. gbinv185.seq - Invertebrate sequence entries, part 185.
3102. gbinv186.seq - Invertebrate sequence entries, part 186.
3103. gbinv187.seq - Invertebrate sequence entries, part 187.
3104. gbinv188.seq - Invertebrate sequence entries, part 188.
3105. gbinv189.seq - Invertebrate sequence entries, part 189.
3106. gbinv19.seq - Invertebrate sequence entries, part 19.
3107. gbinv190.seq - Invertebrate sequence entries, part 190.
3108. gbinv191.seq - Invertebrate sequence entries, part 191.
3109. gbinv192.seq - Invertebrate sequence entries, part 192.
3110. gbinv193.seq - Invertebrate sequence entries, part 193.
3111. gbinv194.seq - Invertebrate sequence entries, part 194.
3112. gbinv195.seq - Invertebrate sequence entries, part 195.
3113. gbinv196.seq - Invertebrate sequence entries, part 196.
3114. gbinv197.seq - Invertebrate sequence entries, part 197.
3115. gbinv198.seq - Invertebrate sequence entries, part 198.
3116. gbinv199.seq - Invertebrate sequence entries, part 199.
3117. gbinv2.seq - Invertebrate sequence entries, part 2.
3118. gbinv20.seq - Invertebrate sequence entries, part 20.
3119. gbinv200.seq - Invertebrate sequence entries, part 200.
3120. gbinv201.seq - Invertebrate sequence entries, part 201.
3121. gbinv202.seq - Invertebrate sequence entries, part 202.
3122. gbinv203.seq - Invertebrate sequence entries, part 203.
3123. gbinv204.seq - Invertebrate sequence entries, part 204.
3124. gbinv205.seq - Invertebrate sequence entries, part 205.
3125. gbinv206.seq - Invertebrate sequence entries, part 206.
3126. gbinv207.seq - Invertebrate sequence entries, part 207.
3127. gbinv208.seq - Invertebrate sequence entries, part 208.
3128. gbinv209.seq - Invertebrate sequence entries, part 209.
3129. gbinv21.seq - Invertebrate sequence entries, part 21.
3130. gbinv210.seq - Invertebrate sequence entries, part 210.
3131. gbinv211.seq - Invertebrate sequence entries, part 211.
3132. gbinv212.seq - Invertebrate sequence entries, part 212.
3133. gbinv213.seq - Invertebrate sequence entries, part 213.
3134. gbinv214.seq - Invertebrate sequence entries, part 214.
3135. gbinv215.seq - Invertebrate sequence entries, part 215.
3136. gbinv216.seq - Invertebrate sequence entries, part 216.
3137. gbinv217.seq - Invertebrate sequence entries, part 217.
3138. gbinv218.seq - Invertebrate sequence entries, part 218.
3139. gbinv219.seq - Invertebrate sequence entries, part 219.
3140. gbinv22.seq - Invertebrate sequence entries, part 22.
3141. gbinv220.seq - Invertebrate sequence entries, part 220.
3142. gbinv221.seq - Invertebrate sequence entries, part 221.
3143. gbinv222.seq - Invertebrate sequence entries, part 222.
3144. gbinv223.seq - Invertebrate sequence entries, part 223.
3145. gbinv224.seq - Invertebrate sequence entries, part 224.
3146. gbinv225.seq - Invertebrate sequence entries, part 225.
3147. gbinv226.seq - Invertebrate sequence entries, part 226.
3148. gbinv227.seq - Invertebrate sequence entries, part 227.
3149. gbinv228.seq - Invertebrate sequence entries, part 228.
3150. gbinv229.seq - Invertebrate sequence entries, part 229.
3151. gbinv23.seq - Invertebrate sequence entries, part 23.
3152. gbinv230.seq - Invertebrate sequence entries, part 230.
3153. gbinv231.seq - Invertebrate sequence entries, part 231.
3154. gbinv232.seq - Invertebrate sequence entries, part 232.
3155. gbinv233.seq - Invertebrate sequence entries, part 233.
3156. gbinv234.seq - Invertebrate sequence entries, part 234.
3157. gbinv235.seq - Invertebrate sequence entries, part 235.
3158. gbinv236.seq - Invertebrate sequence entries, part 236.
3159. gbinv237.seq - Invertebrate sequence entries, part 237.
3160. gbinv238.seq - Invertebrate sequence entries, part 238.
3161. gbinv239.seq - Invertebrate sequence entries, part 239.
3162. gbinv24.seq - Invertebrate sequence entries, part 24.
3163. gbinv240.seq - Invertebrate sequence entries, part 240.
3164. gbinv241.seq - Invertebrate sequence entries, part 241.
3165. gbinv242.seq - Invertebrate sequence entries, part 242.
3166. gbinv243.seq - Invertebrate sequence entries, part 243.
3167. gbinv244.seq - Invertebrate sequence entries, part 244.
3168. gbinv245.seq - Invertebrate sequence entries, part 245.
3169. gbinv246.seq - Invertebrate sequence entries, part 246.
3170. gbinv247.seq - Invertebrate sequence entries, part 247.
3171. gbinv248.seq - Invertebrate sequence entries, part 248.
3172. gbinv249.seq - Invertebrate sequence entries, part 249.
3173. gbinv25.seq - Invertebrate sequence entries, part 25.
3174. gbinv250.seq - Invertebrate sequence entries, part 250.
3175. gbinv251.seq - Invertebrate sequence entries, part 251.
3176. gbinv252.seq - Invertebrate sequence entries, part 252.
3177. gbinv253.seq - Invertebrate sequence entries, part 253.
3178. gbinv254.seq - Invertebrate sequence entries, part 254.
3179. gbinv255.seq - Invertebrate sequence entries, part 255.
3180. gbinv256.seq - Invertebrate sequence entries, part 256.
3181. gbinv257.seq - Invertebrate sequence entries, part 257.
3182. gbinv258.seq - Invertebrate sequence entries, part 258.
3183. gbinv259.seq - Invertebrate sequence entries, part 259.
3184. gbinv26.seq - Invertebrate sequence entries, part 26.
3185. gbinv260.seq - Invertebrate sequence entries, part 260.
3186. gbinv261.seq - Invertebrate sequence entries, part 261.
3187. gbinv262.seq - Invertebrate sequence entries, part 262.
3188. gbinv263.seq - Invertebrate sequence entries, part 263.
3189. gbinv264.seq - Invertebrate sequence entries, part 264.
3190. gbinv265.seq - Invertebrate sequence entries, part 265.
3191. gbinv266.seq - Invertebrate sequence entries, part 266.
3192. gbinv267.seq - Invertebrate sequence entries, part 267.
3193. gbinv268.seq - Invertebrate sequence entries, part 268.
3194. gbinv269.seq - Invertebrate sequence entries, part 269.
3195. gbinv27.seq - Invertebrate sequence entries, part 27.
3196. gbinv270.seq - Invertebrate sequence entries, part 270.
3197. gbinv271.seq - Invertebrate sequence entries, part 271.
3198. gbinv272.seq - Invertebrate sequence entries, part 272.
3199. gbinv273.seq - Invertebrate sequence entries, part 273.
3200. gbinv274.seq - Invertebrate sequence entries, part 274.
3201. gbinv275.seq - Invertebrate sequence entries, part 275.
3202. gbinv276.seq - Invertebrate sequence entries, part 276.
3203. gbinv277.seq - Invertebrate sequence entries, part 277.
3204. gbinv278.seq - Invertebrate sequence entries, part 278.
3205. gbinv279.seq - Invertebrate sequence entries, part 279.
3206. gbinv28.seq - Invertebrate sequence entries, part 28.
3207. gbinv280.seq - Invertebrate sequence entries, part 280.
3208. gbinv281.seq - Invertebrate sequence entries, part 281.
3209. gbinv282.seq - Invertebrate sequence entries, part 282.
3210. gbinv283.seq - Invertebrate sequence entries, part 283.
3211. gbinv284.seq - Invertebrate sequence entries, part 284.
3212. gbinv285.seq - Invertebrate sequence entries, part 285.
3213. gbinv286.seq - Invertebrate sequence entries, part 286.
3214. gbinv287.seq - Invertebrate sequence entries, part 287.
3215. gbinv288.seq - Invertebrate sequence entries, part 288.
3216. gbinv289.seq - Invertebrate sequence entries, part 289.
3217. gbinv29.seq - Invertebrate sequence entries, part 29.
3218. gbinv290.seq - Invertebrate sequence entries, part 290.
3219. gbinv291.seq - Invertebrate sequence entries, part 291.
3220. gbinv292.seq - Invertebrate sequence entries, part 292.
3221. gbinv293.seq - Invertebrate sequence entries, part 293.
3222. gbinv294.seq - Invertebrate sequence entries, part 294.
3223. gbinv295.seq - Invertebrate sequence entries, part 295.
3224. gbinv296.seq - Invertebrate sequence entries, part 296.
3225. gbinv297.seq - Invertebrate sequence entries, part 297.
3226. gbinv298.seq - Invertebrate sequence entries, part 298.
3227. gbinv299.seq - Invertebrate sequence entries, part 299.
3228. gbinv3.seq - Invertebrate sequence entries, part 3.
3229. gbinv30.seq - Invertebrate sequence entries, part 30.
3230. gbinv300.seq - Invertebrate sequence entries, part 300.
3231. gbinv301.seq - Invertebrate sequence entries, part 301.
3232. gbinv302.seq - Invertebrate sequence entries, part 302.
3233. gbinv303.seq - Invertebrate sequence entries, part 303.
3234. gbinv304.seq - Invertebrate sequence entries, part 304.
3235. gbinv305.seq - Invertebrate sequence entries, part 305.
3236. gbinv306.seq - Invertebrate sequence entries, part 306.
3237. gbinv307.seq - Invertebrate sequence entries, part 307.
3238. gbinv308.seq - Invertebrate sequence entries, part 308.
3239. gbinv309.seq - Invertebrate sequence entries, part 309.
3240. gbinv31.seq - Invertebrate sequence entries, part 31.
3241. gbinv310.seq - Invertebrate sequence entries, part 310.
3242. gbinv311.seq - Invertebrate sequence entries, part 311.
3243. gbinv312.seq - Invertebrate sequence entries, part 312.
3244. gbinv313.seq - Invertebrate sequence entries, part 313.
3245. gbinv314.seq - Invertebrate sequence entries, part 314.
3246. gbinv315.seq - Invertebrate sequence entries, part 315.
3247. gbinv316.seq - Invertebrate sequence entries, part 316.
3248. gbinv317.seq - Invertebrate sequence entries, part 317.
3249. gbinv318.seq - Invertebrate sequence entries, part 318.
3250. gbinv319.seq - Invertebrate sequence entries, part 319.
3251. gbinv32.seq - Invertebrate sequence entries, part 32.
3252. gbinv320.seq - Invertebrate sequence entries, part 320.
3253. gbinv321.seq - Invertebrate sequence entries, part 321.
3254. gbinv322.seq - Invertebrate sequence entries, part 322.
3255. gbinv323.seq - Invertebrate sequence entries, part 323.
3256. gbinv324.seq - Invertebrate sequence entries, part 324.
3257. gbinv325.seq - Invertebrate sequence entries, part 325.
3258. gbinv326.seq - Invertebrate sequence entries, part 326.
3259. gbinv327.seq - Invertebrate sequence entries, part 327.
3260. gbinv328.seq - Invertebrate sequence entries, part 328.
3261. gbinv329.seq - Invertebrate sequence entries, part 329.
3262. gbinv33.seq - Invertebrate sequence entries, part 33.
3263. gbinv330.seq - Invertebrate sequence entries, part 330.
3264. gbinv331.seq - Invertebrate sequence entries, part 331.
3265. gbinv332.seq - Invertebrate sequence entries, part 332.
3266. gbinv333.seq - Invertebrate sequence entries, part 333.
3267. gbinv334.seq - Invertebrate sequence entries, part 334.
3268. gbinv335.seq - Invertebrate sequence entries, part 335.
3269. gbinv336.seq - Invertebrate sequence entries, part 336.
3270. gbinv337.seq - Invertebrate sequence entries, part 337.
3271. gbinv338.seq - Invertebrate sequence entries, part 338.
3272. gbinv339.seq - Invertebrate sequence entries, part 339.
3273. gbinv34.seq - Invertebrate sequence entries, part 34.
3274. gbinv340.seq - Invertebrate sequence entries, part 340.
3275. gbinv341.seq - Invertebrate sequence entries, part 341.
3276. gbinv342.seq - Invertebrate sequence entries, part 342.
3277. gbinv343.seq - Invertebrate sequence entries, part 343.
3278. gbinv344.seq - Invertebrate sequence entries, part 344.
3279. gbinv345.seq - Invertebrate sequence entries, part 345.
3280. gbinv346.seq - Invertebrate sequence entries, part 346.
3281. gbinv347.seq - Invertebrate sequence entries, part 347.
3282. gbinv348.seq - Invertebrate sequence entries, part 348.
3283. gbinv349.seq - Invertebrate sequence entries, part 349.
3284. gbinv35.seq - Invertebrate sequence entries, part 35.
3285. gbinv350.seq - Invertebrate sequence entries, part 350.
3286. gbinv351.seq - Invertebrate sequence entries, part 351.
3287. gbinv352.seq - Invertebrate sequence entries, part 352.
3288. gbinv353.seq - Invertebrate sequence entries, part 353.
3289. gbinv354.seq - Invertebrate sequence entries, part 354.
3290. gbinv355.seq - Invertebrate sequence entries, part 355.
3291. gbinv356.seq - Invertebrate sequence entries, part 356.
3292. gbinv357.seq - Invertebrate sequence entries, part 357.
3293. gbinv358.seq - Invertebrate sequence entries, part 358.
3294. gbinv359.seq - Invertebrate sequence entries, part 359.
3295. gbinv36.seq - Invertebrate sequence entries, part 36.
3296. gbinv360.seq - Invertebrate sequence entries, part 360.
3297. gbinv361.seq - Invertebrate sequence entries, part 361.
3298. gbinv362.seq - Invertebrate sequence entries, part 362.
3299. gbinv363.seq - Invertebrate sequence entries, part 363.
3300. gbinv364.seq - Invertebrate sequence entries, part 364.
3301. gbinv365.seq - Invertebrate sequence entries, part 365.
3302. gbinv366.seq - Invertebrate sequence entries, part 366.
3303. gbinv367.seq - Invertebrate sequence entries, part 367.
3304. gbinv368.seq - Invertebrate sequence entries, part 368.
3305. gbinv369.seq - Invertebrate sequence entries, part 369.
3306. gbinv37.seq - Invertebrate sequence entries, part 37.
3307. gbinv370.seq - Invertebrate sequence entries, part 370.
3308. gbinv371.seq - Invertebrate sequence entries, part 371.
3309. gbinv372.seq - Invertebrate sequence entries, part 372.
3310. gbinv373.seq - Invertebrate sequence entries, part 373.
3311. gbinv374.seq - Invertebrate sequence entries, part 374.
3312. gbinv375.seq - Invertebrate sequence entries, part 375.
3313. gbinv376.seq - Invertebrate sequence entries, part 376.
3314. gbinv377.seq - Invertebrate sequence entries, part 377.
3315. gbinv378.seq - Invertebrate sequence entries, part 378.
3316. gbinv379.seq - Invertebrate sequence entries, part 379.
3317. gbinv38.seq - Invertebrate sequence entries, part 38.
3318. gbinv380.seq - Invertebrate sequence entries, part 380.
3319. gbinv381.seq - Invertebrate sequence entries, part 381.
3320. gbinv382.seq - Invertebrate sequence entries, part 382.
3321. gbinv383.seq - Invertebrate sequence entries, part 383.
3322. gbinv384.seq - Invertebrate sequence entries, part 384.
3323. gbinv385.seq - Invertebrate sequence entries, part 385.
3324. gbinv386.seq - Invertebrate sequence entries, part 386.
3325. gbinv387.seq - Invertebrate sequence entries, part 387.
3326. gbinv388.seq - Invertebrate sequence entries, part 388.
3327. gbinv389.seq - Invertebrate sequence entries, part 389.
3328. gbinv39.seq - Invertebrate sequence entries, part 39.
3329. gbinv390.seq - Invertebrate sequence entries, part 390.
3330. gbinv391.seq - Invertebrate sequence entries, part 391.
3331. gbinv392.seq - Invertebrate sequence entries, part 392.
3332. gbinv393.seq - Invertebrate sequence entries, part 393.
3333. gbinv394.seq - Invertebrate sequence entries, part 394.
3334. gbinv395.seq - Invertebrate sequence entries, part 395.
3335. gbinv396.seq - Invertebrate sequence entries, part 396.
3336. gbinv397.seq - Invertebrate sequence entries, part 397.
3337. gbinv398.seq - Invertebrate sequence entries, part 398.
3338. gbinv399.seq - Invertebrate sequence entries, part 399.
3339. gbinv4.seq - Invertebrate sequence entries, part 4.
3340. gbinv40.seq - Invertebrate sequence entries, part 40.
3341. gbinv400.seq - Invertebrate sequence entries, part 400.
3342. gbinv401.seq - Invertebrate sequence entries, part 401.
3343. gbinv402.seq - Invertebrate sequence entries, part 402.
3344. gbinv403.seq - Invertebrate sequence entries, part 403.
3345. gbinv404.seq - Invertebrate sequence entries, part 404.
3346. gbinv405.seq - Invertebrate sequence entries, part 405.
3347. gbinv406.seq - Invertebrate sequence entries, part 406.
3348. gbinv407.seq - Invertebrate sequence entries, part 407.
3349. gbinv408.seq - Invertebrate sequence entries, part 408.
3350. gbinv409.seq - Invertebrate sequence entries, part 409.
3351. gbinv41.seq - Invertebrate sequence entries, part 41.
3352. gbinv410.seq - Invertebrate sequence entries, part 410.
3353. gbinv411.seq - Invertebrate sequence entries, part 411.
3354. gbinv412.seq - Invertebrate sequence entries, part 412.
3355. gbinv413.seq - Invertebrate sequence entries, part 413.
3356. gbinv414.seq - Invertebrate sequence entries, part 414.
3357. gbinv415.seq - Invertebrate sequence entries, part 415.
3358. gbinv416.seq - Invertebrate sequence entries, part 416.
3359. gbinv417.seq - Invertebrate sequence entries, part 417.
3360. gbinv418.seq - Invertebrate sequence entries, part 418.
3361. gbinv419.seq - Invertebrate sequence entries, part 419.
3362. gbinv42.seq - Invertebrate sequence entries, part 42.
3363. gbinv420.seq - Invertebrate sequence entries, part 420.
3364. gbinv421.seq - Invertebrate sequence entries, part 421.
3365. gbinv422.seq - Invertebrate sequence entries, part 422.
3366. gbinv423.seq - Invertebrate sequence entries, part 423.
3367. gbinv424.seq - Invertebrate sequence entries, part 424.
3368. gbinv425.seq - Invertebrate sequence entries, part 425.
3369. gbinv426.seq - Invertebrate sequence entries, part 426.
3370. gbinv427.seq - Invertebrate sequence entries, part 427.
3371. gbinv428.seq - Invertebrate sequence entries, part 428.
3372. gbinv429.seq - Invertebrate sequence entries, part 429.
3373. gbinv43.seq - Invertebrate sequence entries, part 43.
3374. gbinv430.seq - Invertebrate sequence entries, part 430.
3375. gbinv431.seq - Invertebrate sequence entries, part 431.
3376. gbinv432.seq - Invertebrate sequence entries, part 432.
3377. gbinv433.seq - Invertebrate sequence entries, part 433.
3378. gbinv434.seq - Invertebrate sequence entries, part 434.
3379. gbinv435.seq - Invertebrate sequence entries, part 435.
3380. gbinv436.seq - Invertebrate sequence entries, part 436.
3381. gbinv437.seq - Invertebrate sequence entries, part 437.
3382. gbinv438.seq - Invertebrate sequence entries, part 438.
3383. gbinv439.seq - Invertebrate sequence entries, part 439.
3384. gbinv44.seq - Invertebrate sequence entries, part 44.
3385. gbinv440.seq - Invertebrate sequence entries, part 440.
3386. gbinv441.seq - Invertebrate sequence entries, part 441.
3387. gbinv442.seq - Invertebrate sequence entries, part 442.
3388. gbinv443.seq - Invertebrate sequence entries, part 443.
3389. gbinv444.seq - Invertebrate sequence entries, part 444.
3390. gbinv445.seq - Invertebrate sequence entries, part 445.
3391. gbinv446.seq - Invertebrate sequence entries, part 446.
3392. gbinv447.seq - Invertebrate sequence entries, part 447.
3393. gbinv448.seq - Invertebrate sequence entries, part 448.
3394. gbinv449.seq - Invertebrate sequence entries, part 449.
3395. gbinv45.seq - Invertebrate sequence entries, part 45.
3396. gbinv450.seq - Invertebrate sequence entries, part 450.
3397. gbinv451.seq - Invertebrate sequence entries, part 451.
3398. gbinv452.seq - Invertebrate sequence entries, part 452.
3399. gbinv453.seq - Invertebrate sequence entries, part 453.
3400. gbinv454.seq - Invertebrate sequence entries, part 454.
3401. gbinv455.seq - Invertebrate sequence entries, part 455.
3402. gbinv456.seq - Invertebrate sequence entries, part 456.
3403. gbinv457.seq - Invertebrate sequence entries, part 457.
3404. gbinv458.seq - Invertebrate sequence entries, part 458.
3405. gbinv459.seq - Invertebrate sequence entries, part 459.
3406. gbinv46.seq - Invertebrate sequence entries, part 46.
3407. gbinv460.seq - Invertebrate sequence entries, part 460.
3408. gbinv461.seq - Invertebrate sequence entries, part 461.
3409. gbinv462.seq - Invertebrate sequence entries, part 462.
3410. gbinv463.seq - Invertebrate sequence entries, part 463.
3411. gbinv464.seq - Invertebrate sequence entries, part 464.
3412. gbinv465.seq - Invertebrate sequence entries, part 465.
3413. gbinv466.seq - Invertebrate sequence entries, part 466.
3414. gbinv467.seq - Invertebrate sequence entries, part 467.
3415. gbinv468.seq - Invertebrate sequence entries, part 468.
3416. gbinv469.seq - Invertebrate sequence entries, part 469.
3417. gbinv47.seq - Invertebrate sequence entries, part 47.
3418. gbinv470.seq - Invertebrate sequence entries, part 470.
3419. gbinv471.seq - Invertebrate sequence entries, part 471.
3420. gbinv472.seq - Invertebrate sequence entries, part 472.
3421. gbinv473.seq - Invertebrate sequence entries, part 473.
3422. gbinv474.seq - Invertebrate sequence entries, part 474.
3423. gbinv475.seq - Invertebrate sequence entries, part 475.
3424. gbinv476.seq - Invertebrate sequence entries, part 476.
3425. gbinv477.seq - Invertebrate sequence entries, part 477.
3426. gbinv478.seq - Invertebrate sequence entries, part 478.
3427. gbinv479.seq - Invertebrate sequence entries, part 479.
3428. gbinv48.seq - Invertebrate sequence entries, part 48.
3429. gbinv480.seq - Invertebrate sequence entries, part 480.
3430. gbinv481.seq - Invertebrate sequence entries, part 481.
3431. gbinv482.seq - Invertebrate sequence entries, part 482.
3432. gbinv483.seq - Invertebrate sequence entries, part 483.
3433. gbinv484.seq - Invertebrate sequence entries, part 484.
3434. gbinv485.seq - Invertebrate sequence entries, part 485.
3435. gbinv486.seq - Invertebrate sequence entries, part 486.
3436. gbinv487.seq - Invertebrate sequence entries, part 487.
3437. gbinv488.seq - Invertebrate sequence entries, part 488.
3438. gbinv489.seq - Invertebrate sequence entries, part 489.
3439. gbinv49.seq - Invertebrate sequence entries, part 49.
3440. gbinv490.seq - Invertebrate sequence entries, part 490.
3441. gbinv491.seq - Invertebrate sequence entries, part 491.
3442. gbinv492.seq - Invertebrate sequence entries, part 492.
3443. gbinv493.seq - Invertebrate sequence entries, part 493.
3444. gbinv494.seq - Invertebrate sequence entries, part 494.
3445. gbinv495.seq - Invertebrate sequence entries, part 495.
3446. gbinv496.seq - Invertebrate sequence entries, part 496.
3447. gbinv497.seq - Invertebrate sequence entries, part 497.
3448. gbinv498.seq - Invertebrate sequence entries, part 498.
3449. gbinv499.seq - Invertebrate sequence entries, part 499.
3450. gbinv5.seq - Invertebrate sequence entries, part 5.
3451. gbinv50.seq - Invertebrate sequence entries, part 50.
3452. gbinv500.seq - Invertebrate sequence entries, part 500.
3453. gbinv501.seq - Invertebrate sequence entries, part 501.
3454. gbinv502.seq - Invertebrate sequence entries, part 502.
3455. gbinv503.seq - Invertebrate sequence entries, part 503.
3456. gbinv504.seq - Invertebrate sequence entries, part 504.
3457. gbinv505.seq - Invertebrate sequence entries, part 505.
3458. gbinv506.seq - Invertebrate sequence entries, part 506.
3459. gbinv507.seq - Invertebrate sequence entries, part 507.
3460. gbinv508.seq - Invertebrate sequence entries, part 508.
3461. gbinv509.seq - Invertebrate sequence entries, part 509.
3462. gbinv51.seq - Invertebrate sequence entries, part 51.
3463. gbinv510.seq - Invertebrate sequence entries, part 510.
3464. gbinv511.seq - Invertebrate sequence entries, part 511.
3465. gbinv512.seq - Invertebrate sequence entries, part 512.
3466. gbinv513.seq - Invertebrate sequence entries, part 513.
3467. gbinv514.seq - Invertebrate sequence entries, part 514.
3468. gbinv515.seq - Invertebrate sequence entries, part 515.
3469. gbinv516.seq - Invertebrate sequence entries, part 516.
3470. gbinv517.seq - Invertebrate sequence entries, part 517.
3471. gbinv518.seq - Invertebrate sequence entries, part 518.
3472. gbinv519.seq - Invertebrate sequence entries, part 519.
3473. gbinv52.seq - Invertebrate sequence entries, part 52.
3474. gbinv520.seq - Invertebrate sequence entries, part 520.
3475. gbinv521.seq - Invertebrate sequence entries, part 521.
3476. gbinv522.seq - Invertebrate sequence entries, part 522.
3477. gbinv523.seq - Invertebrate sequence entries, part 523.
3478. gbinv524.seq - Invertebrate sequence entries, part 524.
3479. gbinv525.seq - Invertebrate sequence entries, part 525.
3480. gbinv526.seq - Invertebrate sequence entries, part 526.
3481. gbinv527.seq - Invertebrate sequence entries, part 527.
3482. gbinv528.seq - Invertebrate sequence entries, part 528.
3483. gbinv529.seq - Invertebrate sequence entries, part 529.
3484. gbinv53.seq - Invertebrate sequence entries, part 53.
3485. gbinv530.seq - Invertebrate sequence entries, part 530.
3486. gbinv531.seq - Invertebrate sequence entries, part 531.
3487. gbinv532.seq - Invertebrate sequence entries, part 532.
3488. gbinv533.seq - Invertebrate sequence entries, part 533.
3489. gbinv534.seq - Invertebrate sequence entries, part 534.
3490. gbinv535.seq - Invertebrate sequence entries, part 535.
3491. gbinv536.seq - Invertebrate sequence entries, part 536.
3492. gbinv537.seq - Invertebrate sequence entries, part 537.
3493. gbinv538.seq - Invertebrate sequence entries, part 538.
3494. gbinv539.seq - Invertebrate sequence entries, part 539.
3495. gbinv54.seq - Invertebrate sequence entries, part 54.
3496. gbinv540.seq - Invertebrate sequence entries, part 540.
3497. gbinv541.seq - Invertebrate sequence entries, part 541.
3498. gbinv542.seq - Invertebrate sequence entries, part 542.
3499. gbinv543.seq - Invertebrate sequence entries, part 543.
3500. gbinv544.seq - Invertebrate sequence entries, part 544.
3501. gbinv545.seq - Invertebrate sequence entries, part 545.
3502. gbinv546.seq - Invertebrate sequence entries, part 546.
3503. gbinv547.seq - Invertebrate sequence entries, part 547.
3504. gbinv548.seq - Invertebrate sequence entries, part 548.
3505. gbinv549.seq - Invertebrate sequence entries, part 549.
3506. gbinv55.seq - Invertebrate sequence entries, part 55.
3507. gbinv550.seq - Invertebrate sequence entries, part 550.
3508. gbinv551.seq - Invertebrate sequence entries, part 551.
3509. gbinv552.seq - Invertebrate sequence entries, part 552.
3510. gbinv553.seq - Invertebrate sequence entries, part 553.
3511. gbinv554.seq - Invertebrate sequence entries, part 554.
3512. gbinv555.seq - Invertebrate sequence entries, part 555.
3513. gbinv556.seq - Invertebrate sequence entries, part 556.
3514. gbinv557.seq - Invertebrate sequence entries, part 557.
3515. gbinv558.seq - Invertebrate sequence entries, part 558.
3516. gbinv559.seq - Invertebrate sequence entries, part 559.
3517. gbinv56.seq - Invertebrate sequence entries, part 56.
3518. gbinv560.seq - Invertebrate sequence entries, part 560.
3519. gbinv561.seq - Invertebrate sequence entries, part 561.
3520. gbinv562.seq - Invertebrate sequence entries, part 562.
3521. gbinv563.seq - Invertebrate sequence entries, part 563.
3522. gbinv564.seq - Invertebrate sequence entries, part 564.
3523. gbinv565.seq - Invertebrate sequence entries, part 565.
3524. gbinv566.seq - Invertebrate sequence entries, part 566.
3525. gbinv567.seq - Invertebrate sequence entries, part 567.
3526. gbinv568.seq - Invertebrate sequence entries, part 568.
3527. gbinv569.seq - Invertebrate sequence entries, part 569.
3528. gbinv57.seq - Invertebrate sequence entries, part 57.
3529. gbinv570.seq - Invertebrate sequence entries, part 570.
3530. gbinv571.seq - Invertebrate sequence entries, part 571.
3531. gbinv572.seq - Invertebrate sequence entries, part 572.
3532. gbinv573.seq - Invertebrate sequence entries, part 573.
3533. gbinv574.seq - Invertebrate sequence entries, part 574.
3534. gbinv575.seq - Invertebrate sequence entries, part 575.
3535. gbinv576.seq - Invertebrate sequence entries, part 576.
3536. gbinv577.seq - Invertebrate sequence entries, part 577.
3537. gbinv578.seq - Invertebrate sequence entries, part 578.
3538. gbinv579.seq - Invertebrate sequence entries, part 579.
3539. gbinv58.seq - Invertebrate sequence entries, part 58.
3540. gbinv580.seq - Invertebrate sequence entries, part 580.
3541. gbinv581.seq - Invertebrate sequence entries, part 581.
3542. gbinv582.seq - Invertebrate sequence entries, part 582.
3543. gbinv583.seq - Invertebrate sequence entries, part 583.
3544. gbinv584.seq - Invertebrate sequence entries, part 584.
3545. gbinv585.seq - Invertebrate sequence entries, part 585.
3546. gbinv586.seq - Invertebrate sequence entries, part 586.
3547. gbinv587.seq - Invertebrate sequence entries, part 587.
3548. gbinv588.seq - Invertebrate sequence entries, part 588.
3549. gbinv589.seq - Invertebrate sequence entries, part 589.
3550. gbinv59.seq - Invertebrate sequence entries, part 59.
3551. gbinv590.seq - Invertebrate sequence entries, part 590.
3552. gbinv591.seq - Invertebrate sequence entries, part 591.
3553. gbinv592.seq - Invertebrate sequence entries, part 592.
3554. gbinv593.seq - Invertebrate sequence entries, part 593.
3555. gbinv594.seq - Invertebrate sequence entries, part 594.
3556. gbinv595.seq - Invertebrate sequence entries, part 595.
3557. gbinv596.seq - Invertebrate sequence entries, part 596.
3558. gbinv597.seq - Invertebrate sequence entries, part 597.
3559. gbinv598.seq - Invertebrate sequence entries, part 598.
3560. gbinv599.seq - Invertebrate sequence entries, part 599.
3561. gbinv6.seq - Invertebrate sequence entries, part 6.
3562. gbinv60.seq - Invertebrate sequence entries, part 60.
3563. gbinv600.seq - Invertebrate sequence entries, part 600.
3564. gbinv601.seq - Invertebrate sequence entries, part 601.
3565. gbinv602.seq - Invertebrate sequence entries, part 602.
3566. gbinv603.seq - Invertebrate sequence entries, part 603.
3567. gbinv604.seq - Invertebrate sequence entries, part 604.
3568. gbinv605.seq - Invertebrate sequence entries, part 605.
3569. gbinv606.seq - Invertebrate sequence entries, part 606.
3570. gbinv607.seq - Invertebrate sequence entries, part 607.
3571. gbinv608.seq - Invertebrate sequence entries, part 608.
3572. gbinv609.seq - Invertebrate sequence entries, part 609.
3573. gbinv61.seq - Invertebrate sequence entries, part 61.
3574. gbinv610.seq - Invertebrate sequence entries, part 610.
3575. gbinv611.seq - Invertebrate sequence entries, part 611.
3576. gbinv612.seq - Invertebrate sequence entries, part 612.
3577. gbinv613.seq - Invertebrate sequence entries, part 613.
3578. gbinv614.seq - Invertebrate sequence entries, part 614.
3579. gbinv615.seq - Invertebrate sequence entries, part 615.
3580. gbinv616.seq - Invertebrate sequence entries, part 616.
3581. gbinv617.seq - Invertebrate sequence entries, part 617.
3582. gbinv618.seq - Invertebrate sequence entries, part 618.
3583. gbinv619.seq - Invertebrate sequence entries, part 619.
3584. gbinv62.seq - Invertebrate sequence entries, part 62.
3585. gbinv620.seq - Invertebrate sequence entries, part 620.
3586. gbinv621.seq - Invertebrate sequence entries, part 621.
3587. gbinv622.seq - Invertebrate sequence entries, part 622.
3588. gbinv623.seq - Invertebrate sequence entries, part 623.
3589. gbinv624.seq - Invertebrate sequence entries, part 624.
3590. gbinv625.seq - Invertebrate sequence entries, part 625.
3591. gbinv626.seq - Invertebrate sequence entries, part 626.
3592. gbinv627.seq - Invertebrate sequence entries, part 627.
3593. gbinv628.seq - Invertebrate sequence entries, part 628.
3594. gbinv629.seq - Invertebrate sequence entries, part 629.
3595. gbinv63.seq - Invertebrate sequence entries, part 63.
3596. gbinv630.seq - Invertebrate sequence entries, part 630.
3597. gbinv631.seq - Invertebrate sequence entries, part 631.
3598. gbinv632.seq - Invertebrate sequence entries, part 632.
3599. gbinv633.seq - Invertebrate sequence entries, part 633.
3600. gbinv634.seq - Invertebrate sequence entries, part 634.
3601. gbinv635.seq - Invertebrate sequence entries, part 635.
3602. gbinv636.seq - Invertebrate sequence entries, part 636.
3603. gbinv637.seq - Invertebrate sequence entries, part 637.
3604. gbinv638.seq - Invertebrate sequence entries, part 638.
3605. gbinv639.seq - Invertebrate sequence entries, part 639.
3606. gbinv64.seq - Invertebrate sequence entries, part 64.
3607. gbinv640.seq - Invertebrate sequence entries, part 640.
3608. gbinv641.seq - Invertebrate sequence entries, part 641.
3609. gbinv642.seq - Invertebrate sequence entries, part 642.
3610. gbinv643.seq - Invertebrate sequence entries, part 643.
3611. gbinv644.seq - Invertebrate sequence entries, part 644.
3612. gbinv645.seq - Invertebrate sequence entries, part 645.
3613. gbinv646.seq - Invertebrate sequence entries, part 646.
3614. gbinv647.seq - Invertebrate sequence entries, part 647.
3615. gbinv648.seq - Invertebrate sequence entries, part 648.
3616. gbinv649.seq - Invertebrate sequence entries, part 649.
3617. gbinv65.seq - Invertebrate sequence entries, part 65.
3618. gbinv650.seq - Invertebrate sequence entries, part 650.
3619. gbinv651.seq - Invertebrate sequence entries, part 651.
3620. gbinv652.seq - Invertebrate sequence entries, part 652.
3621. gbinv653.seq - Invertebrate sequence entries, part 653.
3622. gbinv654.seq - Invertebrate sequence entries, part 654.
3623. gbinv655.seq - Invertebrate sequence entries, part 655.
3624. gbinv656.seq - Invertebrate sequence entries, part 656.
3625. gbinv657.seq - Invertebrate sequence entries, part 657.
3626. gbinv658.seq - Invertebrate sequence entries, part 658.
3627. gbinv659.seq - Invertebrate sequence entries, part 659.
3628. gbinv66.seq - Invertebrate sequence entries, part 66.
3629. gbinv660.seq - Invertebrate sequence entries, part 660.
3630. gbinv661.seq - Invertebrate sequence entries, part 661.
3631. gbinv662.seq - Invertebrate sequence entries, part 662.
3632. gbinv663.seq - Invertebrate sequence entries, part 663.
3633. gbinv664.seq - Invertebrate sequence entries, part 664.
3634. gbinv665.seq - Invertebrate sequence entries, part 665.
3635. gbinv666.seq - Invertebrate sequence entries, part 666.
3636. gbinv667.seq - Invertebrate sequence entries, part 667.
3637. gbinv668.seq - Invertebrate sequence entries, part 668.
3638. gbinv669.seq - Invertebrate sequence entries, part 669.
3639. gbinv67.seq - Invertebrate sequence entries, part 67.
3640. gbinv670.seq - Invertebrate sequence entries, part 670.
3641. gbinv671.seq - Invertebrate sequence entries, part 671.
3642. gbinv672.seq - Invertebrate sequence entries, part 672.
3643. gbinv673.seq - Invertebrate sequence entries, part 673.
3644. gbinv674.seq - Invertebrate sequence entries, part 674.
3645. gbinv675.seq - Invertebrate sequence entries, part 675.
3646. gbinv676.seq - Invertebrate sequence entries, part 676.
3647. gbinv677.seq - Invertebrate sequence entries, part 677.
3648. gbinv678.seq - Invertebrate sequence entries, part 678.
3649. gbinv679.seq - Invertebrate sequence entries, part 679.
3650. gbinv68.seq - Invertebrate sequence entries, part 68.
3651. gbinv680.seq - Invertebrate sequence entries, part 680.
3652. gbinv681.seq - Invertebrate sequence entries, part 681.
3653. gbinv682.seq - Invertebrate sequence entries, part 682.
3654. gbinv683.seq - Invertebrate sequence entries, part 683.
3655. gbinv684.seq - Invertebrate sequence entries, part 684.
3656. gbinv685.seq - Invertebrate sequence entries, part 685.
3657. gbinv686.seq - Invertebrate sequence entries, part 686.
3658. gbinv687.seq - Invertebrate sequence entries, part 687.
3659. gbinv688.seq - Invertebrate sequence entries, part 688.
3660. gbinv689.seq - Invertebrate sequence entries, part 689.
3661. gbinv69.seq - Invertebrate sequence entries, part 69.
3662. gbinv690.seq - Invertebrate sequence entries, part 690.
3663. gbinv691.seq - Invertebrate sequence entries, part 691.
3664. gbinv692.seq - Invertebrate sequence entries, part 692.
3665. gbinv693.seq - Invertebrate sequence entries, part 693.
3666. gbinv694.seq - Invertebrate sequence entries, part 694.
3667. gbinv695.seq - Invertebrate sequence entries, part 695.
3668. gbinv696.seq - Invertebrate sequence entries, part 696.
3669. gbinv697.seq - Invertebrate sequence entries, part 697.
3670. gbinv698.seq - Invertebrate sequence entries, part 698.
3671. gbinv699.seq - Invertebrate sequence entries, part 699.
3672. gbinv7.seq - Invertebrate sequence entries, part 7.
3673. gbinv70.seq - Invertebrate sequence entries, part 70.
3674. gbinv700.seq - Invertebrate sequence entries, part 700.
3675. gbinv701.seq - Invertebrate sequence entries, part 701.
3676. gbinv702.seq - Invertebrate sequence entries, part 702.
3677. gbinv703.seq - Invertebrate sequence entries, part 703.
3678. gbinv704.seq - Invertebrate sequence entries, part 704.
3679. gbinv705.seq - Invertebrate sequence entries, part 705.
3680. gbinv706.seq - Invertebrate sequence entries, part 706.
3681. gbinv707.seq - Invertebrate sequence entries, part 707.
3682. gbinv708.seq - Invertebrate sequence entries, part 708.
3683. gbinv709.seq - Invertebrate sequence entries, part 709.
3684. gbinv71.seq - Invertebrate sequence entries, part 71.
3685. gbinv710.seq - Invertebrate sequence entries, part 710.
3686. gbinv711.seq - Invertebrate sequence entries, part 711.
3687. gbinv712.seq - Invertebrate sequence entries, part 712.
3688. gbinv713.seq - Invertebrate sequence entries, part 713.
3689. gbinv714.seq - Invertebrate sequence entries, part 714.
3690. gbinv715.seq - Invertebrate sequence entries, part 715.
3691. gbinv716.seq - Invertebrate sequence entries, part 716.
3692. gbinv717.seq - Invertebrate sequence entries, part 717.
3693. gbinv718.seq - Invertebrate sequence entries, part 718.
3694. gbinv719.seq - Invertebrate sequence entries, part 719.
3695. gbinv72.seq - Invertebrate sequence entries, part 72.
3696. gbinv720.seq - Invertebrate sequence entries, part 720.
3697. gbinv721.seq - Invertebrate sequence entries, part 721.
3698. gbinv722.seq - Invertebrate sequence entries, part 722.
3699. gbinv723.seq - Invertebrate sequence entries, part 723.
3700. gbinv724.seq - Invertebrate sequence entries, part 724.
3701. gbinv725.seq - Invertebrate sequence entries, part 725.
3702. gbinv726.seq - Invertebrate sequence entries, part 726.
3703. gbinv727.seq - Invertebrate sequence entries, part 727.
3704. gbinv728.seq - Invertebrate sequence entries, part 728.
3705. gbinv729.seq - Invertebrate sequence entries, part 729.
3706. gbinv73.seq - Invertebrate sequence entries, part 73.
3707. gbinv730.seq - Invertebrate sequence entries, part 730.
3708. gbinv731.seq - Invertebrate sequence entries, part 731.
3709. gbinv732.seq - Invertebrate sequence entries, part 732.
3710. gbinv733.seq - Invertebrate sequence entries, part 733.
3711. gbinv734.seq - Invertebrate sequence entries, part 734.
3712. gbinv735.seq - Invertebrate sequence entries, part 735.
3713. gbinv736.seq - Invertebrate sequence entries, part 736.
3714. gbinv737.seq - Invertebrate sequence entries, part 737.
3715. gbinv738.seq - Invertebrate sequence entries, part 738.
3716. gbinv739.seq - Invertebrate sequence entries, part 739.
3717. gbinv74.seq - Invertebrate sequence entries, part 74.
3718. gbinv740.seq - Invertebrate sequence entries, part 740.
3719. gbinv741.seq - Invertebrate sequence entries, part 741.
3720. gbinv742.seq - Invertebrate sequence entries, part 742.
3721. gbinv743.seq - Invertebrate sequence entries, part 743.
3722. gbinv744.seq - Invertebrate sequence entries, part 744.
3723. gbinv745.seq - Invertebrate sequence entries, part 745.
3724. gbinv746.seq - Invertebrate sequence entries, part 746.
3725. gbinv747.seq - Invertebrate sequence entries, part 747.
3726. gbinv748.seq - Invertebrate sequence entries, part 748.
3727. gbinv749.seq - Invertebrate sequence entries, part 749.
3728. gbinv75.seq - Invertebrate sequence entries, part 75.
3729. gbinv750.seq - Invertebrate sequence entries, part 750.
3730. gbinv751.seq - Invertebrate sequence entries, part 751.
3731. gbinv752.seq - Invertebrate sequence entries, part 752.
3732. gbinv753.seq - Invertebrate sequence entries, part 753.
3733. gbinv754.seq - Invertebrate sequence entries, part 754.
3734. gbinv755.seq - Invertebrate sequence entries, part 755.
3735. gbinv756.seq - Invertebrate sequence entries, part 756.
3736. gbinv757.seq - Invertebrate sequence entries, part 757.
3737. gbinv758.seq - Invertebrate sequence entries, part 758.
3738. gbinv759.seq - Invertebrate sequence entries, part 759.
3739. gbinv76.seq - Invertebrate sequence entries, part 76.
3740. gbinv760.seq - Invertebrate sequence entries, part 760.
3741. gbinv761.seq - Invertebrate sequence entries, part 761.
3742. gbinv762.seq - Invertebrate sequence entries, part 762.
3743. gbinv763.seq - Invertebrate sequence entries, part 763.
3744. gbinv764.seq - Invertebrate sequence entries, part 764.
3745. gbinv765.seq - Invertebrate sequence entries, part 765.
3746. gbinv766.seq - Invertebrate sequence entries, part 766.
3747. gbinv767.seq - Invertebrate sequence entries, part 767.
3748. gbinv768.seq - Invertebrate sequence entries, part 768.
3749. gbinv769.seq - Invertebrate sequence entries, part 769.
3750. gbinv77.seq - Invertebrate sequence entries, part 77.
3751. gbinv770.seq - Invertebrate sequence entries, part 770.
3752. gbinv771.seq - Invertebrate sequence entries, part 771.
3753. gbinv772.seq - Invertebrate sequence entries, part 772.
3754. gbinv773.seq - Invertebrate sequence entries, part 773.
3755. gbinv774.seq - Invertebrate sequence entries, part 774.
3756. gbinv775.seq - Invertebrate sequence entries, part 775.
3757. gbinv776.seq - Invertebrate sequence entries, part 776.
3758. gbinv777.seq - Invertebrate sequence entries, part 777.
3759. gbinv778.seq - Invertebrate sequence entries, part 778.
3760. gbinv779.seq - Invertebrate sequence entries, part 779.
3761. gbinv78.seq - Invertebrate sequence entries, part 78.
3762. gbinv780.seq - Invertebrate sequence entries, part 780.
3763. gbinv781.seq - Invertebrate sequence entries, part 781.
3764. gbinv782.seq - Invertebrate sequence entries, part 782.
3765. gbinv783.seq - Invertebrate sequence entries, part 783.
3766. gbinv784.seq - Invertebrate sequence entries, part 784.
3767. gbinv785.seq - Invertebrate sequence entries, part 785.
3768. gbinv786.seq - Invertebrate sequence entries, part 786.
3769. gbinv787.seq - Invertebrate sequence entries, part 787.
3770. gbinv788.seq - Invertebrate sequence entries, part 788.
3771. gbinv789.seq - Invertebrate sequence entries, part 789.
3772. gbinv79.seq - Invertebrate sequence entries, part 79.
3773. gbinv790.seq - Invertebrate sequence entries, part 790.
3774. gbinv791.seq - Invertebrate sequence entries, part 791.
3775. gbinv792.seq - Invertebrate sequence entries, part 792.
3776. gbinv793.seq - Invertebrate sequence entries, part 793.
3777. gbinv794.seq - Invertebrate sequence entries, part 794.
3778. gbinv795.seq - Invertebrate sequence entries, part 795.
3779. gbinv796.seq - Invertebrate sequence entries, part 796.
3780. gbinv797.seq - Invertebrate sequence entries, part 797.
3781. gbinv798.seq - Invertebrate sequence entries, part 798.
3782. gbinv799.seq - Invertebrate sequence entries, part 799.
3783. gbinv8.seq - Invertebrate sequence entries, part 8.
3784. gbinv80.seq - Invertebrate sequence entries, part 80.
3785. gbinv800.seq - Invertebrate sequence entries, part 800.
3786. gbinv801.seq - Invertebrate sequence entries, part 801.
3787. gbinv802.seq - Invertebrate sequence entries, part 802.
3788. gbinv803.seq - Invertebrate sequence entries, part 803.
3789. gbinv804.seq - Invertebrate sequence entries, part 804.
3790. gbinv805.seq - Invertebrate sequence entries, part 805.
3791. gbinv806.seq - Invertebrate sequence entries, part 806.
3792. gbinv807.seq - Invertebrate sequence entries, part 807.
3793. gbinv808.seq - Invertebrate sequence entries, part 808.
3794. gbinv809.seq - Invertebrate sequence entries, part 809.
3795. gbinv81.seq - Invertebrate sequence entries, part 81.
3796. gbinv810.seq - Invertebrate sequence entries, part 810.
3797. gbinv811.seq - Invertebrate sequence entries, part 811.
3798. gbinv812.seq - Invertebrate sequence entries, part 812.
3799. gbinv813.seq - Invertebrate sequence entries, part 813.
3800. gbinv814.seq - Invertebrate sequence entries, part 814.
3801. gbinv815.seq - Invertebrate sequence entries, part 815.
3802. gbinv816.seq - Invertebrate sequence entries, part 816.
3803. gbinv817.seq - Invertebrate sequence entries, part 817.
3804. gbinv818.seq - Invertebrate sequence entries, part 818.
3805. gbinv819.seq - Invertebrate sequence entries, part 819.
3806. gbinv82.seq - Invertebrate sequence entries, part 82.
3807. gbinv820.seq - Invertebrate sequence entries, part 820.
3808. gbinv821.seq - Invertebrate sequence entries, part 821.
3809. gbinv822.seq - Invertebrate sequence entries, part 822.
3810. gbinv823.seq - Invertebrate sequence entries, part 823.
3811. gbinv824.seq - Invertebrate sequence entries, part 824.
3812. gbinv825.seq - Invertebrate sequence entries, part 825.
3813. gbinv826.seq - Invertebrate sequence entries, part 826.
3814. gbinv827.seq - Invertebrate sequence entries, part 827.
3815. gbinv828.seq - Invertebrate sequence entries, part 828.
3816. gbinv829.seq - Invertebrate sequence entries, part 829.
3817. gbinv83.seq - Invertebrate sequence entries, part 83.
3818. gbinv830.seq - Invertebrate sequence entries, part 830.
3819. gbinv831.seq - Invertebrate sequence entries, part 831.
3820. gbinv832.seq - Invertebrate sequence entries, part 832.
3821. gbinv833.seq - Invertebrate sequence entries, part 833.
3822. gbinv834.seq - Invertebrate sequence entries, part 834.
3823. gbinv835.seq - Invertebrate sequence entries, part 835.
3824. gbinv836.seq - Invertebrate sequence entries, part 836.
3825. gbinv837.seq - Invertebrate sequence entries, part 837.
3826. gbinv838.seq - Invertebrate sequence entries, part 838.
3827. gbinv839.seq - Invertebrate sequence entries, part 839.
3828. gbinv84.seq - Invertebrate sequence entries, part 84.
3829. gbinv840.seq - Invertebrate sequence entries, part 840.
3830. gbinv841.seq - Invertebrate sequence entries, part 841.
3831. gbinv842.seq - Invertebrate sequence entries, part 842.
3832. gbinv843.seq - Invertebrate sequence entries, part 843.
3833. gbinv844.seq - Invertebrate sequence entries, part 844.
3834. gbinv845.seq - Invertebrate sequence entries, part 845.
3835. gbinv846.seq - Invertebrate sequence entries, part 846.
3836. gbinv847.seq - Invertebrate sequence entries, part 847.
3837. gbinv848.seq - Invertebrate sequence entries, part 848.
3838. gbinv849.seq - Invertebrate sequence entries, part 849.
3839. gbinv85.seq - Invertebrate sequence entries, part 85.
3840. gbinv850.seq - Invertebrate sequence entries, part 850.
3841. gbinv851.seq - Invertebrate sequence entries, part 851.
3842. gbinv852.seq - Invertebrate sequence entries, part 852.
3843. gbinv853.seq - Invertebrate sequence entries, part 853.
3844. gbinv854.seq - Invertebrate sequence entries, part 854.
3845. gbinv855.seq - Invertebrate sequence entries, part 855.
3846. gbinv856.seq - Invertebrate sequence entries, part 856.
3847. gbinv857.seq - Invertebrate sequence entries, part 857.
3848. gbinv858.seq - Invertebrate sequence entries, part 858.
3849. gbinv859.seq - Invertebrate sequence entries, part 859.
3850. gbinv86.seq - Invertebrate sequence entries, part 86.
3851. gbinv860.seq - Invertebrate sequence entries, part 860.
3852. gbinv861.seq - Invertebrate sequence entries, part 861.
3853. gbinv862.seq - Invertebrate sequence entries, part 862.
3854. gbinv863.seq - Invertebrate sequence entries, part 863.
3855. gbinv864.seq - Invertebrate sequence entries, part 864.
3856. gbinv865.seq - Invertebrate sequence entries, part 865.
3857. gbinv866.seq - Invertebrate sequence entries, part 866.
3858. gbinv867.seq - Invertebrate sequence entries, part 867.
3859. gbinv868.seq - Invertebrate sequence entries, part 868.
3860. gbinv869.seq - Invertebrate sequence entries, part 869.
3861. gbinv87.seq - Invertebrate sequence entries, part 87.
3862. gbinv870.seq - Invertebrate sequence entries, part 870.
3863. gbinv871.seq - Invertebrate sequence entries, part 871.
3864. gbinv872.seq - Invertebrate sequence entries, part 872.
3865. gbinv873.seq - Invertebrate sequence entries, part 873.
3866. gbinv874.seq - Invertebrate sequence entries, part 874.
3867. gbinv875.seq - Invertebrate sequence entries, part 875.
3868. gbinv876.seq - Invertebrate sequence entries, part 876.
3869. gbinv877.seq - Invertebrate sequence entries, part 877.
3870. gbinv878.seq - Invertebrate sequence entries, part 878.
3871. gbinv879.seq - Invertebrate sequence entries, part 879.
3872. gbinv88.seq - Invertebrate sequence entries, part 88.
3873. gbinv880.seq - Invertebrate sequence entries, part 880.
3874. gbinv881.seq - Invertebrate sequence entries, part 881.
3875. gbinv882.seq - Invertebrate sequence entries, part 882.
3876. gbinv883.seq - Invertebrate sequence entries, part 883.
3877. gbinv884.seq - Invertebrate sequence entries, part 884.
3878. gbinv885.seq - Invertebrate sequence entries, part 885.
3879. gbinv886.seq - Invertebrate sequence entries, part 886.
3880. gbinv887.seq - Invertebrate sequence entries, part 887.
3881. gbinv888.seq - Invertebrate sequence entries, part 888.
3882. gbinv889.seq - Invertebrate sequence entries, part 889.
3883. gbinv89.seq - Invertebrate sequence entries, part 89.
3884. gbinv890.seq - Invertebrate sequence entries, part 890.
3885. gbinv891.seq - Invertebrate sequence entries, part 891.
3886. gbinv892.seq - Invertebrate sequence entries, part 892.
3887. gbinv893.seq - Invertebrate sequence entries, part 893.
3888. gbinv894.seq - Invertebrate sequence entries, part 894.
3889. gbinv895.seq - Invertebrate sequence entries, part 895.
3890. gbinv896.seq - Invertebrate sequence entries, part 896.
3891. gbinv897.seq - Invertebrate sequence entries, part 897.
3892. gbinv898.seq - Invertebrate sequence entries, part 898.
3893. gbinv899.seq - Invertebrate sequence entries, part 899.
3894. gbinv9.seq - Invertebrate sequence entries, part 9.
3895. gbinv90.seq - Invertebrate sequence entries, part 90.
3896. gbinv900.seq - Invertebrate sequence entries, part 900.
3897. gbinv901.seq - Invertebrate sequence entries, part 901.
3898. gbinv902.seq - Invertebrate sequence entries, part 902.
3899. gbinv903.seq - Invertebrate sequence entries, part 903.
3900. gbinv904.seq - Invertebrate sequence entries, part 904.
3901. gbinv905.seq - Invertebrate sequence entries, part 905.
3902. gbinv906.seq - Invertebrate sequence entries, part 906.
3903. gbinv907.seq - Invertebrate sequence entries, part 907.
3904. gbinv908.seq - Invertebrate sequence entries, part 908.
3905. gbinv909.seq - Invertebrate sequence entries, part 909.
3906. gbinv91.seq - Invertebrate sequence entries, part 91.
3907. gbinv910.seq - Invertebrate sequence entries, part 910.
3908. gbinv911.seq - Invertebrate sequence entries, part 911.
3909. gbinv912.seq - Invertebrate sequence entries, part 912.
3910. gbinv913.seq - Invertebrate sequence entries, part 913.
3911. gbinv914.seq - Invertebrate sequence entries, part 914.
3912. gbinv915.seq - Invertebrate sequence entries, part 915.
3913. gbinv916.seq - Invertebrate sequence entries, part 916.
3914. gbinv917.seq - Invertebrate sequence entries, part 917.
3915. gbinv918.seq - Invertebrate sequence entries, part 918.
3916. gbinv919.seq - Invertebrate sequence entries, part 919.
3917. gbinv92.seq - Invertebrate sequence entries, part 92.
3918. gbinv920.seq - Invertebrate sequence entries, part 920.
3919. gbinv921.seq - Invertebrate sequence entries, part 921.
3920. gbinv922.seq - Invertebrate sequence entries, part 922.
3921. gbinv923.seq - Invertebrate sequence entries, part 923.
3922. gbinv924.seq - Invertebrate sequence entries, part 924.
3923. gbinv925.seq - Invertebrate sequence entries, part 925.
3924. gbinv926.seq - Invertebrate sequence entries, part 926.
3925. gbinv927.seq - Invertebrate sequence entries, part 927.
3926. gbinv928.seq - Invertebrate sequence entries, part 928.
3927. gbinv929.seq - Invertebrate sequence entries, part 929.
3928. gbinv93.seq - Invertebrate sequence entries, part 93.
3929. gbinv930.seq - Invertebrate sequence entries, part 930.
3930. gbinv931.seq - Invertebrate sequence entries, part 931.
3931. gbinv932.seq - Invertebrate sequence entries, part 932.
3932. gbinv933.seq - Invertebrate sequence entries, part 933.
3933. gbinv934.seq - Invertebrate sequence entries, part 934.
3934. gbinv935.seq - Invertebrate sequence entries, part 935.
3935. gbinv936.seq - Invertebrate sequence entries, part 936.
3936. gbinv937.seq - Invertebrate sequence entries, part 937.
3937. gbinv938.seq - Invertebrate sequence entries, part 938.
3938. gbinv939.seq - Invertebrate sequence entries, part 939.
3939. gbinv94.seq - Invertebrate sequence entries, part 94.
3940. gbinv940.seq - Invertebrate sequence entries, part 940.
3941. gbinv941.seq - Invertebrate sequence entries, part 941.
3942. gbinv942.seq - Invertebrate sequence entries, part 942.
3943. gbinv943.seq - Invertebrate sequence entries, part 943.
3944. gbinv944.seq - Invertebrate sequence entries, part 944.
3945. gbinv945.seq - Invertebrate sequence entries, part 945.
3946. gbinv946.seq - Invertebrate sequence entries, part 946.
3947. gbinv947.seq - Invertebrate sequence entries, part 947.
3948. gbinv948.seq - Invertebrate sequence entries, part 948.
3949. gbinv949.seq - Invertebrate sequence entries, part 949.
3950. gbinv95.seq - Invertebrate sequence entries, part 95.
3951. gbinv950.seq - Invertebrate sequence entries, part 950.
3952. gbinv951.seq - Invertebrate sequence entries, part 951.
3953. gbinv952.seq - Invertebrate sequence entries, part 952.
3954. gbinv953.seq - Invertebrate sequence entries, part 953.
3955. gbinv954.seq - Invertebrate sequence entries, part 954.
3956. gbinv955.seq - Invertebrate sequence entries, part 955.
3957. gbinv956.seq - Invertebrate sequence entries, part 956.
3958. gbinv957.seq - Invertebrate sequence entries, part 957.
3959. gbinv958.seq - Invertebrate sequence entries, part 958.
3960. gbinv959.seq - Invertebrate sequence entries, part 959.
3961. gbinv96.seq - Invertebrate sequence entries, part 96.
3962. gbinv960.seq - Invertebrate sequence entries, part 960.
3963. gbinv961.seq - Invertebrate sequence entries, part 961.
3964. gbinv962.seq - Invertebrate sequence entries, part 962.
3965. gbinv963.seq - Invertebrate sequence entries, part 963.
3966. gbinv964.seq - Invertebrate sequence entries, part 964.
3967. gbinv965.seq - Invertebrate sequence entries, part 965.
3968. gbinv966.seq - Invertebrate sequence entries, part 966.
3969. gbinv967.seq - Invertebrate sequence entries, part 967.
3970. gbinv968.seq - Invertebrate sequence entries, part 968.
3971. gbinv969.seq - Invertebrate sequence entries, part 969.
3972. gbinv97.seq - Invertebrate sequence entries, part 97.
3973. gbinv970.seq - Invertebrate sequence entries, part 970.
3974. gbinv971.seq - Invertebrate sequence entries, part 971.
3975. gbinv972.seq - Invertebrate sequence entries, part 972.
3976. gbinv973.seq - Invertebrate sequence entries, part 973.
3977. gbinv974.seq - Invertebrate sequence entries, part 974.
3978. gbinv975.seq - Invertebrate sequence entries, part 975.
3979. gbinv976.seq - Invertebrate sequence entries, part 976.
3980. gbinv977.seq - Invertebrate sequence entries, part 977.
3981. gbinv978.seq - Invertebrate sequence entries, part 978.
3982. gbinv979.seq - Invertebrate sequence entries, part 979.
3983. gbinv98.seq - Invertebrate sequence entries, part 98.
3984. gbinv980.seq - Invertebrate sequence entries, part 980.
3985. gbinv981.seq - Invertebrate sequence entries, part 981.
3986. gbinv982.seq - Invertebrate sequence entries, part 982.
3987. gbinv983.seq - Invertebrate sequence entries, part 983.
3988. gbinv984.seq - Invertebrate sequence entries, part 984.
3989. gbinv985.seq - Invertebrate sequence entries, part 985.
3990. gbinv986.seq - Invertebrate sequence entries, part 986.
3991. gbinv987.seq - Invertebrate sequence entries, part 987.
3992. gbinv988.seq - Invertebrate sequence entries, part 988.
3993. gbinv989.seq - Invertebrate sequence entries, part 989.
3994. gbinv99.seq - Invertebrate sequence entries, part 99.
3995. gbinv990.seq - Invertebrate sequence entries, part 990.
3996. gbinv991.seq - Invertebrate sequence entries, part 991.
3997. gbinv992.seq - Invertebrate sequence entries, part 992.
3998. gbinv993.seq - Invertebrate sequence entries, part 993.
3999. gbinv994.seq - Invertebrate sequence entries, part 994.
4000. gbinv995.seq - Invertebrate sequence entries, part 995.
4001. gbinv996.seq - Invertebrate sequence entries, part 996.
4002. gbinv997.seq - Invertebrate sequence entries, part 997.
4003. gbinv998.seq - Invertebrate sequence entries, part 998.
4004. gbinv999.seq - Invertebrate sequence entries, part 999.
4005. gbmam1.seq - Other mammalian sequence entries, part 1.
4006. gbmam10.seq - Other mammalian sequence entries, part 10.
4007. gbmam100.seq - Other mammalian sequence entries, part 100.
4008. gbmam101.seq - Other mammalian sequence entries, part 101.
4009. gbmam102.seq - Other mammalian sequence entries, part 102.
4010. gbmam103.seq - Other mammalian sequence entries, part 103.
4011. gbmam104.seq - Other mammalian sequence entries, part 104.
4012. gbmam105.seq - Other mammalian sequence entries, part 105.
4013. gbmam106.seq - Other mammalian sequence entries, part 106.
4014. gbmam107.seq - Other mammalian sequence entries, part 107.
4015. gbmam108.seq - Other mammalian sequence entries, part 108.
4016. gbmam109.seq - Other mammalian sequence entries, part 109.
4017. gbmam11.seq - Other mammalian sequence entries, part 11.
4018. gbmam110.seq - Other mammalian sequence entries, part 110.
4019. gbmam111.seq - Other mammalian sequence entries, part 111.
4020. gbmam112.seq - Other mammalian sequence entries, part 112.
4021. gbmam113.seq - Other mammalian sequence entries, part 113.
4022. gbmam114.seq - Other mammalian sequence entries, part 114.
4023. gbmam115.seq - Other mammalian sequence entries, part 115.
4024. gbmam116.seq - Other mammalian sequence entries, part 116.
4025. gbmam117.seq - Other mammalian sequence entries, part 117.
4026. gbmam118.seq - Other mammalian sequence entries, part 118.
4027. gbmam119.seq - Other mammalian sequence entries, part 119.
4028. gbmam12.seq - Other mammalian sequence entries, part 12.
4029. gbmam120.seq - Other mammalian sequence entries, part 120.
4030. gbmam121.seq - Other mammalian sequence entries, part 121.
4031. gbmam122.seq - Other mammalian sequence entries, part 122.
4032. gbmam123.seq - Other mammalian sequence entries, part 123.
4033. gbmam124.seq - Other mammalian sequence entries, part 124.
4034. gbmam125.seq - Other mammalian sequence entries, part 125.
4035. gbmam126.seq - Other mammalian sequence entries, part 126.
4036. gbmam127.seq - Other mammalian sequence entries, part 127.
4037. gbmam128.seq - Other mammalian sequence entries, part 128.
4038. gbmam129.seq - Other mammalian sequence entries, part 129.
4039. gbmam13.seq - Other mammalian sequence entries, part 13.
4040. gbmam130.seq - Other mammalian sequence entries, part 130.
4041. gbmam131.seq - Other mammalian sequence entries, part 131.
4042. gbmam132.seq - Other mammalian sequence entries, part 132.
4043. gbmam133.seq - Other mammalian sequence entries, part 133.
4044. gbmam134.seq - Other mammalian sequence entries, part 134.
4045. gbmam135.seq - Other mammalian sequence entries, part 135.
4046. gbmam136.seq - Other mammalian sequence entries, part 136.
4047. gbmam137.seq - Other mammalian sequence entries, part 137.
4048. gbmam138.seq - Other mammalian sequence entries, part 138.
4049. gbmam139.seq - Other mammalian sequence entries, part 139.
4050. gbmam14.seq - Other mammalian sequence entries, part 14.
4051. gbmam140.seq - Other mammalian sequence entries, part 140.
4052. gbmam141.seq - Other mammalian sequence entries, part 141.
4053. gbmam142.seq - Other mammalian sequence entries, part 142.
4054. gbmam143.seq - Other mammalian sequence entries, part 143.
4055. gbmam144.seq - Other mammalian sequence entries, part 144.
4056. gbmam145.seq - Other mammalian sequence entries, part 145.
4057. gbmam146.seq - Other mammalian sequence entries, part 146.
4058. gbmam147.seq - Other mammalian sequence entries, part 147.
4059. gbmam148.seq - Other mammalian sequence entries, part 148.
4060. gbmam149.seq - Other mammalian sequence entries, part 149.
4061. gbmam15.seq - Other mammalian sequence entries, part 15.
4062. gbmam150.seq - Other mammalian sequence entries, part 150.
4063. gbmam151.seq - Other mammalian sequence entries, part 151.
4064. gbmam152.seq - Other mammalian sequence entries, part 152.
4065. gbmam153.seq - Other mammalian sequence entries, part 153.
4066. gbmam154.seq - Other mammalian sequence entries, part 154.
4067. gbmam155.seq - Other mammalian sequence entries, part 155.
4068. gbmam156.seq - Other mammalian sequence entries, part 156.
4069. gbmam157.seq - Other mammalian sequence entries, part 157.
4070. gbmam158.seq - Other mammalian sequence entries, part 158.
4071. gbmam159.seq - Other mammalian sequence entries, part 159.
4072. gbmam16.seq - Other mammalian sequence entries, part 16.
4073. gbmam160.seq - Other mammalian sequence entries, part 160.
4074. gbmam161.seq - Other mammalian sequence entries, part 161.
4075. gbmam162.seq - Other mammalian sequence entries, part 162.
4076. gbmam163.seq - Other mammalian sequence entries, part 163.
4077. gbmam164.seq - Other mammalian sequence entries, part 164.
4078. gbmam165.seq - Other mammalian sequence entries, part 165.
4079. gbmam166.seq - Other mammalian sequence entries, part 166.
4080. gbmam167.seq - Other mammalian sequence entries, part 167.
4081. gbmam168.seq - Other mammalian sequence entries, part 168.
4082. gbmam169.seq - Other mammalian sequence entries, part 169.
4083. gbmam17.seq - Other mammalian sequence entries, part 17.
4084. gbmam170.seq - Other mammalian sequence entries, part 170.
4085. gbmam171.seq - Other mammalian sequence entries, part 171.
4086. gbmam172.seq - Other mammalian sequence entries, part 172.
4087. gbmam173.seq - Other mammalian sequence entries, part 173.
4088. gbmam174.seq - Other mammalian sequence entries, part 174.
4089. gbmam175.seq - Other mammalian sequence entries, part 175.
4090. gbmam176.seq - Other mammalian sequence entries, part 176.
4091. gbmam177.seq - Other mammalian sequence entries, part 177.
4092. gbmam178.seq - Other mammalian sequence entries, part 178.
4093. gbmam179.seq - Other mammalian sequence entries, part 179.
4094. gbmam18.seq - Other mammalian sequence entries, part 18.
4095. gbmam180.seq - Other mammalian sequence entries, part 180.
4096. gbmam181.seq - Other mammalian sequence entries, part 181.
4097. gbmam182.seq - Other mammalian sequence entries, part 182.
4098. gbmam183.seq - Other mammalian sequence entries, part 183.
4099. gbmam184.seq - Other mammalian sequence entries, part 184.
4100. gbmam185.seq - Other mammalian sequence entries, part 185.
4101. gbmam186.seq - Other mammalian sequence entries, part 186.
4102. gbmam187.seq - Other mammalian sequence entries, part 187.
4103. gbmam188.seq - Other mammalian sequence entries, part 188.
4104. gbmam189.seq - Other mammalian sequence entries, part 189.
4105. gbmam19.seq - Other mammalian sequence entries, part 19.
4106. gbmam190.seq - Other mammalian sequence entries, part 190.
4107. gbmam191.seq - Other mammalian sequence entries, part 191.
4108. gbmam192.seq - Other mammalian sequence entries, part 192.
4109. gbmam193.seq - Other mammalian sequence entries, part 193.
4110. gbmam194.seq - Other mammalian sequence entries, part 194.
4111. gbmam195.seq - Other mammalian sequence entries, part 195.
4112. gbmam196.seq - Other mammalian sequence entries, part 196.
4113. gbmam197.seq - Other mammalian sequence entries, part 197.
4114. gbmam198.seq - Other mammalian sequence entries, part 198.
4115. gbmam199.seq - Other mammalian sequence entries, part 199.
4116. gbmam2.seq - Other mammalian sequence entries, part 2.
4117. gbmam20.seq - Other mammalian sequence entries, part 20.
4118. gbmam200.seq - Other mammalian sequence entries, part 200.
4119. gbmam201.seq - Other mammalian sequence entries, part 201.
4120. gbmam202.seq - Other mammalian sequence entries, part 202.
4121. gbmam203.seq - Other mammalian sequence entries, part 203.
4122. gbmam204.seq - Other mammalian sequence entries, part 204.
4123. gbmam205.seq - Other mammalian sequence entries, part 205.
4124. gbmam206.seq - Other mammalian sequence entries, part 206.
4125. gbmam207.seq - Other mammalian sequence entries, part 207.
4126. gbmam208.seq - Other mammalian sequence entries, part 208.
4127. gbmam209.seq - Other mammalian sequence entries, part 209.
4128. gbmam21.seq - Other mammalian sequence entries, part 21.
4129. gbmam210.seq - Other mammalian sequence entries, part 210.
4130. gbmam211.seq - Other mammalian sequence entries, part 211.
4131. gbmam212.seq - Other mammalian sequence entries, part 212.
4132. gbmam213.seq - Other mammalian sequence entries, part 213.
4133. gbmam214.seq - Other mammalian sequence entries, part 214.
4134. gbmam215.seq - Other mammalian sequence entries, part 215.
4135. gbmam216.seq - Other mammalian sequence entries, part 216.
4136. gbmam217.seq - Other mammalian sequence entries, part 217.
4137. gbmam218.seq - Other mammalian sequence entries, part 218.
4138. gbmam219.seq - Other mammalian sequence entries, part 219.
4139. gbmam22.seq - Other mammalian sequence entries, part 22.
4140. gbmam220.seq - Other mammalian sequence entries, part 220.
4141. gbmam221.seq - Other mammalian sequence entries, part 221.
4142. gbmam222.seq - Other mammalian sequence entries, part 222.
4143. gbmam223.seq - Other mammalian sequence entries, part 223.
4144. gbmam224.seq - Other mammalian sequence entries, part 224.
4145. gbmam225.seq - Other mammalian sequence entries, part 225.
4146. gbmam226.seq - Other mammalian sequence entries, part 226.
4147. gbmam227.seq - Other mammalian sequence entries, part 227.
4148. gbmam228.seq - Other mammalian sequence entries, part 228.
4149. gbmam229.seq - Other mammalian sequence entries, part 229.
4150. gbmam23.seq - Other mammalian sequence entries, part 23.
4151. gbmam230.seq - Other mammalian sequence entries, part 230.
4152. gbmam231.seq - Other mammalian sequence entries, part 231.
4153. gbmam232.seq - Other mammalian sequence entries, part 232.
4154. gbmam233.seq - Other mammalian sequence entries, part 233.
4155. gbmam234.seq - Other mammalian sequence entries, part 234.
4156. gbmam235.seq - Other mammalian sequence entries, part 235.
4157. gbmam24.seq - Other mammalian sequence entries, part 24.
4158. gbmam25.seq - Other mammalian sequence entries, part 25.
4159. gbmam26.seq - Other mammalian sequence entries, part 26.
4160. gbmam27.seq - Other mammalian sequence entries, part 27.
4161. gbmam28.seq - Other mammalian sequence entries, part 28.
4162. gbmam29.seq - Other mammalian sequence entries, part 29.
4163. gbmam3.seq - Other mammalian sequence entries, part 3.
4164. gbmam30.seq - Other mammalian sequence entries, part 30.
4165. gbmam31.seq - Other mammalian sequence entries, part 31.
4166. gbmam32.seq - Other mammalian sequence entries, part 32.
4167. gbmam33.seq - Other mammalian sequence entries, part 33.
4168. gbmam34.seq - Other mammalian sequence entries, part 34.
4169. gbmam35.seq - Other mammalian sequence entries, part 35.
4170. gbmam36.seq - Other mammalian sequence entries, part 36.
4171. gbmam37.seq - Other mammalian sequence entries, part 37.
4172. gbmam38.seq - Other mammalian sequence entries, part 38.
4173. gbmam39.seq - Other mammalian sequence entries, part 39.
4174. gbmam4.seq - Other mammalian sequence entries, part 4.
4175. gbmam40.seq - Other mammalian sequence entries, part 40.
4176. gbmam41.seq - Other mammalian sequence entries, part 41.
4177. gbmam42.seq - Other mammalian sequence entries, part 42.
4178. gbmam43.seq - Other mammalian sequence entries, part 43.
4179. gbmam44.seq - Other mammalian sequence entries, part 44.
4180. gbmam45.seq - Other mammalian sequence entries, part 45.
4181. gbmam46.seq - Other mammalian sequence entries, part 46.
4182. gbmam47.seq - Other mammalian sequence entries, part 47.
4183. gbmam48.seq - Other mammalian sequence entries, part 48.
4184. gbmam49.seq - Other mammalian sequence entries, part 49.
4185. gbmam5.seq - Other mammalian sequence entries, part 5.
4186. gbmam50.seq - Other mammalian sequence entries, part 50.
4187. gbmam51.seq - Other mammalian sequence entries, part 51.
4188. gbmam52.seq - Other mammalian sequence entries, part 52.
4189. gbmam53.seq - Other mammalian sequence entries, part 53.
4190. gbmam54.seq - Other mammalian sequence entries, part 54.
4191. gbmam55.seq - Other mammalian sequence entries, part 55.
4192. gbmam56.seq - Other mammalian sequence entries, part 56.
4193. gbmam57.seq - Other mammalian sequence entries, part 57.
4194. gbmam58.seq - Other mammalian sequence entries, part 58.
4195. gbmam59.seq - Other mammalian sequence entries, part 59.
4196. gbmam6.seq - Other mammalian sequence entries, part 6.
4197. gbmam60.seq - Other mammalian sequence entries, part 60.
4198. gbmam61.seq - Other mammalian sequence entries, part 61.
4199. gbmam62.seq - Other mammalian sequence entries, part 62.
4200. gbmam63.seq - Other mammalian sequence entries, part 63.
4201. gbmam64.seq - Other mammalian sequence entries, part 64.
4202. gbmam65.seq - Other mammalian sequence entries, part 65.
4203. gbmam66.seq - Other mammalian sequence entries, part 66.
4204. gbmam67.seq - Other mammalian sequence entries, part 67.
4205. gbmam68.seq - Other mammalian sequence entries, part 68.
4206. gbmam69.seq - Other mammalian sequence entries, part 69.
4207. gbmam7.seq - Other mammalian sequence entries, part 7.
4208. gbmam70.seq - Other mammalian sequence entries, part 70.
4209. gbmam71.seq - Other mammalian sequence entries, part 71.
4210. gbmam72.seq - Other mammalian sequence entries, part 72.
4211. gbmam73.seq - Other mammalian sequence entries, part 73.
4212. gbmam74.seq - Other mammalian sequence entries, part 74.
4213. gbmam75.seq - Other mammalian sequence entries, part 75.
4214. gbmam76.seq - Other mammalian sequence entries, part 76.
4215. gbmam77.seq - Other mammalian sequence entries, part 77.
4216. gbmam78.seq - Other mammalian sequence entries, part 78.
4217. gbmam79.seq - Other mammalian sequence entries, part 79.
4218. gbmam8.seq - Other mammalian sequence entries, part 8.
4219. gbmam80.seq - Other mammalian sequence entries, part 80.
4220. gbmam81.seq - Other mammalian sequence entries, part 81.
4221. gbmam82.seq - Other mammalian sequence entries, part 82.
4222. gbmam83.seq - Other mammalian sequence entries, part 83.
4223. gbmam84.seq - Other mammalian sequence entries, part 84.
4224. gbmam85.seq - Other mammalian sequence entries, part 85.
4225. gbmam86.seq - Other mammalian sequence entries, part 86.
4226. gbmam87.seq - Other mammalian sequence entries, part 87.
4227. gbmam88.seq - Other mammalian sequence entries, part 88.
4228. gbmam89.seq - Other mammalian sequence entries, part 89.
4229. gbmam9.seq - Other mammalian sequence entries, part 9.
4230. gbmam90.seq - Other mammalian sequence entries, part 90.
4231. gbmam91.seq - Other mammalian sequence entries, part 91.
4232. gbmam92.seq - Other mammalian sequence entries, part 92.
4233. gbmam93.seq - Other mammalian sequence entries, part 93.
4234. gbmam94.seq - Other mammalian sequence entries, part 94.
4235. gbmam95.seq - Other mammalian sequence entries, part 95.
4236. gbmam96.seq - Other mammalian sequence entries, part 96.
4237. gbmam97.seq - Other mammalian sequence entries, part 97.
4238. gbmam98.seq - Other mammalian sequence entries, part 98.
4239. gbmam99.seq - Other mammalian sequence entries, part 99.
4240. gbnew.txt - Accession numbers of entries new since the previous release.
4241. gbpat1.seq - Patent sequence entries, part 1.
4242. gbpat10.seq - Patent sequence entries, part 10.
4243. gbpat100.seq - Patent sequence entries, part 100.
4244. gbpat101.seq - Patent sequence entries, part 101.
4245. gbpat102.seq - Patent sequence entries, part 102.
4246. gbpat103.seq - Patent sequence entries, part 103.
4247. gbpat104.seq - Patent sequence entries, part 104.
4248. gbpat105.seq - Patent sequence entries, part 105.
4249. gbpat106.seq - Patent sequence entries, part 106.
4250. gbpat107.seq - Patent sequence entries, part 107.
4251. gbpat108.seq - Patent sequence entries, part 108.
4252. gbpat109.seq - Patent sequence entries, part 109.
4253. gbpat11.seq - Patent sequence entries, part 11.
4254. gbpat110.seq - Patent sequence entries, part 110.
4255. gbpat111.seq - Patent sequence entries, part 111.
4256. gbpat112.seq - Patent sequence entries, part 112.
4257. gbpat113.seq - Patent sequence entries, part 113.
4258. gbpat114.seq - Patent sequence entries, part 114.
4259. gbpat115.seq - Patent sequence entries, part 115.
4260. gbpat116.seq - Patent sequence entries, part 116.
4261. gbpat117.seq - Patent sequence entries, part 117.
4262. gbpat118.seq - Patent sequence entries, part 118.
4263. gbpat119.seq - Patent sequence entries, part 119.
4264. gbpat12.seq - Patent sequence entries, part 12.
4265. gbpat120.seq - Patent sequence entries, part 120.
4266. gbpat121.seq - Patent sequence entries, part 121.
4267. gbpat122.seq - Patent sequence entries, part 122.
4268. gbpat123.seq - Patent sequence entries, part 123.
4269. gbpat124.seq - Patent sequence entries, part 124.
4270. gbpat125.seq - Patent sequence entries, part 125.
4271. gbpat126.seq - Patent sequence entries, part 126.
4272. gbpat127.seq - Patent sequence entries, part 127.
4273. gbpat128.seq - Patent sequence entries, part 128.
4274. gbpat129.seq - Patent sequence entries, part 129.
4275. gbpat13.seq - Patent sequence entries, part 13.
4276. gbpat130.seq - Patent sequence entries, part 130.
4277. gbpat131.seq - Patent sequence entries, part 131.
4278. gbpat132.seq - Patent sequence entries, part 132.
4279. gbpat133.seq - Patent sequence entries, part 133.
4280. gbpat134.seq - Patent sequence entries, part 134.
4281. gbpat135.seq - Patent sequence entries, part 135.
4282. gbpat136.seq - Patent sequence entries, part 136.
4283. gbpat137.seq - Patent sequence entries, part 137.
4284. gbpat138.seq - Patent sequence entries, part 138.
4285. gbpat139.seq - Patent sequence entries, part 139.
4286. gbpat14.seq - Patent sequence entries, part 14.
4287. gbpat140.seq - Patent sequence entries, part 140.
4288. gbpat141.seq - Patent sequence entries, part 141.
4289. gbpat142.seq - Patent sequence entries, part 142.
4290. gbpat143.seq - Patent sequence entries, part 143.
4291. gbpat144.seq - Patent sequence entries, part 144.
4292. gbpat145.seq - Patent sequence entries, part 145.
4293. gbpat146.seq - Patent sequence entries, part 146.
4294. gbpat147.seq - Patent sequence entries, part 147.
4295. gbpat148.seq - Patent sequence entries, part 148.
4296. gbpat149.seq - Patent sequence entries, part 149.
4297. gbpat15.seq - Patent sequence entries, part 15.
4298. gbpat150.seq - Patent sequence entries, part 150.
4299. gbpat151.seq - Patent sequence entries, part 151.
4300. gbpat152.seq - Patent sequence entries, part 152.
4301. gbpat153.seq - Patent sequence entries, part 153.
4302. gbpat154.seq - Patent sequence entries, part 154.
4303. gbpat155.seq - Patent sequence entries, part 155.
4304. gbpat156.seq - Patent sequence entries, part 156.
4305. gbpat157.seq - Patent sequence entries, part 157.
4306. gbpat158.seq - Patent sequence entries, part 158.
4307. gbpat159.seq - Patent sequence entries, part 159.
4308. gbpat16.seq - Patent sequence entries, part 16.
4309. gbpat160.seq - Patent sequence entries, part 160.
4310. gbpat161.seq - Patent sequence entries, part 161.
4311. gbpat162.seq - Patent sequence entries, part 162.
4312. gbpat163.seq - Patent sequence entries, part 163.
4313. gbpat164.seq - Patent sequence entries, part 164.
4314. gbpat165.seq - Patent sequence entries, part 165.
4315. gbpat166.seq - Patent sequence entries, part 166.
4316. gbpat167.seq - Patent sequence entries, part 167.
4317. gbpat168.seq - Patent sequence entries, part 168.
4318. gbpat169.seq - Patent sequence entries, part 169.
4319. gbpat17.seq - Patent sequence entries, part 17.
4320. gbpat170.seq - Patent sequence entries, part 170.
4321. gbpat171.seq - Patent sequence entries, part 171.
4322. gbpat172.seq - Patent sequence entries, part 172.
4323. gbpat173.seq - Patent sequence entries, part 173.
4324. gbpat174.seq - Patent sequence entries, part 174.
4325. gbpat175.seq - Patent sequence entries, part 175.
4326. gbpat176.seq - Patent sequence entries, part 176.
4327. gbpat177.seq - Patent sequence entries, part 177.
4328. gbpat178.seq - Patent sequence entries, part 178.
4329. gbpat179.seq - Patent sequence entries, part 179.
4330. gbpat18.seq - Patent sequence entries, part 18.
4331. gbpat180.seq - Patent sequence entries, part 180.
4332. gbpat181.seq - Patent sequence entries, part 181.
4333. gbpat182.seq - Patent sequence entries, part 182.
4334. gbpat183.seq - Patent sequence entries, part 183.
4335. gbpat184.seq - Patent sequence entries, part 184.
4336. gbpat185.seq - Patent sequence entries, part 185.
4337. gbpat186.seq - Patent sequence entries, part 186.
4338. gbpat187.seq - Patent sequence entries, part 187.
4339. gbpat188.seq - Patent sequence entries, part 188.
4340. gbpat189.seq - Patent sequence entries, part 189.
4341. gbpat19.seq - Patent sequence entries, part 19.
4342. gbpat190.seq - Patent sequence entries, part 190.
4343. gbpat191.seq - Patent sequence entries, part 191.
4344. gbpat192.seq - Patent sequence entries, part 192.
4345. gbpat193.seq - Patent sequence entries, part 193.
4346. gbpat194.seq - Patent sequence entries, part 194.
4347. gbpat195.seq - Patent sequence entries, part 195.
4348. gbpat196.seq - Patent sequence entries, part 196.
4349. gbpat197.seq - Patent sequence entries, part 197.
4350. gbpat198.seq - Patent sequence entries, part 198.
4351. gbpat199.seq - Patent sequence entries, part 199.
4352. gbpat2.seq - Patent sequence entries, part 2.
4353. gbpat20.seq - Patent sequence entries, part 20.
4354. gbpat200.seq - Patent sequence entries, part 200.
4355. gbpat201.seq - Patent sequence entries, part 201.
4356. gbpat202.seq - Patent sequence entries, part 202.
4357. gbpat203.seq - Patent sequence entries, part 203.
4358. gbpat204.seq - Patent sequence entries, part 204.
4359. gbpat205.seq - Patent sequence entries, part 205.
4360. gbpat206.seq - Patent sequence entries, part 206.
4361. gbpat207.seq - Patent sequence entries, part 207.
4362. gbpat208.seq - Patent sequence entries, part 208.
4363. gbpat209.seq - Patent sequence entries, part 209.
4364. gbpat21.seq - Patent sequence entries, part 21.
4365. gbpat210.seq - Patent sequence entries, part 210.
4366. gbpat211.seq - Patent sequence entries, part 211.
4367. gbpat212.seq - Patent sequence entries, part 212.
4368. gbpat213.seq - Patent sequence entries, part 213.
4369. gbpat214.seq - Patent sequence entries, part 214.
4370. gbpat215.seq - Patent sequence entries, part 215.
4371. gbpat216.seq - Patent sequence entries, part 216.
4372. gbpat217.seq - Patent sequence entries, part 217.
4373. gbpat218.seq - Patent sequence entries, part 218.
4374. gbpat219.seq - Patent sequence entries, part 219.
4375. gbpat22.seq - Patent sequence entries, part 22.
4376. gbpat220.seq - Patent sequence entries, part 220.
4377. gbpat221.seq - Patent sequence entries, part 221.
4378. gbpat222.seq - Patent sequence entries, part 222.
4379. gbpat223.seq - Patent sequence entries, part 223.
4380. gbpat224.seq - Patent sequence entries, part 224.
4381. gbpat225.seq - Patent sequence entries, part 225.
4382. gbpat226.seq - Patent sequence entries, part 226.
4383. gbpat227.seq - Patent sequence entries, part 227.
4384. gbpat228.seq - Patent sequence entries, part 228.
4385. gbpat229.seq - Patent sequence entries, part 229.
4386. gbpat23.seq - Patent sequence entries, part 23.
4387. gbpat230.seq - Patent sequence entries, part 230.
4388. gbpat231.seq - Patent sequence entries, part 231.
4389. gbpat232.seq - Patent sequence entries, part 232.
4390. gbpat233.seq - Patent sequence entries, part 233.
4391. gbpat234.seq - Patent sequence entries, part 234.
4392. gbpat235.seq - Patent sequence entries, part 235.
4393. gbpat236.seq - Patent sequence entries, part 236.
4394. gbpat237.seq - Patent sequence entries, part 237.
4395. gbpat238.seq - Patent sequence entries, part 238.
4396. gbpat239.seq - Patent sequence entries, part 239.
4397. gbpat24.seq - Patent sequence entries, part 24.
4398. gbpat240.seq - Patent sequence entries, part 240.
4399. gbpat241.seq - Patent sequence entries, part 241.
4400. gbpat242.seq - Patent sequence entries, part 242.
4401. gbpat243.seq - Patent sequence entries, part 243.
4402. gbpat244.seq - Patent sequence entries, part 244.
4403. gbpat245.seq - Patent sequence entries, part 245.
4404. gbpat246.seq - Patent sequence entries, part 246.
4405. gbpat247.seq - Patent sequence entries, part 247.
4406. gbpat248.seq - Patent sequence entries, part 248.
4407. gbpat249.seq - Patent sequence entries, part 249.
4408. gbpat25.seq - Patent sequence entries, part 25.
4409. gbpat250.seq - Patent sequence entries, part 250.
4410. gbpat251.seq - Patent sequence entries, part 251.
4411. gbpat252.seq - Patent sequence entries, part 252.
4412. gbpat253.seq - Patent sequence entries, part 253.
4413. gbpat254.seq - Patent sequence entries, part 254.
4414. gbpat255.seq - Patent sequence entries, part 255.
4415. gbpat256.seq - Patent sequence entries, part 256.
4416. gbpat257.seq - Patent sequence entries, part 257.
4417. gbpat258.seq - Patent sequence entries, part 258.
4418. gbpat259.seq - Patent sequence entries, part 259.
4419. gbpat26.seq - Patent sequence entries, part 26.
4420. gbpat260.seq - Patent sequence entries, part 260.
4421. gbpat27.seq - Patent sequence entries, part 27.
4422. gbpat28.seq - Patent sequence entries, part 28.
4423. gbpat29.seq - Patent sequence entries, part 29.
4424. gbpat3.seq - Patent sequence entries, part 3.
4425. gbpat30.seq - Patent sequence entries, part 30.
4426. gbpat31.seq - Patent sequence entries, part 31.
4427. gbpat32.seq - Patent sequence entries, part 32.
4428. gbpat33.seq - Patent sequence entries, part 33.
4429. gbpat34.seq - Patent sequence entries, part 34.
4430. gbpat35.seq - Patent sequence entries, part 35.
4431. gbpat36.seq - Patent sequence entries, part 36.
4432. gbpat37.seq - Patent sequence entries, part 37.
4433. gbpat38.seq - Patent sequence entries, part 38.
4434. gbpat39.seq - Patent sequence entries, part 39.
4435. gbpat4.seq - Patent sequence entries, part 4.
4436. gbpat40.seq - Patent sequence entries, part 40.
4437. gbpat41.seq - Patent sequence entries, part 41.
4438. gbpat42.seq - Patent sequence entries, part 42.
4439. gbpat43.seq - Patent sequence entries, part 43.
4440. gbpat44.seq - Patent sequence entries, part 44.
4441. gbpat45.seq - Patent sequence entries, part 45.
4442. gbpat46.seq - Patent sequence entries, part 46.
4443. gbpat47.seq - Patent sequence entries, part 47.
4444. gbpat48.seq - Patent sequence entries, part 48.
4445. gbpat49.seq - Patent sequence entries, part 49.
4446. gbpat5.seq - Patent sequence entries, part 5.
4447. gbpat50.seq - Patent sequence entries, part 50.
4448. gbpat51.seq - Patent sequence entries, part 51.
4449. gbpat52.seq - Patent sequence entries, part 52.
4450. gbpat53.seq - Patent sequence entries, part 53.
4451. gbpat54.seq - Patent sequence entries, part 54.
4452. gbpat55.seq - Patent sequence entries, part 55.
4453. gbpat56.seq - Patent sequence entries, part 56.
4454. gbpat57.seq - Patent sequence entries, part 57.
4455. gbpat58.seq - Patent sequence entries, part 58.
4456. gbpat59.seq - Patent sequence entries, part 59.
4457. gbpat6.seq - Patent sequence entries, part 6.
4458. gbpat60.seq - Patent sequence entries, part 60.
4459. gbpat61.seq - Patent sequence entries, part 61.
4460. gbpat62.seq - Patent sequence entries, part 62.
4461. gbpat63.seq - Patent sequence entries, part 63.
4462. gbpat64.seq - Patent sequence entries, part 64.
4463. gbpat65.seq - Patent sequence entries, part 65.
4464. gbpat66.seq - Patent sequence entries, part 66.
4465. gbpat67.seq - Patent sequence entries, part 67.
4466. gbpat68.seq - Patent sequence entries, part 68.
4467. gbpat69.seq - Patent sequence entries, part 69.
4468. gbpat7.seq - Patent sequence entries, part 7.
4469. gbpat70.seq - Patent sequence entries, part 70.
4470. gbpat71.seq - Patent sequence entries, part 71.
4471. gbpat72.seq - Patent sequence entries, part 72.
4472. gbpat73.seq - Patent sequence entries, part 73.
4473. gbpat74.seq - Patent sequence entries, part 74.
4474. gbpat75.seq - Patent sequence entries, part 75.
4475. gbpat76.seq - Patent sequence entries, part 76.
4476. gbpat77.seq - Patent sequence entries, part 77.
4477. gbpat78.seq - Patent sequence entries, part 78.
4478. gbpat79.seq - Patent sequence entries, part 79.
4479. gbpat8.seq - Patent sequence entries, part 8.
4480. gbpat80.seq - Patent sequence entries, part 80.
4481. gbpat81.seq - Patent sequence entries, part 81.
4482. gbpat82.seq - Patent sequence entries, part 82.
4483. gbpat83.seq - Patent sequence entries, part 83.
4484. gbpat84.seq - Patent sequence entries, part 84.
4485. gbpat85.seq - Patent sequence entries, part 85.
4486. gbpat86.seq - Patent sequence entries, part 86.
4487. gbpat87.seq - Patent sequence entries, part 87.
4488. gbpat88.seq - Patent sequence entries, part 88.
4489. gbpat89.seq - Patent sequence entries, part 89.
4490. gbpat9.seq - Patent sequence entries, part 9.
4491. gbpat90.seq - Patent sequence entries, part 90.
4492. gbpat91.seq - Patent sequence entries, part 91.
4493. gbpat92.seq - Patent sequence entries, part 92.
4494. gbpat93.seq - Patent sequence entries, part 93.
4495. gbpat94.seq - Patent sequence entries, part 94.
4496. gbpat95.seq - Patent sequence entries, part 95.
4497. gbpat96.seq - Patent sequence entries, part 96.
4498. gbpat97.seq - Patent sequence entries, part 97.
4499. gbpat98.seq - Patent sequence entries, part 98.
4500. gbpat99.seq - Patent sequence entries, part 99.
4501. gbphg1.seq - Phage sequence entries, part 1.
4502. gbphg2.seq - Phage sequence entries, part 2.
4503. gbphg3.seq - Phage sequence entries, part 3.
4504. gbphg4.seq - Phage sequence entries, part 4.
4505. gbphg5.seq - Phage sequence entries, part 5.
4506. gbphg6.seq - Phage sequence entries, part 6.
4507. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
4508. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
4509. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
4510. gbpln1000.seq - Plant sequence entries (including fungi and algae), part 1000.
4511. gbpln1001.seq - Plant sequence entries (including fungi and algae), part 1001.
4512. gbpln1002.seq - Plant sequence entries (including fungi and algae), part 1002.
4513. gbpln1003.seq - Plant sequence entries (including fungi and algae), part 1003.
4514. gbpln1004.seq - Plant sequence entries (including fungi and algae), part 1004.
4515. gbpln1005.seq - Plant sequence entries (including fungi and algae), part 1005.
4516. gbpln1006.seq - Plant sequence entries (including fungi and algae), part 1006.
4517. gbpln1007.seq - Plant sequence entries (including fungi and algae), part 1007.
4518. gbpln1008.seq - Plant sequence entries (including fungi and algae), part 1008.
4519. gbpln1009.seq - Plant sequence entries (including fungi and algae), part 1009.
4520. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
4521. gbpln1010.seq - Plant sequence entries (including fungi and algae), part 1010.
4522. gbpln1011.seq - Plant sequence entries (including fungi and algae), part 1011.
4523. gbpln1012.seq - Plant sequence entries (including fungi and algae), part 1012.
4524. gbpln1013.seq - Plant sequence entries (including fungi and algae), part 1013.
4525. gbpln1014.seq - Plant sequence entries (including fungi and algae), part 1014.
4526. gbpln1015.seq - Plant sequence entries (including fungi and algae), part 1015.
4527. gbpln1016.seq - Plant sequence entries (including fungi and algae), part 1016.
4528. gbpln1017.seq - Plant sequence entries (including fungi and algae), part 1017.
4529. gbpln1018.seq - Plant sequence entries (including fungi and algae), part 1018.
4530. gbpln1019.seq - Plant sequence entries (including fungi and algae), part 1019.
4531. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
4532. gbpln1020.seq - Plant sequence entries (including fungi and algae), part 1020.
4533. gbpln1021.seq - Plant sequence entries (including fungi and algae), part 1021.
4534. gbpln1022.seq - Plant sequence entries (including fungi and algae), part 1022.
4535. gbpln1023.seq - Plant sequence entries (including fungi and algae), part 1023.
4536. gbpln1024.seq - Plant sequence entries (including fungi and algae), part 1024.
4537. gbpln1025.seq - Plant sequence entries (including fungi and algae), part 1025.
4538. gbpln1026.seq - Plant sequence entries (including fungi and algae), part 1026.
4539. gbpln1027.seq - Plant sequence entries (including fungi and algae), part 1027.
4540. gbpln1028.seq - Plant sequence entries (including fungi and algae), part 1028.
4541. gbpln1029.seq - Plant sequence entries (including fungi and algae), part 1029.
4542. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
4543. gbpln1030.seq - Plant sequence entries (including fungi and algae), part 1030.
4544. gbpln1031.seq - Plant sequence entries (including fungi and algae), part 1031.
4545. gbpln1032.seq - Plant sequence entries (including fungi and algae), part 1032.
4546. gbpln1033.seq - Plant sequence entries (including fungi and algae), part 1033.
4547. gbpln1034.seq - Plant sequence entries (including fungi and algae), part 1034.
4548. gbpln1035.seq - Plant sequence entries (including fungi and algae), part 1035.
4549. gbpln1036.seq - Plant sequence entries (including fungi and algae), part 1036.
4550. gbpln1037.seq - Plant sequence entries (including fungi and algae), part 1037.
4551. gbpln1038.seq - Plant sequence entries (including fungi and algae), part 1038.
4552. gbpln1039.seq - Plant sequence entries (including fungi and algae), part 1039.
4553. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
4554. gbpln1040.seq - Plant sequence entries (including fungi and algae), part 1040.
4555. gbpln1041.seq - Plant sequence entries (including fungi and algae), part 1041.
4556. gbpln1042.seq - Plant sequence entries (including fungi and algae), part 1042.
4557. gbpln1043.seq - Plant sequence entries (including fungi and algae), part 1043.
4558. gbpln1044.seq - Plant sequence entries (including fungi and algae), part 1044.
4559. gbpln1045.seq - Plant sequence entries (including fungi and algae), part 1045.
4560. gbpln1046.seq - Plant sequence entries (including fungi and algae), part 1046.
4561. gbpln1047.seq - Plant sequence entries (including fungi and algae), part 1047.
4562. gbpln1048.seq - Plant sequence entries (including fungi and algae), part 1048.
4563. gbpln1049.seq - Plant sequence entries (including fungi and algae), part 1049.
4564. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
4565. gbpln1050.seq - Plant sequence entries (including fungi and algae), part 1050.
4566. gbpln1051.seq - Plant sequence entries (including fungi and algae), part 1051.
4567. gbpln1052.seq - Plant sequence entries (including fungi and algae), part 1052.
4568. gbpln1053.seq - Plant sequence entries (including fungi and algae), part 1053.
4569. gbpln1054.seq - Plant sequence entries (including fungi and algae), part 1054.
4570. gbpln1055.seq - Plant sequence entries (including fungi and algae), part 1055.
4571. gbpln1056.seq - Plant sequence entries (including fungi and algae), part 1056.
4572. gbpln1057.seq - Plant sequence entries (including fungi and algae), part 1057.
4573. gbpln1058.seq - Plant sequence entries (including fungi and algae), part 1058.
4574. gbpln1059.seq - Plant sequence entries (including fungi and algae), part 1059.
4575. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
4576. gbpln1060.seq - Plant sequence entries (including fungi and algae), part 1060.
4577. gbpln1061.seq - Plant sequence entries (including fungi and algae), part 1061.
4578. gbpln1062.seq - Plant sequence entries (including fungi and algae), part 1062.
4579. gbpln1063.seq - Plant sequence entries (including fungi and algae), part 1063.
4580. gbpln1064.seq - Plant sequence entries (including fungi and algae), part 1064.
4581. gbpln1065.seq - Plant sequence entries (including fungi and algae), part 1065.
4582. gbpln1066.seq - Plant sequence entries (including fungi and algae), part 1066.
4583. gbpln1067.seq - Plant sequence entries (including fungi and algae), part 1067.
4584. gbpln1068.seq - Plant sequence entries (including fungi and algae), part 1068.
4585. gbpln1069.seq - Plant sequence entries (including fungi and algae), part 1069.
4586. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
4587. gbpln1070.seq - Plant sequence entries (including fungi and algae), part 1070.
4588. gbpln1071.seq - Plant sequence entries (including fungi and algae), part 1071.
4589. gbpln1072.seq - Plant sequence entries (including fungi and algae), part 1072.
4590. gbpln1073.seq - Plant sequence entries (including fungi and algae), part 1073.
4591. gbpln1074.seq - Plant sequence entries (including fungi and algae), part 1074.
4592. gbpln1075.seq - Plant sequence entries (including fungi and algae), part 1075.
4593. gbpln1076.seq - Plant sequence entries (including fungi and algae), part 1076.
4594. gbpln1077.seq - Plant sequence entries (including fungi and algae), part 1077.
4595. gbpln1078.seq - Plant sequence entries (including fungi and algae), part 1078.
4596. gbpln1079.seq - Plant sequence entries (including fungi and algae), part 1079.
4597. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
4598. gbpln1080.seq - Plant sequence entries (including fungi and algae), part 1080.
4599. gbpln1081.seq - Plant sequence entries (including fungi and algae), part 1081.
4600. gbpln1082.seq - Plant sequence entries (including fungi and algae), part 1082.
4601. gbpln1083.seq - Plant sequence entries (including fungi and algae), part 1083.
4602. gbpln1084.seq - Plant sequence entries (including fungi and algae), part 1084.
4603. gbpln1085.seq - Plant sequence entries (including fungi and algae), part 1085.
4604. gbpln1086.seq - Plant sequence entries (including fungi and algae), part 1086.
4605. gbpln1087.seq - Plant sequence entries (including fungi and algae), part 1087.
4606. gbpln1088.seq - Plant sequence entries (including fungi and algae), part 1088.
4607. gbpln1089.seq - Plant sequence entries (including fungi and algae), part 1089.
4608. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
4609. gbpln1090.seq - Plant sequence entries (including fungi and algae), part 1090.
4610. gbpln1091.seq - Plant sequence entries (including fungi and algae), part 1091.
4611. gbpln1092.seq - Plant sequence entries (including fungi and algae), part 1092.
4612. gbpln1093.seq - Plant sequence entries (including fungi and algae), part 1093.
4613. gbpln1094.seq - Plant sequence entries (including fungi and algae), part 1094.
4614. gbpln1095.seq - Plant sequence entries (including fungi and algae), part 1095.
4615. gbpln1096.seq - Plant sequence entries (including fungi and algae), part 1096.
4616. gbpln1097.seq - Plant sequence entries (including fungi and algae), part 1097.
4617. gbpln1098.seq - Plant sequence entries (including fungi and algae), part 1098.
4618. gbpln1099.seq - Plant sequence entries (including fungi and algae), part 1099.
4619. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
4620. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
4621. gbpln1100.seq - Plant sequence entries (including fungi and algae), part 1100.
4622. gbpln1101.seq - Plant sequence entries (including fungi and algae), part 1101.
4623. gbpln1102.seq - Plant sequence entries (including fungi and algae), part 1102.
4624. gbpln1103.seq - Plant sequence entries (including fungi and algae), part 1103.
4625. gbpln1104.seq - Plant sequence entries (including fungi and algae), part 1104.
4626. gbpln1105.seq - Plant sequence entries (including fungi and algae), part 1105.
4627. gbpln1106.seq - Plant sequence entries (including fungi and algae), part 1106.
4628. gbpln1107.seq - Plant sequence entries (including fungi and algae), part 1107.
4629. gbpln1108.seq - Plant sequence entries (including fungi and algae), part 1108.
4630. gbpln1109.seq - Plant sequence entries (including fungi and algae), part 1109.
4631. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
4632. gbpln1110.seq - Plant sequence entries (including fungi and algae), part 1110.
4633. gbpln1111.seq - Plant sequence entries (including fungi and algae), part 1111.
4634. gbpln1112.seq - Plant sequence entries (including fungi and algae), part 1112.
4635. gbpln1113.seq - Plant sequence entries (including fungi and algae), part 1113.
4636. gbpln1114.seq - Plant sequence entries (including fungi and algae), part 1114.
4637. gbpln1115.seq - Plant sequence entries (including fungi and algae), part 1115.
4638. gbpln1116.seq - Plant sequence entries (including fungi and algae), part 1116.
4639. gbpln1117.seq - Plant sequence entries (including fungi and algae), part 1117.
4640. gbpln1118.seq - Plant sequence entries (including fungi and algae), part 1118.
4641. gbpln1119.seq - Plant sequence entries (including fungi and algae), part 1119.
4642. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
4643. gbpln1120.seq - Plant sequence entries (including fungi and algae), part 1120.
4644. gbpln1121.seq - Plant sequence entries (including fungi and algae), part 1121.
4645. gbpln1122.seq - Plant sequence entries (including fungi and algae), part 1122.
4646. gbpln1123.seq - Plant sequence entries (including fungi and algae), part 1123.
4647. gbpln1124.seq - Plant sequence entries (including fungi and algae), part 1124.
4648. gbpln1125.seq - Plant sequence entries (including fungi and algae), part 1125.
4649. gbpln1126.seq - Plant sequence entries (including fungi and algae), part 1126.
4650. gbpln1127.seq - Plant sequence entries (including fungi and algae), part 1127.
4651. gbpln1128.seq - Plant sequence entries (including fungi and algae), part 1128.
4652. gbpln1129.seq - Plant sequence entries (including fungi and algae), part 1129.
4653. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
4654. gbpln1130.seq - Plant sequence entries (including fungi and algae), part 1130.
4655. gbpln1131.seq - Plant sequence entries (including fungi and algae), part 1131.
4656. gbpln1132.seq - Plant sequence entries (including fungi and algae), part 1132.
4657. gbpln1133.seq - Plant sequence entries (including fungi and algae), part 1133.
4658. gbpln1134.seq - Plant sequence entries (including fungi and algae), part 1134.
4659. gbpln1135.seq - Plant sequence entries (including fungi and algae), part 1135.
4660. gbpln1136.seq - Plant sequence entries (including fungi and algae), part 1136.
4661. gbpln1137.seq - Plant sequence entries (including fungi and algae), part 1137.
4662. gbpln1138.seq - Plant sequence entries (including fungi and algae), part 1138.
4663. gbpln1139.seq - Plant sequence entries (including fungi and algae), part 1139.
4664. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
4665. gbpln1140.seq - Plant sequence entries (including fungi and algae), part 1140.
4666. gbpln1141.seq - Plant sequence entries (including fungi and algae), part 1141.
4667. gbpln1142.seq - Plant sequence entries (including fungi and algae), part 1142.
4668. gbpln1143.seq - Plant sequence entries (including fungi and algae), part 1143.
4669. gbpln1144.seq - Plant sequence entries (including fungi and algae), part 1144.
4670. gbpln1145.seq - Plant sequence entries (including fungi and algae), part 1145.
4671. gbpln1146.seq - Plant sequence entries (including fungi and algae), part 1146.
4672. gbpln1147.seq - Plant sequence entries (including fungi and algae), part 1147.
4673. gbpln1148.seq - Plant sequence entries (including fungi and algae), part 1148.
4674. gbpln1149.seq - Plant sequence entries (including fungi and algae), part 1149.
4675. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
4676. gbpln1150.seq - Plant sequence entries (including fungi and algae), part 1150.
4677. gbpln1151.seq - Plant sequence entries (including fungi and algae), part 1151.
4678. gbpln1152.seq - Plant sequence entries (including fungi and algae), part 1152.
4679. gbpln1153.seq - Plant sequence entries (including fungi and algae), part 1153.
4680. gbpln1154.seq - Plant sequence entries (including fungi and algae), part 1154.
4681. gbpln1155.seq - Plant sequence entries (including fungi and algae), part 1155.
4682. gbpln1156.seq - Plant sequence entries (including fungi and algae), part 1156.
4683. gbpln1157.seq - Plant sequence entries (including fungi and algae), part 1157.
4684. gbpln1158.seq - Plant sequence entries (including fungi and algae), part 1158.
4685. gbpln1159.seq - Plant sequence entries (including fungi and algae), part 1159.
4686. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
4687. gbpln1160.seq - Plant sequence entries (including fungi and algae), part 1160.
4688. gbpln1161.seq - Plant sequence entries (including fungi and algae), part 1161.
4689. gbpln1162.seq - Plant sequence entries (including fungi and algae), part 1162.
4690. gbpln1163.seq - Plant sequence entries (including fungi and algae), part 1163.
4691. gbpln1164.seq - Plant sequence entries (including fungi and algae), part 1164.
4692. gbpln1165.seq - Plant sequence entries (including fungi and algae), part 1165.
4693. gbpln1166.seq - Plant sequence entries (including fungi and algae), part 1166.
4694. gbpln1167.seq - Plant sequence entries (including fungi and algae), part 1167.
4695. gbpln1168.seq - Plant sequence entries (including fungi and algae), part 1168.
4696. gbpln1169.seq - Plant sequence entries (including fungi and algae), part 1169.
4697. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
4698. gbpln1170.seq - Plant sequence entries (including fungi and algae), part 1170.
4699. gbpln1171.seq - Plant sequence entries (including fungi and algae), part 1171.
4700. gbpln1172.seq - Plant sequence entries (including fungi and algae), part 1172.
4701. gbpln1173.seq - Plant sequence entries (including fungi and algae), part 1173.
4702. gbpln1174.seq - Plant sequence entries (including fungi and algae), part 1174.
4703. gbpln1175.seq - Plant sequence entries (including fungi and algae), part 1175.
4704. gbpln1176.seq - Plant sequence entries (including fungi and algae), part 1176.
4705. gbpln1177.seq - Plant sequence entries (including fungi and algae), part 1177.
4706. gbpln1178.seq - Plant sequence entries (including fungi and algae), part 1178.
4707. gbpln1179.seq - Plant sequence entries (including fungi and algae), part 1179.
4708. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
4709. gbpln1180.seq - Plant sequence entries (including fungi and algae), part 1180.
4710. gbpln1181.seq - Plant sequence entries (including fungi and algae), part 1181.
4711. gbpln1182.seq - Plant sequence entries (including fungi and algae), part 1182.
4712. gbpln1183.seq - Plant sequence entries (including fungi and algae), part 1183.
4713. gbpln1184.seq - Plant sequence entries (including fungi and algae), part 1184.
4714. gbpln1185.seq - Plant sequence entries (including fungi and algae), part 1185.
4715. gbpln1186.seq - Plant sequence entries (including fungi and algae), part 1186.
4716. gbpln1187.seq - Plant sequence entries (including fungi and algae), part 1187.
4717. gbpln1188.seq - Plant sequence entries (including fungi and algae), part 1188.
4718. gbpln1189.seq - Plant sequence entries (including fungi and algae), part 1189.
4719. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
4720. gbpln1190.seq - Plant sequence entries (including fungi and algae), part 1190.
4721. gbpln1191.seq - Plant sequence entries (including fungi and algae), part 1191.
4722. gbpln1192.seq - Plant sequence entries (including fungi and algae), part 1192.
4723. gbpln1193.seq - Plant sequence entries (including fungi and algae), part 1193.
4724. gbpln1194.seq - Plant sequence entries (including fungi and algae), part 1194.
4725. gbpln1195.seq - Plant sequence entries (including fungi and algae), part 1195.
4726. gbpln1196.seq - Plant sequence entries (including fungi and algae), part 1196.
4727. gbpln1197.seq - Plant sequence entries (including fungi and algae), part 1197.
4728. gbpln1198.seq - Plant sequence entries (including fungi and algae), part 1198.
4729. gbpln1199.seq - Plant sequence entries (including fungi and algae), part 1199.
4730. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
4731. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
4732. gbpln1200.seq - Plant sequence entries (including fungi and algae), part 1200.
4733. gbpln1201.seq - Plant sequence entries (including fungi and algae), part 1201.
4734. gbpln1202.seq - Plant sequence entries (including fungi and algae), part 1202.
4735. gbpln1203.seq - Plant sequence entries (including fungi and algae), part 1203.
4736. gbpln1204.seq - Plant sequence entries (including fungi and algae), part 1204.
4737. gbpln1205.seq - Plant sequence entries (including fungi and algae), part 1205.
4738. gbpln1206.seq - Plant sequence entries (including fungi and algae), part 1206.
4739. gbpln1207.seq - Plant sequence entries (including fungi and algae), part 1207.
4740. gbpln1208.seq - Plant sequence entries (including fungi and algae), part 1208.
4741. gbpln1209.seq - Plant sequence entries (including fungi and algae), part 1209.
4742. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
4743. gbpln1210.seq - Plant sequence entries (including fungi and algae), part 1210.
4744. gbpln1211.seq - Plant sequence entries (including fungi and algae), part 1211.
4745. gbpln1212.seq - Plant sequence entries (including fungi and algae), part 1212.
4746. gbpln1213.seq - Plant sequence entries (including fungi and algae), part 1213.
4747. gbpln1214.seq - Plant sequence entries (including fungi and algae), part 1214.
4748. gbpln1215.seq - Plant sequence entries (including fungi and algae), part 1215.
4749. gbpln1216.seq - Plant sequence entries (including fungi and algae), part 1216.
4750. gbpln1217.seq - Plant sequence entries (including fungi and algae), part 1217.
4751. gbpln1218.seq - Plant sequence entries (including fungi and algae), part 1218.
4752. gbpln1219.seq - Plant sequence entries (including fungi and algae), part 1219.
4753. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
4754. gbpln1220.seq - Plant sequence entries (including fungi and algae), part 1220.
4755. gbpln1221.seq - Plant sequence entries (including fungi and algae), part 1221.
4756. gbpln1222.seq - Plant sequence entries (including fungi and algae), part 1222.
4757. gbpln1223.seq - Plant sequence entries (including fungi and algae), part 1223.
4758. gbpln1224.seq - Plant sequence entries (including fungi and algae), part 1224.
4759. gbpln1225.seq - Plant sequence entries (including fungi and algae), part 1225.
4760. gbpln1226.seq - Plant sequence entries (including fungi and algae), part 1226.
4761. gbpln1227.seq - Plant sequence entries (including fungi and algae), part 1227.
4762. gbpln1228.seq - Plant sequence entries (including fungi and algae), part 1228.
4763. gbpln1229.seq - Plant sequence entries (including fungi and algae), part 1229.
4764. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
4765. gbpln1230.seq - Plant sequence entries (including fungi and algae), part 1230.
4766. gbpln1231.seq - Plant sequence entries (including fungi and algae), part 1231.
4767. gbpln1232.seq - Plant sequence entries (including fungi and algae), part 1232.
4768. gbpln1233.seq - Plant sequence entries (including fungi and algae), part 1233.
4769. gbpln1234.seq - Plant sequence entries (including fungi and algae), part 1234.
4770. gbpln1235.seq - Plant sequence entries (including fungi and algae), part 1235.
4771. gbpln1236.seq - Plant sequence entries (including fungi and algae), part 1236.
4772. gbpln1237.seq - Plant sequence entries (including fungi and algae), part 1237.
4773. gbpln1238.seq - Plant sequence entries (including fungi and algae), part 1238.
4774. gbpln1239.seq - Plant sequence entries (including fungi and algae), part 1239.
4775. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
4776. gbpln1240.seq - Plant sequence entries (including fungi and algae), part 1240.
4777. gbpln1241.seq - Plant sequence entries (including fungi and algae), part 1241.
4778. gbpln1242.seq - Plant sequence entries (including fungi and algae), part 1242.
4779. gbpln1243.seq - Plant sequence entries (including fungi and algae), part 1243.
4780. gbpln1244.seq - Plant sequence entries (including fungi and algae), part 1244.
4781. gbpln1245.seq - Plant sequence entries (including fungi and algae), part 1245.
4782. gbpln1246.seq - Plant sequence entries (including fungi and algae), part 1246.
4783. gbpln1247.seq - Plant sequence entries (including fungi and algae), part 1247.
4784. gbpln1248.seq - Plant sequence entries (including fungi and algae), part 1248.
4785. gbpln1249.seq - Plant sequence entries (including fungi and algae), part 1249.
4786. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
4787. gbpln1250.seq - Plant sequence entries (including fungi and algae), part 1250.
4788. gbpln1251.seq - Plant sequence entries (including fungi and algae), part 1251.
4789. gbpln1252.seq - Plant sequence entries (including fungi and algae), part 1252.
4790. gbpln1253.seq - Plant sequence entries (including fungi and algae), part 1253.
4791. gbpln1254.seq - Plant sequence entries (including fungi and algae), part 1254.
4792. gbpln1255.seq - Plant sequence entries (including fungi and algae), part 1255.
4793. gbpln1256.seq - Plant sequence entries (including fungi and algae), part 1256.
4794. gbpln1257.seq - Plant sequence entries (including fungi and algae), part 1257.
4795. gbpln1258.seq - Plant sequence entries (including fungi and algae), part 1258.
4796. gbpln1259.seq - Plant sequence entries (including fungi and algae), part 1259.
4797. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
4798. gbpln1260.seq - Plant sequence entries (including fungi and algae), part 1260.
4799. gbpln1261.seq - Plant sequence entries (including fungi and algae), part 1261.
4800. gbpln1262.seq - Plant sequence entries (including fungi and algae), part 1262.
4801. gbpln1263.seq - Plant sequence entries (including fungi and algae), part 1263.
4802. gbpln1264.seq - Plant sequence entries (including fungi and algae), part 1264.
4803. gbpln1265.seq - Plant sequence entries (including fungi and algae), part 1265.
4804. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
4805. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
4806. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
4807. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
4808. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
4809. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
4810. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
4811. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
4812. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
4813. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
4814. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
4815. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
4816. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
4817. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
4818. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
4819. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
4820. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
4821. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
4822. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
4823. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
4824. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
4825. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
4826. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
4827. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
4828. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
4829. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
4830. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
4831. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
4832. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
4833. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
4834. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
4835. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
4836. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
4837. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
4838. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
4839. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
4840. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
4841. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
4842. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
4843. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
4844. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
4845. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
4846. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
4847. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
4848. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
4849. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
4850. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
4851. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
4852. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
4853. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
4854. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
4855. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
4856. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
4857. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
4858. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
4859. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
4860. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
4861. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
4862. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
4863. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
4864. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
4865. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
4866. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
4867. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
4868. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
4869. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
4870. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
4871. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
4872. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
4873. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
4874. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
4875. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
4876. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
4877. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
4878. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
4879. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
4880. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
4881. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
4882. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
4883. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
4884. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
4885. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
4886. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
4887. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
4888. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
4889. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
4890. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
4891. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
4892. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
4893. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
4894. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
4895. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
4896. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
4897. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
4898. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
4899. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
4900. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
4901. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
4902. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
4903. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
4904. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
4905. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
4906. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
4907. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
4908. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
4909. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
4910. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
4911. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
4912. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
4913. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
4914. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
4915. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
4916. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
4917. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
4918. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
4919. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
4920. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
4921. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
4922. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
4923. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
4924. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
4925. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
4926. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
4927. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
4928. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
4929. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
4930. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
4931. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
4932. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
4933. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
4934. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
4935. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
4936. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
4937. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
4938. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
4939. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
4940. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
4941. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
4942. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
4943. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
4944. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
4945. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
4946. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
4947. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
4948. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
4949. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
4950. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
4951. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
4952. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
4953. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
4954. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
4955. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
4956. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
4957. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
4958. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
4959. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
4960. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
4961. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
4962. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
4963. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
4964. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
4965. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
4966. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
4967. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
4968. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
4969. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
4970. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
4971. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
4972. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
4973. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
4974. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
4975. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
4976. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
4977. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
4978. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
4979. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
4980. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
4981. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
4982. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
4983. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
4984. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
4985. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
4986. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
4987. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
4988. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
4989. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
4990. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
4991. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
4992. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
4993. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
4994. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
4995. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
4996. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
4997. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
4998. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
4999. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
5000. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
5001. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
5002. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
5003. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
5004. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
5005. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
5006. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
5007. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
5008. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
5009. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
5010. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
5011. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
5012. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
5013. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
5014. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
5015. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
5016. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
5017. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
5018. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
5019. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
5020. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
5021. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
5022. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
5023. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
5024. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
5025. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
5026. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
5027. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
5028. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
5029. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
5030. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
5031. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
5032. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
5033. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
5034. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
5035. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
5036. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
5037. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
5038. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
5039. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
5040. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
5041. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
5042. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
5043. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
5044. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
5045. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
5046. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
5047. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
5048. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
5049. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
5050. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
5051. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
5052. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
5053. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
5054. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
5055. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
5056. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
5057. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
5058. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
5059. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
5060. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
5061. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
5062. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
5063. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
5064. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
5065. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
5066. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
5067. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
5068. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
5069. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
5070. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
5071. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
5072. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
5073. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
5074. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
5075. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
5076. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
5077. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
5078. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
5079. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
5080. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
5081. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
5082. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
5083. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
5084. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
5085. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
5086. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
5087. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
5088. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
5089. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
5090. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
5091. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
5092. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
5093. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
5094. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
5095. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
5096. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
5097. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
5098. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
5099. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
5100. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
5101. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
5102. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
5103. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
5104. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
5105. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
5106. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
5107. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
5108. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
5109. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
5110. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
5111. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
5112. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
5113. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
5114. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
5115. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
5116. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
5117. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
5118. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
5119. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
5120. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
5121. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
5122. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
5123. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
5124. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
5125. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
5126. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
5127. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
5128. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
5129. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
5130. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
5131. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
5132. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
5133. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
5134. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
5135. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
5136. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
5137. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
5138. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
5139. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
5140. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
5141. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
5142. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
5143. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
5144. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
5145. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
5146. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
5147. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
5148. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
5149. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
5150. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
5151. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
5152. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
5153. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
5154. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
5155. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
5156. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
5157. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
5158. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
5159. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
5160. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
5161. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
5162. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
5163. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
5164. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
5165. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
5166. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
5167. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
5168. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
5169. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
5170. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
5171. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
5172. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
5173. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
5174. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
5175. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
5176. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
5177. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
5178. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
5179. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
5180. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
5181. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
5182. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
5183. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
5184. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
5185. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
5186. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
5187. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
5188. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
5189. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
5190. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
5191. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
5192. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
5193. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
5194. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
5195. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
5196. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
5197. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
5198. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
5199. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
5200. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
5201. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
5202. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
5203. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
5204. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
5205. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
5206. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
5207. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
5208. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
5209. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
5210. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
5211. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
5212. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
5213. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
5214. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
5215. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
5216. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
5217. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
5218. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
5219. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
5220. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
5221. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
5222. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
5223. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
5224. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
5225. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
5226. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
5227. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
5228. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
5229. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
5230. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
5231. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
5232. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
5233. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
5234. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
5235. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
5236. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
5237. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
5238. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
5239. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
5240. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
5241. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
5242. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
5243. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
5244. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
5245. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
5246. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
5247. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
5248. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
5249. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
5250. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
5251. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
5252. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
5253. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
5254. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
5255. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
5256. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
5257. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
5258. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
5259. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
5260. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
5261. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
5262. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
5263. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
5264. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
5265. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
5266. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
5267. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
5268. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
5269. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
5270. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
5271. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548.
5272. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549.
5273. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
5274. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550.
5275. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551.
5276. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552.
5277. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553.
5278. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554.
5279. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555.
5280. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556.
5281. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557.
5282. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558.
5283. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559.
5284. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
5285. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560.
5286. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561.
5287. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562.
5288. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563.
5289. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564.
5290. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565.
5291. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566.
5292. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567.
5293. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568.
5294. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569.
5295. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
5296. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570.
5297. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571.
5298. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572.
5299. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573.
5300. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574.
5301. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575.
5302. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576.
5303. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577.
5304. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578.
5305. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579.
5306. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
5307. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580.
5308. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581.
5309. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582.
5310. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583.
5311. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584.
5312. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585.
5313. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586.
5314. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587.
5315. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588.
5316. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589.
5317. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
5318. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590.
5319. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591.
5320. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592.
5321. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593.
5322. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594.
5323. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595.
5324. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596.
5325. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597.
5326. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598.
5327. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599.
5328. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
5329. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
5330. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600.
5331. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601.
5332. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602.
5333. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603.
5334. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604.
5335. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605.
5336. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606.
5337. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607.
5338. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608.
5339. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609.
5340. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
5341. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610.
5342. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611.
5343. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612.
5344. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613.
5345. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614.
5346. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615.
5347. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616.
5348. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617.
5349. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618.
5350. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619.
5351. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
5352. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620.
5353. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621.
5354. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622.
5355. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623.
5356. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624.
5357. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625.
5358. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626.
5359. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627.
5360. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628.
5361. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629.
5362. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
5363. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630.
5364. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631.
5365. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632.
5366. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633.
5367. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634.
5368. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635.
5369. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636.
5370. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637.
5371. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638.
5372. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639.
5373. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
5374. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640.
5375. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641.
5376. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642.
5377. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643.
5378. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644.
5379. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645.
5380. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646.
5381. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647.
5382. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648.
5383. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649.
5384. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
5385. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650.
5386. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651.
5387. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652.
5388. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653.
5389. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654.
5390. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655.
5391. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656.
5392. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657.
5393. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658.
5394. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659.
5395. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
5396. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660.
5397. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661.
5398. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662.
5399. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663.
5400. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664.
5401. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665.
5402. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666.
5403. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667.
5404. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668.
5405. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669.
5406. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
5407. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670.
5408. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671.
5409. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672.
5410. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673.
5411. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674.
5412. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675.
5413. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676.
5414. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677.
5415. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678.
5416. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679.
5417. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
5418. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680.
5419. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681.
5420. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682.
5421. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683.
5422. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684.
5423. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685.
5424. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686.
5425. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687.
5426. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688.
5427. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689.
5428. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
5429. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690.
5430. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691.
5431. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692.
5432. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693.
5433. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694.
5434. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695.
5435. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696.
5436. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697.
5437. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698.
5438. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699.
5439. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
5440. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
5441. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700.
5442. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701.
5443. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702.
5444. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703.
5445. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704.
5446. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705.
5447. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706.
5448. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707.
5449. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708.
5450. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709.
5451. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
5452. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710.
5453. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711.
5454. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712.
5455. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713.
5456. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714.
5457. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715.
5458. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716.
5459. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717.
5460. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718.
5461. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719.
5462. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
5463. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720.
5464. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721.
5465. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722.
5466. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723.
5467. gbpln724.seq - Plant sequence entries (including fungi and algae), part 724.
5468. gbpln725.seq - Plant sequence entries (including fungi and algae), part 725.
5469. gbpln726.seq - Plant sequence entries (including fungi and algae), part 726.
5470. gbpln727.seq - Plant sequence entries (including fungi and algae), part 727.
5471. gbpln728.seq - Plant sequence entries (including fungi and algae), part 728.
5472. gbpln729.seq - Plant sequence entries (including fungi and algae), part 729.
5473. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
5474. gbpln730.seq - Plant sequence entries (including fungi and algae), part 730.
5475. gbpln731.seq - Plant sequence entries (including fungi and algae), part 731.
5476. gbpln732.seq - Plant sequence entries (including fungi and algae), part 732.
5477. gbpln733.seq - Plant sequence entries (including fungi and algae), part 733.
5478. gbpln734.seq - Plant sequence entries (including fungi and algae), part 734.
5479. gbpln735.seq - Plant sequence entries (including fungi and algae), part 735.
5480. gbpln736.seq - Plant sequence entries (including fungi and algae), part 736.
5481. gbpln737.seq - Plant sequence entries (including fungi and algae), part 737.
5482. gbpln738.seq - Plant sequence entries (including fungi and algae), part 738.
5483. gbpln739.seq - Plant sequence entries (including fungi and algae), part 739.
5484. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
5485. gbpln740.seq - Plant sequence entries (including fungi and algae), part 740.
5486. gbpln741.seq - Plant sequence entries (including fungi and algae), part 741.
5487. gbpln742.seq - Plant sequence entries (including fungi and algae), part 742.
5488. gbpln743.seq - Plant sequence entries (including fungi and algae), part 743.
5489. gbpln744.seq - Plant sequence entries (including fungi and algae), part 744.
5490. gbpln745.seq - Plant sequence entries (including fungi and algae), part 745.
5491. gbpln746.seq - Plant sequence entries (including fungi and algae), part 746.
5492. gbpln747.seq - Plant sequence entries (including fungi and algae), part 747.
5493. gbpln748.seq - Plant sequence entries (including fungi and algae), part 748.
5494. gbpln749.seq - Plant sequence entries (including fungi and algae), part 749.
5495. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
5496. gbpln750.seq - Plant sequence entries (including fungi and algae), part 750.
5497. gbpln751.seq - Plant sequence entries (including fungi and algae), part 751.
5498. gbpln752.seq - Plant sequence entries (including fungi and algae), part 752.
5499. gbpln753.seq - Plant sequence entries (including fungi and algae), part 753.
5500. gbpln754.seq - Plant sequence entries (including fungi and algae), part 754.
5501. gbpln755.seq - Plant sequence entries (including fungi and algae), part 755.
5502. gbpln756.seq - Plant sequence entries (including fungi and algae), part 756.
5503. gbpln757.seq - Plant sequence entries (including fungi and algae), part 757.
5504. gbpln758.seq - Plant sequence entries (including fungi and algae), part 758.
5505. gbpln759.seq - Plant sequence entries (including fungi and algae), part 759.
5506. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
5507. gbpln760.seq - Plant sequence entries (including fungi and algae), part 760.
5508. gbpln761.seq - Plant sequence entries (including fungi and algae), part 761.
5509. gbpln762.seq - Plant sequence entries (including fungi and algae), part 762.
5510. gbpln763.seq - Plant sequence entries (including fungi and algae), part 763.
5511. gbpln764.seq - Plant sequence entries (including fungi and algae), part 764.
5512. gbpln765.seq - Plant sequence entries (including fungi and algae), part 765.
5513. gbpln766.seq - Plant sequence entries (including fungi and algae), part 766.
5514. gbpln767.seq - Plant sequence entries (including fungi and algae), part 767.
5515. gbpln768.seq - Plant sequence entries (including fungi and algae), part 768.
5516. gbpln769.seq - Plant sequence entries (including fungi and algae), part 769.
5517. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
5518. gbpln770.seq - Plant sequence entries (including fungi and algae), part 770.
5519. gbpln771.seq - Plant sequence entries (including fungi and algae), part 771.
5520. gbpln772.seq - Plant sequence entries (including fungi and algae), part 772.
5521. gbpln773.seq - Plant sequence entries (including fungi and algae), part 773.
5522. gbpln774.seq - Plant sequence entries (including fungi and algae), part 774.
5523. gbpln775.seq - Plant sequence entries (including fungi and algae), part 775.
5524. gbpln776.seq - Plant sequence entries (including fungi and algae), part 776.
5525. gbpln777.seq - Plant sequence entries (including fungi and algae), part 777.
5526. gbpln778.seq - Plant sequence entries (including fungi and algae), part 778.
5527. gbpln779.seq - Plant sequence entries (including fungi and algae), part 779.
5528. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
5529. gbpln780.seq - Plant sequence entries (including fungi and algae), part 780.
5530. gbpln781.seq - Plant sequence entries (including fungi and algae), part 781.
5531. gbpln782.seq - Plant sequence entries (including fungi and algae), part 782.
5532. gbpln783.seq - Plant sequence entries (including fungi and algae), part 783.
5533. gbpln784.seq - Plant sequence entries (including fungi and algae), part 784.
5534. gbpln785.seq - Plant sequence entries (including fungi and algae), part 785.
5535. gbpln786.seq - Plant sequence entries (including fungi and algae), part 786.
5536. gbpln787.seq - Plant sequence entries (including fungi and algae), part 787.
5537. gbpln788.seq - Plant sequence entries (including fungi and algae), part 788.
5538. gbpln789.seq - Plant sequence entries (including fungi and algae), part 789.
5539. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
5540. gbpln790.seq - Plant sequence entries (including fungi and algae), part 790.
5541. gbpln791.seq - Plant sequence entries (including fungi and algae), part 791.
5542. gbpln792.seq - Plant sequence entries (including fungi and algae), part 792.
5543. gbpln793.seq - Plant sequence entries (including fungi and algae), part 793.
5544. gbpln794.seq - Plant sequence entries (including fungi and algae), part 794.
5545. gbpln795.seq - Plant sequence entries (including fungi and algae), part 795.
5546. gbpln796.seq - Plant sequence entries (including fungi and algae), part 796.
5547. gbpln797.seq - Plant sequence entries (including fungi and algae), part 797.
5548. gbpln798.seq - Plant sequence entries (including fungi and algae), part 798.
5549. gbpln799.seq - Plant sequence entries (including fungi and algae), part 799.
5550. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
5551. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
5552. gbpln800.seq - Plant sequence entries (including fungi and algae), part 800.
5553. gbpln801.seq - Plant sequence entries (including fungi and algae), part 801.
5554. gbpln802.seq - Plant sequence entries (including fungi and algae), part 802.
5555. gbpln803.seq - Plant sequence entries (including fungi and algae), part 803.
5556. gbpln804.seq - Plant sequence entries (including fungi and algae), part 804.
5557. gbpln805.seq - Plant sequence entries (including fungi and algae), part 805.
5558. gbpln806.seq - Plant sequence entries (including fungi and algae), part 806.
5559. gbpln807.seq - Plant sequence entries (including fungi and algae), part 807.
5560. gbpln808.seq - Plant sequence entries (including fungi and algae), part 808.
5561. gbpln809.seq - Plant sequence entries (including fungi and algae), part 809.
5562. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
5563. gbpln810.seq - Plant sequence entries (including fungi and algae), part 810.
5564. gbpln811.seq - Plant sequence entries (including fungi and algae), part 811.
5565. gbpln812.seq - Plant sequence entries (including fungi and algae), part 812.
5566. gbpln813.seq - Plant sequence entries (including fungi and algae), part 813.
5567. gbpln814.seq - Plant sequence entries (including fungi and algae), part 814.
5568. gbpln815.seq - Plant sequence entries (including fungi and algae), part 815.
5569. gbpln816.seq - Plant sequence entries (including fungi and algae), part 816.
5570. gbpln817.seq - Plant sequence entries (including fungi and algae), part 817.
5571. gbpln818.seq - Plant sequence entries (including fungi and algae), part 818.
5572. gbpln819.seq - Plant sequence entries (including fungi and algae), part 819.
5573. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
5574. gbpln820.seq - Plant sequence entries (including fungi and algae), part 820.
5575. gbpln821.seq - Plant sequence entries (including fungi and algae), part 821.
5576. gbpln822.seq - Plant sequence entries (including fungi and algae), part 822.
5577. gbpln823.seq - Plant sequence entries (including fungi and algae), part 823.
5578. gbpln824.seq - Plant sequence entries (including fungi and algae), part 824.
5579. gbpln825.seq - Plant sequence entries (including fungi and algae), part 825.
5580. gbpln826.seq - Plant sequence entries (including fungi and algae), part 826.
5581. gbpln827.seq - Plant sequence entries (including fungi and algae), part 827.
5582. gbpln828.seq - Plant sequence entries (including fungi and algae), part 828.
5583. gbpln829.seq - Plant sequence entries (including fungi and algae), part 829.
5584. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
5585. gbpln830.seq - Plant sequence entries (including fungi and algae), part 830.
5586. gbpln831.seq - Plant sequence entries (including fungi and algae), part 831.
5587. gbpln832.seq - Plant sequence entries (including fungi and algae), part 832.
5588. gbpln833.seq - Plant sequence entries (including fungi and algae), part 833.
5589. gbpln834.seq - Plant sequence entries (including fungi and algae), part 834.
5590. gbpln835.seq - Plant sequence entries (including fungi and algae), part 835.
5591. gbpln836.seq - Plant sequence entries (including fungi and algae), part 836.
5592. gbpln837.seq - Plant sequence entries (including fungi and algae), part 837.
5593. gbpln838.seq - Plant sequence entries (including fungi and algae), part 838.
5594. gbpln839.seq - Plant sequence entries (including fungi and algae), part 839.
5595. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
5596. gbpln840.seq - Plant sequence entries (including fungi and algae), part 840.
5597. gbpln841.seq - Plant sequence entries (including fungi and algae), part 841.
5598. gbpln842.seq - Plant sequence entries (including fungi and algae), part 842.
5599. gbpln843.seq - Plant sequence entries (including fungi and algae), part 843.
5600. gbpln844.seq - Plant sequence entries (including fungi and algae), part 844.
5601. gbpln845.seq - Plant sequence entries (including fungi and algae), part 845.
5602. gbpln846.seq - Plant sequence entries (including fungi and algae), part 846.
5603. gbpln847.seq - Plant sequence entries (including fungi and algae), part 847.
5604. gbpln848.seq - Plant sequence entries (including fungi and algae), part 848.
5605. gbpln849.seq - Plant sequence entries (including fungi and algae), part 849.
5606. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
5607. gbpln850.seq - Plant sequence entries (including fungi and algae), part 850.
5608. gbpln851.seq - Plant sequence entries (including fungi and algae), part 851.
5609. gbpln852.seq - Plant sequence entries (including fungi and algae), part 852.
5610. gbpln853.seq - Plant sequence entries (including fungi and algae), part 853.
5611. gbpln854.seq - Plant sequence entries (including fungi and algae), part 854.
5612. gbpln855.seq - Plant sequence entries (including fungi and algae), part 855.
5613. gbpln856.seq - Plant sequence entries (including fungi and algae), part 856.
5614. gbpln857.seq - Plant sequence entries (including fungi and algae), part 857.
5615. gbpln858.seq - Plant sequence entries (including fungi and algae), part 858.
5616. gbpln859.seq - Plant sequence entries (including fungi and algae), part 859.
5617. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
5618. gbpln860.seq - Plant sequence entries (including fungi and algae), part 860.
5619. gbpln861.seq - Plant sequence entries (including fungi and algae), part 861.
5620. gbpln862.seq - Plant sequence entries (including fungi and algae), part 862.
5621. gbpln863.seq - Plant sequence entries (including fungi and algae), part 863.
5622. gbpln864.seq - Plant sequence entries (including fungi and algae), part 864.
5623. gbpln865.seq - Plant sequence entries (including fungi and algae), part 865.
5624. gbpln866.seq - Plant sequence entries (including fungi and algae), part 866.
5625. gbpln867.seq - Plant sequence entries (including fungi and algae), part 867.
5626. gbpln868.seq - Plant sequence entries (including fungi and algae), part 868.
5627. gbpln869.seq - Plant sequence entries (including fungi and algae), part 869.
5628. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
5629. gbpln870.seq - Plant sequence entries (including fungi and algae), part 870.
5630. gbpln871.seq - Plant sequence entries (including fungi and algae), part 871.
5631. gbpln872.seq - Plant sequence entries (including fungi and algae), part 872.
5632. gbpln873.seq - Plant sequence entries (including fungi and algae), part 873.
5633. gbpln874.seq - Plant sequence entries (including fungi and algae), part 874.
5634. gbpln875.seq - Plant sequence entries (including fungi and algae), part 875.
5635. gbpln876.seq - Plant sequence entries (including fungi and algae), part 876.
5636. gbpln877.seq - Plant sequence entries (including fungi and algae), part 877.
5637. gbpln878.seq - Plant sequence entries (including fungi and algae), part 878.
5638. gbpln879.seq - Plant sequence entries (including fungi and algae), part 879.
5639. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
5640. gbpln880.seq - Plant sequence entries (including fungi and algae), part 880.
5641. gbpln881.seq - Plant sequence entries (including fungi and algae), part 881.
5642. gbpln882.seq - Plant sequence entries (including fungi and algae), part 882.
5643. gbpln883.seq - Plant sequence entries (including fungi and algae), part 883.
5644. gbpln884.seq - Plant sequence entries (including fungi and algae), part 884.
5645. gbpln885.seq - Plant sequence entries (including fungi and algae), part 885.
5646. gbpln886.seq - Plant sequence entries (including fungi and algae), part 886.
5647. gbpln887.seq - Plant sequence entries (including fungi and algae), part 887.
5648. gbpln888.seq - Plant sequence entries (including fungi and algae), part 888.
5649. gbpln889.seq - Plant sequence entries (including fungi and algae), part 889.
5650. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
5651. gbpln890.seq - Plant sequence entries (including fungi and algae), part 890.
5652. gbpln891.seq - Plant sequence entries (including fungi and algae), part 891.
5653. gbpln892.seq - Plant sequence entries (including fungi and algae), part 892.
5654. gbpln893.seq - Plant sequence entries (including fungi and algae), part 893.
5655. gbpln894.seq - Plant sequence entries (including fungi and algae), part 894.
5656. gbpln895.seq - Plant sequence entries (including fungi and algae), part 895.
5657. gbpln896.seq - Plant sequence entries (including fungi and algae), part 896.
5658. gbpln897.seq - Plant sequence entries (including fungi and algae), part 897.
5659. gbpln898.seq - Plant sequence entries (including fungi and algae), part 898.
5660. gbpln899.seq - Plant sequence entries (including fungi and algae), part 899.
5661. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
5662. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
5663. gbpln900.seq - Plant sequence entries (including fungi and algae), part 900.
5664. gbpln901.seq - Plant sequence entries (including fungi and algae), part 901.
5665. gbpln902.seq - Plant sequence entries (including fungi and algae), part 902.
5666. gbpln903.seq - Plant sequence entries (including fungi and algae), part 903.
5667. gbpln904.seq - Plant sequence entries (including fungi and algae), part 904.
5668. gbpln905.seq - Plant sequence entries (including fungi and algae), part 905.
5669. gbpln906.seq - Plant sequence entries (including fungi and algae), part 906.
5670. gbpln907.seq - Plant sequence entries (including fungi and algae), part 907.
5671. gbpln908.seq - Plant sequence entries (including fungi and algae), part 908.
5672. gbpln909.seq - Plant sequence entries (including fungi and algae), part 909.
5673. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
5674. gbpln910.seq - Plant sequence entries (including fungi and algae), part 910.
5675. gbpln911.seq - Plant sequence entries (including fungi and algae), part 911.
5676. gbpln912.seq - Plant sequence entries (including fungi and algae), part 912.
5677. gbpln913.seq - Plant sequence entries (including fungi and algae), part 913.
5678. gbpln914.seq - Plant sequence entries (including fungi and algae), part 914.
5679. gbpln915.seq - Plant sequence entries (including fungi and algae), part 915.
5680. gbpln916.seq - Plant sequence entries (including fungi and algae), part 916.
5681. gbpln917.seq - Plant sequence entries (including fungi and algae), part 917.
5682. gbpln918.seq - Plant sequence entries (including fungi and algae), part 918.
5683. gbpln919.seq - Plant sequence entries (including fungi and algae), part 919.
5684. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
5685. gbpln920.seq - Plant sequence entries (including fungi and algae), part 920.
5686. gbpln921.seq - Plant sequence entries (including fungi and algae), part 921.
5687. gbpln922.seq - Plant sequence entries (including fungi and algae), part 922.
5688. gbpln923.seq - Plant sequence entries (including fungi and algae), part 923.
5689. gbpln924.seq - Plant sequence entries (including fungi and algae), part 924.
5690. gbpln925.seq - Plant sequence entries (including fungi and algae), part 925.
5691. gbpln926.seq - Plant sequence entries (including fungi and algae), part 926.
5692. gbpln927.seq - Plant sequence entries (including fungi and algae), part 927.
5693. gbpln928.seq - Plant sequence entries (including fungi and algae), part 928.
5694. gbpln929.seq - Plant sequence entries (including fungi and algae), part 929.
5695. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
5696. gbpln930.seq - Plant sequence entries (including fungi and algae), part 930.
5697. gbpln931.seq - Plant sequence entries (including fungi and algae), part 931.
5698. gbpln932.seq - Plant sequence entries (including fungi and algae), part 932.
5699. gbpln933.seq - Plant sequence entries (including fungi and algae), part 933.
5700. gbpln934.seq - Plant sequence entries (including fungi and algae), part 934.
5701. gbpln935.seq - Plant sequence entries (including fungi and algae), part 935.
5702. gbpln936.seq - Plant sequence entries (including fungi and algae), part 936.
5703. gbpln937.seq - Plant sequence entries (including fungi and algae), part 937.
5704. gbpln938.seq - Plant sequence entries (including fungi and algae), part 938.
5705. gbpln939.seq - Plant sequence entries (including fungi and algae), part 939.
5706. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
5707. gbpln940.seq - Plant sequence entries (including fungi and algae), part 940.
5708. gbpln941.seq - Plant sequence entries (including fungi and algae), part 941.
5709. gbpln942.seq - Plant sequence entries (including fungi and algae), part 942.
5710. gbpln943.seq - Plant sequence entries (including fungi and algae), part 943.
5711. gbpln944.seq - Plant sequence entries (including fungi and algae), part 944.
5712. gbpln945.seq - Plant sequence entries (including fungi and algae), part 945.
5713. gbpln946.seq - Plant sequence entries (including fungi and algae), part 946.
5714. gbpln947.seq - Plant sequence entries (including fungi and algae), part 947.
5715. gbpln948.seq - Plant sequence entries (including fungi and algae), part 948.
5716. gbpln949.seq - Plant sequence entries (including fungi and algae), part 949.
5717. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
5718. gbpln950.seq - Plant sequence entries (including fungi and algae), part 950.
5719. gbpln951.seq - Plant sequence entries (including fungi and algae), part 951.
5720. gbpln952.seq - Plant sequence entries (including fungi and algae), part 952.
5721. gbpln953.seq - Plant sequence entries (including fungi and algae), part 953.
5722. gbpln954.seq - Plant sequence entries (including fungi and algae), part 954.
5723. gbpln955.seq - Plant sequence entries (including fungi and algae), part 955.
5724. gbpln956.seq - Plant sequence entries (including fungi and algae), part 956.
5725. gbpln957.seq - Plant sequence entries (including fungi and algae), part 957.
5726. gbpln958.seq - Plant sequence entries (including fungi and algae), part 958.
5727. gbpln959.seq - Plant sequence entries (including fungi and algae), part 959.
5728. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
5729. gbpln960.seq - Plant sequence entries (including fungi and algae), part 960.
5730. gbpln961.seq - Plant sequence entries (including fungi and algae), part 961.
5731. gbpln962.seq - Plant sequence entries (including fungi and algae), part 962.
5732. gbpln963.seq - Plant sequence entries (including fungi and algae), part 963.
5733. gbpln964.seq - Plant sequence entries (including fungi and algae), part 964.
5734. gbpln965.seq - Plant sequence entries (including fungi and algae), part 965.
5735. gbpln966.seq - Plant sequence entries (including fungi and algae), part 966.
5736. gbpln967.seq - Plant sequence entries (including fungi and algae), part 967.
5737. gbpln968.seq - Plant sequence entries (including fungi and algae), part 968.
5738. gbpln969.seq - Plant sequence entries (including fungi and algae), part 969.
5739. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
5740. gbpln970.seq - Plant sequence entries (including fungi and algae), part 970.
5741. gbpln971.seq - Plant sequence entries (including fungi and algae), part 971.
5742. gbpln972.seq - Plant sequence entries (including fungi and algae), part 972.
5743. gbpln973.seq - Plant sequence entries (including fungi and algae), part 973.
5744. gbpln974.seq - Plant sequence entries (including fungi and algae), part 974.
5745. gbpln975.seq - Plant sequence entries (including fungi and algae), part 975.
5746. gbpln976.seq - Plant sequence entries (including fungi and algae), part 976.
5747. gbpln977.seq - Plant sequence entries (including fungi and algae), part 977.
5748. gbpln978.seq - Plant sequence entries (including fungi and algae), part 978.
5749. gbpln979.seq - Plant sequence entries (including fungi and algae), part 979.
5750. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
5751. gbpln980.seq - Plant sequence entries (including fungi and algae), part 980.
5752. gbpln981.seq - Plant sequence entries (including fungi and algae), part 981.
5753. gbpln982.seq - Plant sequence entries (including fungi and algae), part 982.
5754. gbpln983.seq - Plant sequence entries (including fungi and algae), part 983.
5755. gbpln984.seq - Plant sequence entries (including fungi and algae), part 984.
5756. gbpln985.seq - Plant sequence entries (including fungi and algae), part 985.
5757. gbpln986.seq - Plant sequence entries (including fungi and algae), part 986.
5758. gbpln987.seq - Plant sequence entries (including fungi and algae), part 987.
5759. gbpln988.seq - Plant sequence entries (including fungi and algae), part 988.
5760. gbpln989.seq - Plant sequence entries (including fungi and algae), part 989.
5761. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
5762. gbpln990.seq - Plant sequence entries (including fungi and algae), part 990.
5763. gbpln991.seq - Plant sequence entries (including fungi and algae), part 991.
5764. gbpln992.seq - Plant sequence entries (including fungi and algae), part 992.
5765. gbpln993.seq - Plant sequence entries (including fungi and algae), part 993.
5766. gbpln994.seq - Plant sequence entries (including fungi and algae), part 994.
5767. gbpln995.seq - Plant sequence entries (including fungi and algae), part 995.
5768. gbpln996.seq - Plant sequence entries (including fungi and algae), part 996.
5769. gbpln997.seq - Plant sequence entries (including fungi and algae), part 997.
5770. gbpln998.seq - Plant sequence entries (including fungi and algae), part 998.
5771. gbpln999.seq - Plant sequence entries (including fungi and algae), part 999.
5772. gbpri1.seq - Primate sequence entries, part 1.
5773. gbpri10.seq - Primate sequence entries, part 10.
5774. gbpri11.seq - Primate sequence entries, part 11.
5775. gbpri12.seq - Primate sequence entries, part 12.
5776. gbpri13.seq - Primate sequence entries, part 13.
5777. gbpri14.seq - Primate sequence entries, part 14.
5778. gbpri15.seq - Primate sequence entries, part 15.
5779. gbpri16.seq - Primate sequence entries, part 16.
5780. gbpri17.seq - Primate sequence entries, part 17.
5781. gbpri18.seq - Primate sequence entries, part 18.
5782. gbpri19.seq - Primate sequence entries, part 19.
5783. gbpri2.seq - Primate sequence entries, part 2.
5784. gbpri20.seq - Primate sequence entries, part 20.
5785. gbpri21.seq - Primate sequence entries, part 21.
5786. gbpri22.seq - Primate sequence entries, part 22.
5787. gbpri23.seq - Primate sequence entries, part 23.
5788. gbpri24.seq - Primate sequence entries, part 24.
5789. gbpri25.seq - Primate sequence entries, part 25.
5790. gbpri26.seq - Primate sequence entries, part 26.
5791. gbpri27.seq - Primate sequence entries, part 27.
5792. gbpri28.seq - Primate sequence entries, part 28.
5793. gbpri29.seq - Primate sequence entries, part 29.
5794. gbpri3.seq - Primate sequence entries, part 3.
5795. gbpri30.seq - Primate sequence entries, part 30.
5796. gbpri31.seq - Primate sequence entries, part 31.
5797. gbpri32.seq - Primate sequence entries, part 32.
5798. gbpri33.seq - Primate sequence entries, part 33.
5799. gbpri34.seq - Primate sequence entries, part 34.
5800. gbpri35.seq - Primate sequence entries, part 35.
5801. gbpri36.seq - Primate sequence entries, part 36.
5802. gbpri37.seq - Primate sequence entries, part 37.
5803. gbpri38.seq - Primate sequence entries, part 38.
5804. gbpri39.seq - Primate sequence entries, part 39.
5805. gbpri4.seq - Primate sequence entries, part 4.
5806. gbpri40.seq - Primate sequence entries, part 40.
5807. gbpri41.seq - Primate sequence entries, part 41.
5808. gbpri42.seq - Primate sequence entries, part 42.
5809. gbpri43.seq - Primate sequence entries, part 43.
5810. gbpri44.seq - Primate sequence entries, part 44.
5811. gbpri45.seq - Primate sequence entries, part 45.
5812. gbpri46.seq - Primate sequence entries, part 46.
5813. gbpri47.seq - Primate sequence entries, part 47.
5814. gbpri48.seq - Primate sequence entries, part 48.
5815. gbpri49.seq - Primate sequence entries, part 49.
5816. gbpri5.seq - Primate sequence entries, part 5.
5817. gbpri50.seq - Primate sequence entries, part 50.
5818. gbpri51.seq - Primate sequence entries, part 51.
5819. gbpri52.seq - Primate sequence entries, part 52.
5820. gbpri53.seq - Primate sequence entries, part 53.
5821. gbpri54.seq - Primate sequence entries, part 54.
5822. gbpri55.seq - Primate sequence entries, part 55.
5823. gbpri56.seq - Primate sequence entries, part 56.
5824. gbpri57.seq - Primate sequence entries, part 57.
5825. gbpri58.seq - Primate sequence entries, part 58.
5826. gbpri6.seq - Primate sequence entries, part 6.
5827. gbpri7.seq - Primate sequence entries, part 7.
5828. gbpri8.seq - Primate sequence entries, part 8.
5829. gbpri9.seq - Primate sequence entries, part 9.
5830. gbrel.txt - Release notes (this document).
5831. gbrod1.seq - Rodent sequence entries, part 1.
5832. gbrod10.seq - Rodent sequence entries, part 10.
5833. gbrod100.seq - Rodent sequence entries, part 100.
5834. gbrod101.seq - Rodent sequence entries, part 101.
5835. gbrod102.seq - Rodent sequence entries, part 102.
5836. gbrod103.seq - Rodent sequence entries, part 103.
5837. gbrod104.seq - Rodent sequence entries, part 104.
5838. gbrod105.seq - Rodent sequence entries, part 105.
5839. gbrod106.seq - Rodent sequence entries, part 106.
5840. gbrod107.seq - Rodent sequence entries, part 107.
5841. gbrod108.seq - Rodent sequence entries, part 108.
5842. gbrod109.seq - Rodent sequence entries, part 109.
5843. gbrod11.seq - Rodent sequence entries, part 11.
5844. gbrod110.seq - Rodent sequence entries, part 110.
5845. gbrod111.seq - Rodent sequence entries, part 111.
5846. gbrod112.seq - Rodent sequence entries, part 112.
5847. gbrod113.seq - Rodent sequence entries, part 113.
5848. gbrod114.seq - Rodent sequence entries, part 114.
5849. gbrod115.seq - Rodent sequence entries, part 115.
5850. gbrod116.seq - Rodent sequence entries, part 116.
5851. gbrod117.seq - Rodent sequence entries, part 117.
5852. gbrod118.seq - Rodent sequence entries, part 118.
5853. gbrod119.seq - Rodent sequence entries, part 119.
5854. gbrod12.seq - Rodent sequence entries, part 12.
5855. gbrod120.seq - Rodent sequence entries, part 120.
5856. gbrod121.seq - Rodent sequence entries, part 121.
5857. gbrod122.seq - Rodent sequence entries, part 122.
5858. gbrod123.seq - Rodent sequence entries, part 123.
5859. gbrod124.seq - Rodent sequence entries, part 124.
5860. gbrod125.seq - Rodent sequence entries, part 125.
5861. gbrod126.seq - Rodent sequence entries, part 126.
5862. gbrod127.seq - Rodent sequence entries, part 127.
5863. gbrod128.seq - Rodent sequence entries, part 128.
5864. gbrod129.seq - Rodent sequence entries, part 129.
5865. gbrod13.seq - Rodent sequence entries, part 13.
5866. gbrod130.seq - Rodent sequence entries, part 130.
5867. gbrod131.seq - Rodent sequence entries, part 131.
5868. gbrod132.seq - Rodent sequence entries, part 132.
5869. gbrod133.seq - Rodent sequence entries, part 133.
5870. gbrod134.seq - Rodent sequence entries, part 134.
5871. gbrod135.seq - Rodent sequence entries, part 135.
5872. gbrod136.seq - Rodent sequence entries, part 136.
5873. gbrod137.seq - Rodent sequence entries, part 137.
5874. gbrod138.seq - Rodent sequence entries, part 138.
5875. gbrod139.seq - Rodent sequence entries, part 139.
5876. gbrod14.seq - Rodent sequence entries, part 14.
5877. gbrod140.seq - Rodent sequence entries, part 140.
5878. gbrod141.seq - Rodent sequence entries, part 141.
5879. gbrod142.seq - Rodent sequence entries, part 142.
5880. gbrod143.seq - Rodent sequence entries, part 143.
5881. gbrod144.seq - Rodent sequence entries, part 144.
5882. gbrod145.seq - Rodent sequence entries, part 145.
5883. gbrod146.seq - Rodent sequence entries, part 146.
5884. gbrod147.seq - Rodent sequence entries, part 147.
5885. gbrod148.seq - Rodent sequence entries, part 148.
5886. gbrod149.seq - Rodent sequence entries, part 149.
5887. gbrod15.seq - Rodent sequence entries, part 15.
5888. gbrod150.seq - Rodent sequence entries, part 150.
5889. gbrod151.seq - Rodent sequence entries, part 151.
5890. gbrod152.seq - Rodent sequence entries, part 152.
5891. gbrod153.seq - Rodent sequence entries, part 153.
5892. gbrod154.seq - Rodent sequence entries, part 154.
5893. gbrod155.seq - Rodent sequence entries, part 155.
5894. gbrod156.seq - Rodent sequence entries, part 156.
5895. gbrod157.seq - Rodent sequence entries, part 157.
5896. gbrod158.seq - Rodent sequence entries, part 158.
5897. gbrod159.seq - Rodent sequence entries, part 159.
5898. gbrod16.seq - Rodent sequence entries, part 16.
5899. gbrod160.seq - Rodent sequence entries, part 160.
5900. gbrod161.seq - Rodent sequence entries, part 161.
5901. gbrod162.seq - Rodent sequence entries, part 162.
5902. gbrod163.seq - Rodent sequence entries, part 163.
5903. gbrod164.seq - Rodent sequence entries, part 164.
5904. gbrod165.seq - Rodent sequence entries, part 165.
5905. gbrod166.seq - Rodent sequence entries, part 166.
5906. gbrod167.seq - Rodent sequence entries, part 167.
5907. gbrod168.seq - Rodent sequence entries, part 168.
5908. gbrod169.seq - Rodent sequence entries, part 169.
5909. gbrod17.seq - Rodent sequence entries, part 17.
5910. gbrod170.seq - Rodent sequence entries, part 170.
5911. gbrod171.seq - Rodent sequence entries, part 171.
5912. gbrod172.seq - Rodent sequence entries, part 172.
5913. gbrod173.seq - Rodent sequence entries, part 173.
5914. gbrod174.seq - Rodent sequence entries, part 174.
5915. gbrod175.seq - Rodent sequence entries, part 175.
5916. gbrod176.seq - Rodent sequence entries, part 176.
5917. gbrod177.seq - Rodent sequence entries, part 177.
5918. gbrod178.seq - Rodent sequence entries, part 178.
5919. gbrod179.seq - Rodent sequence entries, part 179.
5920. gbrod18.seq - Rodent sequence entries, part 18.
5921. gbrod180.seq - Rodent sequence entries, part 180.
5922. gbrod181.seq - Rodent sequence entries, part 181.
5923. gbrod182.seq - Rodent sequence entries, part 182.
5924. gbrod183.seq - Rodent sequence entries, part 183.
5925. gbrod184.seq - Rodent sequence entries, part 184.
5926. gbrod185.seq - Rodent sequence entries, part 185.
5927. gbrod186.seq - Rodent sequence entries, part 186.
5928. gbrod187.seq - Rodent sequence entries, part 187.
5929. gbrod188.seq - Rodent sequence entries, part 188.
5930. gbrod189.seq - Rodent sequence entries, part 189.
5931. gbrod19.seq - Rodent sequence entries, part 19.
5932. gbrod190.seq - Rodent sequence entries, part 190.
5933. gbrod191.seq - Rodent sequence entries, part 191.
5934. gbrod192.seq - Rodent sequence entries, part 192.
5935. gbrod193.seq - Rodent sequence entries, part 193.
5936. gbrod194.seq - Rodent sequence entries, part 194.
5937. gbrod195.seq - Rodent sequence entries, part 195.
5938. gbrod196.seq - Rodent sequence entries, part 196.
5939. gbrod197.seq - Rodent sequence entries, part 197.
5940. gbrod198.seq - Rodent sequence entries, part 198.
5941. gbrod199.seq - Rodent sequence entries, part 199.
5942. gbrod2.seq - Rodent sequence entries, part 2.
5943. gbrod20.seq - Rodent sequence entries, part 20.
5944. gbrod200.seq - Rodent sequence entries, part 200.
5945. gbrod201.seq - Rodent sequence entries, part 201.
5946. gbrod202.seq - Rodent sequence entries, part 202.
5947. gbrod203.seq - Rodent sequence entries, part 203.
5948. gbrod204.seq - Rodent sequence entries, part 204.
5949. gbrod205.seq - Rodent sequence entries, part 205.
5950. gbrod206.seq - Rodent sequence entries, part 206.
5951. gbrod207.seq - Rodent sequence entries, part 207.
5952. gbrod208.seq - Rodent sequence entries, part 208.
5953. gbrod209.seq - Rodent sequence entries, part 209.
5954. gbrod21.seq - Rodent sequence entries, part 21.
5955. gbrod210.seq - Rodent sequence entries, part 210.
5956. gbrod211.seq - Rodent sequence entries, part 211.
5957. gbrod212.seq - Rodent sequence entries, part 212.
5958. gbrod213.seq - Rodent sequence entries, part 213.
5959. gbrod214.seq - Rodent sequence entries, part 214.
5960. gbrod215.seq - Rodent sequence entries, part 215.
5961. gbrod216.seq - Rodent sequence entries, part 216.
5962. gbrod217.seq - Rodent sequence entries, part 217.
5963. gbrod218.seq - Rodent sequence entries, part 218.
5964. gbrod219.seq - Rodent sequence entries, part 219.
5965. gbrod22.seq - Rodent sequence entries, part 22.
5966. gbrod220.seq - Rodent sequence entries, part 220.
5967. gbrod221.seq - Rodent sequence entries, part 221.
5968. gbrod222.seq - Rodent sequence entries, part 222.
5969. gbrod223.seq - Rodent sequence entries, part 223.
5970. gbrod224.seq - Rodent sequence entries, part 224.
5971. gbrod225.seq - Rodent sequence entries, part 225.
5972. gbrod226.seq - Rodent sequence entries, part 226.
5973. gbrod227.seq - Rodent sequence entries, part 227.
5974. gbrod228.seq - Rodent sequence entries, part 228.
5975. gbrod229.seq - Rodent sequence entries, part 229.
5976. gbrod23.seq - Rodent sequence entries, part 23.
5977. gbrod230.seq - Rodent sequence entries, part 230.
5978. gbrod231.seq - Rodent sequence entries, part 231.
5979. gbrod232.seq - Rodent sequence entries, part 232.
5980. gbrod233.seq - Rodent sequence entries, part 233.
5981. gbrod234.seq - Rodent sequence entries, part 234.
5982. gbrod235.seq - Rodent sequence entries, part 235.
5983. gbrod236.seq - Rodent sequence entries, part 236.
5984. gbrod237.seq - Rodent sequence entries, part 237.
5985. gbrod238.seq - Rodent sequence entries, part 238.
5986. gbrod239.seq - Rodent sequence entries, part 239.
5987. gbrod24.seq - Rodent sequence entries, part 24.
5988. gbrod240.seq - Rodent sequence entries, part 240.
5989. gbrod241.seq - Rodent sequence entries, part 241.
5990. gbrod242.seq - Rodent sequence entries, part 242.
5991. gbrod243.seq - Rodent sequence entries, part 243.
5992. gbrod244.seq - Rodent sequence entries, part 244.
5993. gbrod245.seq - Rodent sequence entries, part 245.
5994. gbrod246.seq - Rodent sequence entries, part 246.
5995. gbrod247.seq - Rodent sequence entries, part 247.
5996. gbrod248.seq - Rodent sequence entries, part 248.
5997. gbrod249.seq - Rodent sequence entries, part 249.
5998. gbrod25.seq - Rodent sequence entries, part 25.
5999. gbrod250.seq - Rodent sequence entries, part 250.
6000. gbrod251.seq - Rodent sequence entries, part 251.
6001. gbrod252.seq - Rodent sequence entries, part 252.
6002. gbrod253.seq - Rodent sequence entries, part 253.
6003. gbrod254.seq - Rodent sequence entries, part 254.
6004. gbrod255.seq - Rodent sequence entries, part 255.
6005. gbrod256.seq - Rodent sequence entries, part 256.
6006. gbrod257.seq - Rodent sequence entries, part 257.
6007. gbrod258.seq - Rodent sequence entries, part 258.
6008. gbrod259.seq - Rodent sequence entries, part 259.
6009. gbrod26.seq - Rodent sequence entries, part 26.
6010. gbrod260.seq - Rodent sequence entries, part 260.
6011. gbrod261.seq - Rodent sequence entries, part 261.
6012. gbrod262.seq - Rodent sequence entries, part 262.
6013. gbrod263.seq - Rodent sequence entries, part 263.
6014. gbrod264.seq - Rodent sequence entries, part 264.
6015. gbrod265.seq - Rodent sequence entries, part 265.
6016. gbrod266.seq - Rodent sequence entries, part 266.
6017. gbrod267.seq - Rodent sequence entries, part 267.
6018. gbrod268.seq - Rodent sequence entries, part 268.
6019. gbrod269.seq - Rodent sequence entries, part 269.
6020. gbrod27.seq - Rodent sequence entries, part 27.
6021. gbrod270.seq - Rodent sequence entries, part 270.
6022. gbrod271.seq - Rodent sequence entries, part 271.
6023. gbrod272.seq - Rodent sequence entries, part 272.
6024. gbrod273.seq - Rodent sequence entries, part 273.
6025. gbrod274.seq - Rodent sequence entries, part 274.
6026. gbrod275.seq - Rodent sequence entries, part 275.
6027. gbrod276.seq - Rodent sequence entries, part 276.
6028. gbrod277.seq - Rodent sequence entries, part 277.
6029. gbrod278.seq - Rodent sequence entries, part 278.
6030. gbrod279.seq - Rodent sequence entries, part 279.
6031. gbrod28.seq - Rodent sequence entries, part 28.
6032. gbrod280.seq - Rodent sequence entries, part 280.
6033. gbrod281.seq - Rodent sequence entries, part 281.
6034. gbrod282.seq - Rodent sequence entries, part 282.
6035. gbrod283.seq - Rodent sequence entries, part 283.
6036. gbrod284.seq - Rodent sequence entries, part 284.
6037. gbrod285.seq - Rodent sequence entries, part 285.
6038. gbrod286.seq - Rodent sequence entries, part 286.
6039. gbrod287.seq - Rodent sequence entries, part 287.
6040. gbrod288.seq - Rodent sequence entries, part 288.
6041. gbrod289.seq - Rodent sequence entries, part 289.
6042. gbrod29.seq - Rodent sequence entries, part 29.
6043. gbrod290.seq - Rodent sequence entries, part 290.
6044. gbrod291.seq - Rodent sequence entries, part 291.
6045. gbrod292.seq - Rodent sequence entries, part 292.
6046. gbrod293.seq - Rodent sequence entries, part 293.
6047. gbrod294.seq - Rodent sequence entries, part 294.
6048. gbrod295.seq - Rodent sequence entries, part 295.
6049. gbrod296.seq - Rodent sequence entries, part 296.
6050. gbrod297.seq - Rodent sequence entries, part 297.
6051. gbrod298.seq - Rodent sequence entries, part 298.
6052. gbrod299.seq - Rodent sequence entries, part 299.
6053. gbrod3.seq - Rodent sequence entries, part 3.
6054. gbrod30.seq - Rodent sequence entries, part 30.
6055. gbrod300.seq - Rodent sequence entries, part 300.
6056. gbrod301.seq - Rodent sequence entries, part 301.
6057. gbrod302.seq - Rodent sequence entries, part 302.
6058. gbrod303.seq - Rodent sequence entries, part 303.
6059. gbrod304.seq - Rodent sequence entries, part 304.
6060. gbrod305.seq - Rodent sequence entries, part 305.
6061. gbrod306.seq - Rodent sequence entries, part 306.
6062. gbrod31.seq - Rodent sequence entries, part 31.
6063. gbrod32.seq - Rodent sequence entries, part 32.
6064. gbrod33.seq - Rodent sequence entries, part 33.
6065. gbrod34.seq - Rodent sequence entries, part 34.
6066. gbrod35.seq - Rodent sequence entries, part 35.
6067. gbrod36.seq - Rodent sequence entries, part 36.
6068. gbrod37.seq - Rodent sequence entries, part 37.
6069. gbrod38.seq - Rodent sequence entries, part 38.
6070. gbrod39.seq - Rodent sequence entries, part 39.
6071. gbrod4.seq - Rodent sequence entries, part 4.
6072. gbrod40.seq - Rodent sequence entries, part 40.
6073. gbrod41.seq - Rodent sequence entries, part 41.
6074. gbrod42.seq - Rodent sequence entries, part 42.
6075. gbrod43.seq - Rodent sequence entries, part 43.
6076. gbrod44.seq - Rodent sequence entries, part 44.
6077. gbrod45.seq - Rodent sequence entries, part 45.
6078. gbrod46.seq - Rodent sequence entries, part 46.
6079. gbrod47.seq - Rodent sequence entries, part 47.
6080. gbrod48.seq - Rodent sequence entries, part 48.
6081. gbrod49.seq - Rodent sequence entries, part 49.
6082. gbrod5.seq - Rodent sequence entries, part 5.
6083. gbrod50.seq - Rodent sequence entries, part 50.
6084. gbrod51.seq - Rodent sequence entries, part 51.
6085. gbrod52.seq - Rodent sequence entries, part 52.
6086. gbrod53.seq - Rodent sequence entries, part 53.
6087. gbrod54.seq - Rodent sequence entries, part 54.
6088. gbrod55.seq - Rodent sequence entries, part 55.
6089. gbrod56.seq - Rodent sequence entries, part 56.
6090. gbrod57.seq - Rodent sequence entries, part 57.
6091. gbrod58.seq - Rodent sequence entries, part 58.
6092. gbrod59.seq - Rodent sequence entries, part 59.
6093. gbrod6.seq - Rodent sequence entries, part 6.
6094. gbrod60.seq - Rodent sequence entries, part 60.
6095. gbrod61.seq - Rodent sequence entries, part 61.
6096. gbrod62.seq - Rodent sequence entries, part 62.
6097. gbrod63.seq - Rodent sequence entries, part 63.
6098. gbrod64.seq - Rodent sequence entries, part 64.
6099. gbrod65.seq - Rodent sequence entries, part 65.
6100. gbrod66.seq - Rodent sequence entries, part 66.
6101. gbrod67.seq - Rodent sequence entries, part 67.
6102. gbrod68.seq - Rodent sequence entries, part 68.
6103. gbrod69.seq - Rodent sequence entries, part 69.
6104. gbrod7.seq - Rodent sequence entries, part 7.
6105. gbrod70.seq - Rodent sequence entries, part 70.
6106. gbrod71.seq - Rodent sequence entries, part 71.
6107. gbrod72.seq - Rodent sequence entries, part 72.
6108. gbrod73.seq - Rodent sequence entries, part 73.
6109. gbrod74.seq - Rodent sequence entries, part 74.
6110. gbrod75.seq - Rodent sequence entries, part 75.
6111. gbrod76.seq - Rodent sequence entries, part 76.
6112. gbrod77.seq - Rodent sequence entries, part 77.
6113. gbrod78.seq - Rodent sequence entries, part 78.
6114. gbrod79.seq - Rodent sequence entries, part 79.
6115. gbrod8.seq - Rodent sequence entries, part 8.
6116. gbrod80.seq - Rodent sequence entries, part 80.
6117. gbrod81.seq - Rodent sequence entries, part 81.
6118. gbrod82.seq - Rodent sequence entries, part 82.
6119. gbrod83.seq - Rodent sequence entries, part 83.
6120. gbrod84.seq - Rodent sequence entries, part 84.
6121. gbrod85.seq - Rodent sequence entries, part 85.
6122. gbrod86.seq - Rodent sequence entries, part 86.
6123. gbrod87.seq - Rodent sequence entries, part 87.
6124. gbrod88.seq - Rodent sequence entries, part 88.
6125. gbrod89.seq - Rodent sequence entries, part 89.
6126. gbrod9.seq - Rodent sequence entries, part 9.
6127. gbrod90.seq - Rodent sequence entries, part 90.
6128. gbrod91.seq - Rodent sequence entries, part 91.
6129. gbrod92.seq - Rodent sequence entries, part 92.
6130. gbrod93.seq - Rodent sequence entries, part 93.
6131. gbrod94.seq - Rodent sequence entries, part 94.
6132. gbrod95.seq - Rodent sequence entries, part 95.
6133. gbrod96.seq - Rodent sequence entries, part 96.
6134. gbrod97.seq - Rodent sequence entries, part 97.
6135. gbrod98.seq - Rodent sequence entries, part 98.
6136. gbrod99.seq - Rodent sequence entries, part 99.
6137. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
6138. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
6139. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
6140. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
6141. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
6142. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
6143. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
6144. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
6145. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
6146. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
6147. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
6148. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
6149. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
6150. gbsyn11.seq - Synthetic and chimeric sequence entries, part 11.
6151. gbsyn12.seq - Synthetic and chimeric sequence entries, part 12.
6152. gbsyn13.seq - Synthetic and chimeric sequence entries, part 13.
6153. gbsyn14.seq - Synthetic and chimeric sequence entries, part 14.
6154. gbsyn15.seq - Synthetic and chimeric sequence entries, part 15.
6155. gbsyn16.seq - Synthetic and chimeric sequence entries, part 16.
6156. gbsyn17.seq - Synthetic and chimeric sequence entries, part 17.
6157. gbsyn18.seq - Synthetic and chimeric sequence entries, part 18.
6158. gbsyn19.seq - Synthetic and chimeric sequence entries, part 19.
6159. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
6160. gbsyn20.seq - Synthetic and chimeric sequence entries, part 20.
6161. gbsyn21.seq - Synthetic and chimeric sequence entries, part 21.
6162. gbsyn22.seq - Synthetic and chimeric sequence entries, part 22.
6163. gbsyn23.seq - Synthetic and chimeric sequence entries, part 23.
6164. gbsyn24.seq - Synthetic and chimeric sequence entries, part 24.
6165. gbsyn25.seq - Synthetic and chimeric sequence entries, part 25.
6166. gbsyn26.seq - Synthetic and chimeric sequence entries, part 26.
6167. gbsyn27.seq - Synthetic and chimeric sequence entries, part 27.
6168. gbsyn28.seq - Synthetic and chimeric sequence entries, part 28.
6169. gbsyn29.seq - Synthetic and chimeric sequence entries, part 29.
6170. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
6171. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
6172. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
6173. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
6174. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
6175. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
6176. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
6177. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
6178. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
6179. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
6180. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
6181. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
6182. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
6183. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
6184. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
6185. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
6186. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
6187. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
6188. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
6189. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
6190. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
6191. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
6192. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
6193. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
6194. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
6195. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
6196. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
6197. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
6198. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
6199. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
6200. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
6201. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
6202. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
6203. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
6204. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
6205. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
6206. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
6207. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
6208. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
6209. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
6210. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
6211. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
6212. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
6213. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
6214. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
6215. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
6216. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
6217. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
6218. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
6219. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
6220. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
6221. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
6222. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
6223. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
6224. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
6225. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
6226. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
6227. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
6228. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
6229. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
6230. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
6231. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
6232. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
6233. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
6234. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
6235. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
6236. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
6237. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
6238. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
6239. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
6240. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
6241. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
6242. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
6243. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
6244. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
6245. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
6246. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
6247. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
6248. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
6249. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
6250. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
6251. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
6252. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
6253. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
6254. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
6255. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
6256. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
6257. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
6258. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
6259. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
6260. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
6261. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
6262. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
6263. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
6264. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
6265. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
6266. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
6267. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
6268. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
6269. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
6270. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
6271. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
6272. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
6273. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
6274. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
6275. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
6276. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
6277. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
6278. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
6279. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
6280. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
6281. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
6282. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
6283. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
6284. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
6285. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
6286. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
6287. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
6288. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
6289. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
6290. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
6291. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
6292. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
6293. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
6294. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
6295. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
6296. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
6297. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
6298. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
6299. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
6300. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
6301. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
6302. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
6303. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
6304. gbuna1.seq - Unannotated sequence entries, part 1.
6305. gbvrl1.seq - Viral sequence entries, part 1.
6306. gbvrl10.seq - Viral sequence entries, part 10.
6307. gbvrl100.seq - Viral sequence entries, part 100.
6308. gbvrl1000.seq - Viral sequence entries, part 1000.
6309. gbvrl1001.seq - Viral sequence entries, part 1001.
6310. gbvrl1002.seq - Viral sequence entries, part 1002.
6311. gbvrl1003.seq - Viral sequence entries, part 1003.
6312. gbvrl1004.seq - Viral sequence entries, part 1004.
6313. gbvrl1005.seq - Viral sequence entries, part 1005.
6314. gbvrl1006.seq - Viral sequence entries, part 1006.
6315. gbvrl1007.seq - Viral sequence entries, part 1007.
6316. gbvrl1008.seq - Viral sequence entries, part 1008.
6317. gbvrl1009.seq - Viral sequence entries, part 1009.
6318. gbvrl101.seq - Viral sequence entries, part 101.
6319. gbvrl1010.seq - Viral sequence entries, part 1010.
6320. gbvrl1011.seq - Viral sequence entries, part 1011.
6321. gbvrl1012.seq - Viral sequence entries, part 1012.
6322. gbvrl1013.seq - Viral sequence entries, part 1013.
6323. gbvrl1014.seq - Viral sequence entries, part 1014.
6324. gbvrl1015.seq - Viral sequence entries, part 1015.
6325. gbvrl1016.seq - Viral sequence entries, part 1016.
6326. gbvrl1017.seq - Viral sequence entries, part 1017.
6327. gbvrl1018.seq - Viral sequence entries, part 1018.
6328. gbvrl1019.seq - Viral sequence entries, part 1019.
6329. gbvrl102.seq - Viral sequence entries, part 102.
6330. gbvrl1020.seq - Viral sequence entries, part 1020.
6331. gbvrl1021.seq - Viral sequence entries, part 1021.
6332. gbvrl1022.seq - Viral sequence entries, part 1022.
6333. gbvrl103.seq - Viral sequence entries, part 103.
6334. gbvrl104.seq - Viral sequence entries, part 104.
6335. gbvrl105.seq - Viral sequence entries, part 105.
6336. gbvrl106.seq - Viral sequence entries, part 106.
6337. gbvrl107.seq - Viral sequence entries, part 107.
6338. gbvrl108.seq - Viral sequence entries, part 108.
6339. gbvrl109.seq - Viral sequence entries, part 109.
6340. gbvrl11.seq - Viral sequence entries, part 11.
6341. gbvrl110.seq - Viral sequence entries, part 110.
6342. gbvrl111.seq - Viral sequence entries, part 111.
6343. gbvrl112.seq - Viral sequence entries, part 112.
6344. gbvrl113.seq - Viral sequence entries, part 113.
6345. gbvrl114.seq - Viral sequence entries, part 114.
6346. gbvrl115.seq - Viral sequence entries, part 115.
6347. gbvrl116.seq - Viral sequence entries, part 116.
6348. gbvrl117.seq - Viral sequence entries, part 117.
6349. gbvrl118.seq - Viral sequence entries, part 118.
6350. gbvrl119.seq - Viral sequence entries, part 119.
6351. gbvrl12.seq - Viral sequence entries, part 12.
6352. gbvrl120.seq - Viral sequence entries, part 120.
6353. gbvrl121.seq - Viral sequence entries, part 121.
6354. gbvrl122.seq - Viral sequence entries, part 122.
6355. gbvrl123.seq - Viral sequence entries, part 123.
6356. gbvrl124.seq - Viral sequence entries, part 124.
6357. gbvrl125.seq - Viral sequence entries, part 125.
6358. gbvrl126.seq - Viral sequence entries, part 126.
6359. gbvrl127.seq - Viral sequence entries, part 127.
6360. gbvrl128.seq - Viral sequence entries, part 128.
6361. gbvrl129.seq - Viral sequence entries, part 129.
6362. gbvrl13.seq - Viral sequence entries, part 13.
6363. gbvrl130.seq - Viral sequence entries, part 130.
6364. gbvrl131.seq - Viral sequence entries, part 131.
6365. gbvrl132.seq - Viral sequence entries, part 132.
6366. gbvrl133.seq - Viral sequence entries, part 133.
6367. gbvrl134.seq - Viral sequence entries, part 134.
6368. gbvrl135.seq - Viral sequence entries, part 135.
6369. gbvrl136.seq - Viral sequence entries, part 136.
6370. gbvrl137.seq - Viral sequence entries, part 137.
6371. gbvrl138.seq - Viral sequence entries, part 138.
6372. gbvrl139.seq - Viral sequence entries, part 139.
6373. gbvrl14.seq - Viral sequence entries, part 14.
6374. gbvrl140.seq - Viral sequence entries, part 140.
6375. gbvrl141.seq - Viral sequence entries, part 141.
6376. gbvrl142.seq - Viral sequence entries, part 142.
6377. gbvrl143.seq - Viral sequence entries, part 143.
6378. gbvrl144.seq - Viral sequence entries, part 144.
6379. gbvrl145.seq - Viral sequence entries, part 145.
6380. gbvrl146.seq - Viral sequence entries, part 146.
6381. gbvrl147.seq - Viral sequence entries, part 147.
6382. gbvrl148.seq - Viral sequence entries, part 148.
6383. gbvrl149.seq - Viral sequence entries, part 149.
6384. gbvrl15.seq - Viral sequence entries, part 15.
6385. gbvrl150.seq - Viral sequence entries, part 150.
6386. gbvrl151.seq - Viral sequence entries, part 151.
6387. gbvrl152.seq - Viral sequence entries, part 152.
6388. gbvrl153.seq - Viral sequence entries, part 153.
6389. gbvrl154.seq - Viral sequence entries, part 154.
6390. gbvrl155.seq - Viral sequence entries, part 155.
6391. gbvrl156.seq - Viral sequence entries, part 156.
6392. gbvrl157.seq - Viral sequence entries, part 157.
6393. gbvrl158.seq - Viral sequence entries, part 158.
6394. gbvrl159.seq - Viral sequence entries, part 159.
6395. gbvrl16.seq - Viral sequence entries, part 16.
6396. gbvrl160.seq - Viral sequence entries, part 160.
6397. gbvrl161.seq - Viral sequence entries, part 161.
6398. gbvrl162.seq - Viral sequence entries, part 162.
6399. gbvrl163.seq - Viral sequence entries, part 163.
6400. gbvrl164.seq - Viral sequence entries, part 164.
6401. gbvrl165.seq - Viral sequence entries, part 165.
6402. gbvrl166.seq - Viral sequence entries, part 166.
6403. gbvrl167.seq - Viral sequence entries, part 167.
6404. gbvrl168.seq - Viral sequence entries, part 168.
6405. gbvrl169.seq - Viral sequence entries, part 169.
6406. gbvrl17.seq - Viral sequence entries, part 17.
6407. gbvrl170.seq - Viral sequence entries, part 170.
6408. gbvrl171.seq - Viral sequence entries, part 171.
6409. gbvrl172.seq - Viral sequence entries, part 172.
6410. gbvrl173.seq - Viral sequence entries, part 173.
6411. gbvrl174.seq - Viral sequence entries, part 174.
6412. gbvrl175.seq - Viral sequence entries, part 175.
6413. gbvrl176.seq - Viral sequence entries, part 176.
6414. gbvrl177.seq - Viral sequence entries, part 177.
6415. gbvrl178.seq - Viral sequence entries, part 178.
6416. gbvrl179.seq - Viral sequence entries, part 179.
6417. gbvrl18.seq - Viral sequence entries, part 18.
6418. gbvrl180.seq - Viral sequence entries, part 180.
6419. gbvrl181.seq - Viral sequence entries, part 181.
6420. gbvrl182.seq - Viral sequence entries, part 182.
6421. gbvrl183.seq - Viral sequence entries, part 183.
6422. gbvrl184.seq - Viral sequence entries, part 184.
6423. gbvrl185.seq - Viral sequence entries, part 185.
6424. gbvrl186.seq - Viral sequence entries, part 186.
6425. gbvrl187.seq - Viral sequence entries, part 187.
6426. gbvrl188.seq - Viral sequence entries, part 188.
6427. gbvrl189.seq - Viral sequence entries, part 189.
6428. gbvrl19.seq - Viral sequence entries, part 19.
6429. gbvrl190.seq - Viral sequence entries, part 190.
6430. gbvrl191.seq - Viral sequence entries, part 191.
6431. gbvrl192.seq - Viral sequence entries, part 192.
6432. gbvrl193.seq - Viral sequence entries, part 193.
6433. gbvrl194.seq - Viral sequence entries, part 194.
6434. gbvrl195.seq - Viral sequence entries, part 195.
6435. gbvrl196.seq - Viral sequence entries, part 196.
6436. gbvrl197.seq - Viral sequence entries, part 197.
6437. gbvrl198.seq - Viral sequence entries, part 198.
6438. gbvrl199.seq - Viral sequence entries, part 199.
6439. gbvrl2.seq - Viral sequence entries, part 2.
6440. gbvrl20.seq - Viral sequence entries, part 20.
6441. gbvrl200.seq - Viral sequence entries, part 200.
6442. gbvrl201.seq - Viral sequence entries, part 201.
6443. gbvrl202.seq - Viral sequence entries, part 202.
6444. gbvrl203.seq - Viral sequence entries, part 203.
6445. gbvrl204.seq - Viral sequence entries, part 204.
6446. gbvrl205.seq - Viral sequence entries, part 205.
6447. gbvrl206.seq - Viral sequence entries, part 206.
6448. gbvrl207.seq - Viral sequence entries, part 207.
6449. gbvrl208.seq - Viral sequence entries, part 208.
6450. gbvrl209.seq - Viral sequence entries, part 209.
6451. gbvrl21.seq - Viral sequence entries, part 21.
6452. gbvrl210.seq - Viral sequence entries, part 210.
6453. gbvrl211.seq - Viral sequence entries, part 211.
6454. gbvrl212.seq - Viral sequence entries, part 212.
6455. gbvrl213.seq - Viral sequence entries, part 213.
6456. gbvrl214.seq - Viral sequence entries, part 214.
6457. gbvrl215.seq - Viral sequence entries, part 215.
6458. gbvrl216.seq - Viral sequence entries, part 216.
6459. gbvrl217.seq - Viral sequence entries, part 217.
6460. gbvrl218.seq - Viral sequence entries, part 218.
6461. gbvrl219.seq - Viral sequence entries, part 219.
6462. gbvrl22.seq - Viral sequence entries, part 22.
6463. gbvrl220.seq - Viral sequence entries, part 220.
6464. gbvrl221.seq - Viral sequence entries, part 221.
6465. gbvrl222.seq - Viral sequence entries, part 222.
6466. gbvrl223.seq - Viral sequence entries, part 223.
6467. gbvrl224.seq - Viral sequence entries, part 224.
6468. gbvrl225.seq - Viral sequence entries, part 225.
6469. gbvrl226.seq - Viral sequence entries, part 226.
6470. gbvrl227.seq - Viral sequence entries, part 227.
6471. gbvrl228.seq - Viral sequence entries, part 228.
6472. gbvrl229.seq - Viral sequence entries, part 229.
6473. gbvrl23.seq - Viral sequence entries, part 23.
6474. gbvrl230.seq - Viral sequence entries, part 230.
6475. gbvrl231.seq - Viral sequence entries, part 231.
6476. gbvrl232.seq - Viral sequence entries, part 232.
6477. gbvrl233.seq - Viral sequence entries, part 233.
6478. gbvrl234.seq - Viral sequence entries, part 234.
6479. gbvrl235.seq - Viral sequence entries, part 235.
6480. gbvrl236.seq - Viral sequence entries, part 236.
6481. gbvrl237.seq - Viral sequence entries, part 237.
6482. gbvrl238.seq - Viral sequence entries, part 238.
6483. gbvrl239.seq - Viral sequence entries, part 239.
6484. gbvrl24.seq - Viral sequence entries, part 24.
6485. gbvrl240.seq - Viral sequence entries, part 240.
6486. gbvrl241.seq - Viral sequence entries, part 241.
6487. gbvrl242.seq - Viral sequence entries, part 242.
6488. gbvrl243.seq - Viral sequence entries, part 243.
6489. gbvrl244.seq - Viral sequence entries, part 244.
6490. gbvrl245.seq - Viral sequence entries, part 245.
6491. gbvrl246.seq - Viral sequence entries, part 246.
6492. gbvrl247.seq - Viral sequence entries, part 247.
6493. gbvrl248.seq - Viral sequence entries, part 248.
6494. gbvrl249.seq - Viral sequence entries, part 249.
6495. gbvrl25.seq - Viral sequence entries, part 25.
6496. gbvrl250.seq - Viral sequence entries, part 250.
6497. gbvrl251.seq - Viral sequence entries, part 251.
6498. gbvrl252.seq - Viral sequence entries, part 252.
6499. gbvrl253.seq - Viral sequence entries, part 253.
6500. gbvrl254.seq - Viral sequence entries, part 254.
6501. gbvrl255.seq - Viral sequence entries, part 255.
6502. gbvrl256.seq - Viral sequence entries, part 256.
6503. gbvrl257.seq - Viral sequence entries, part 257.
6504. gbvrl258.seq - Viral sequence entries, part 258.
6505. gbvrl259.seq - Viral sequence entries, part 259.
6506. gbvrl26.seq - Viral sequence entries, part 26.
6507. gbvrl260.seq - Viral sequence entries, part 260.
6508. gbvrl261.seq - Viral sequence entries, part 261.
6509. gbvrl262.seq - Viral sequence entries, part 262.
6510. gbvrl263.seq - Viral sequence entries, part 263.
6511. gbvrl264.seq - Viral sequence entries, part 264.
6512. gbvrl265.seq - Viral sequence entries, part 265.
6513. gbvrl266.seq - Viral sequence entries, part 266.
6514. gbvrl267.seq - Viral sequence entries, part 267.
6515. gbvrl268.seq - Viral sequence entries, part 268.
6516. gbvrl269.seq - Viral sequence entries, part 269.
6517. gbvrl27.seq - Viral sequence entries, part 27.
6518. gbvrl270.seq - Viral sequence entries, part 270.
6519. gbvrl271.seq - Viral sequence entries, part 271.
6520. gbvrl272.seq - Viral sequence entries, part 272.
6521. gbvrl273.seq - Viral sequence entries, part 273.
6522. gbvrl274.seq - Viral sequence entries, part 274.
6523. gbvrl275.seq - Viral sequence entries, part 275.
6524. gbvrl276.seq - Viral sequence entries, part 276.
6525. gbvrl277.seq - Viral sequence entries, part 277.
6526. gbvrl278.seq - Viral sequence entries, part 278.
6527. gbvrl279.seq - Viral sequence entries, part 279.
6528. gbvrl28.seq - Viral sequence entries, part 28.
6529. gbvrl280.seq - Viral sequence entries, part 280.
6530. gbvrl281.seq - Viral sequence entries, part 281.
6531. gbvrl282.seq - Viral sequence entries, part 282.
6532. gbvrl283.seq - Viral sequence entries, part 283.
6533. gbvrl284.seq - Viral sequence entries, part 284.
6534. gbvrl285.seq - Viral sequence entries, part 285.
6535. gbvrl286.seq - Viral sequence entries, part 286.
6536. gbvrl287.seq - Viral sequence entries, part 287.
6537. gbvrl288.seq - Viral sequence entries, part 288.
6538. gbvrl289.seq - Viral sequence entries, part 289.
6539. gbvrl29.seq - Viral sequence entries, part 29.
6540. gbvrl290.seq - Viral sequence entries, part 290.
6541. gbvrl291.seq - Viral sequence entries, part 291.
6542. gbvrl292.seq - Viral sequence entries, part 292.
6543. gbvrl293.seq - Viral sequence entries, part 293.
6544. gbvrl294.seq - Viral sequence entries, part 294.
6545. gbvrl295.seq - Viral sequence entries, part 295.
6546. gbvrl296.seq - Viral sequence entries, part 296.
6547. gbvrl297.seq - Viral sequence entries, part 297.
6548. gbvrl298.seq - Viral sequence entries, part 298.
6549. gbvrl299.seq - Viral sequence entries, part 299.
6550. gbvrl3.seq - Viral sequence entries, part 3.
6551. gbvrl30.seq - Viral sequence entries, part 30.
6552. gbvrl300.seq - Viral sequence entries, part 300.
6553. gbvrl301.seq - Viral sequence entries, part 301.
6554. gbvrl302.seq - Viral sequence entries, part 302.
6555. gbvrl303.seq - Viral sequence entries, part 303.
6556. gbvrl304.seq - Viral sequence entries, part 304.
6557. gbvrl305.seq - Viral sequence entries, part 305.
6558. gbvrl306.seq - Viral sequence entries, part 306.
6559. gbvrl307.seq - Viral sequence entries, part 307.
6560. gbvrl308.seq - Viral sequence entries, part 308.
6561. gbvrl309.seq - Viral sequence entries, part 309.
6562. gbvrl31.seq - Viral sequence entries, part 31.
6563. gbvrl310.seq - Viral sequence entries, part 310.
6564. gbvrl311.seq - Viral sequence entries, part 311.
6565. gbvrl312.seq - Viral sequence entries, part 312.
6566. gbvrl313.seq - Viral sequence entries, part 313.
6567. gbvrl314.seq - Viral sequence entries, part 314.
6568. gbvrl315.seq - Viral sequence entries, part 315.
6569. gbvrl316.seq - Viral sequence entries, part 316.
6570. gbvrl317.seq - Viral sequence entries, part 317.
6571. gbvrl318.seq - Viral sequence entries, part 318.
6572. gbvrl319.seq - Viral sequence entries, part 319.
6573. gbvrl32.seq - Viral sequence entries, part 32.
6574. gbvrl320.seq - Viral sequence entries, part 320.
6575. gbvrl321.seq - Viral sequence entries, part 321.
6576. gbvrl322.seq - Viral sequence entries, part 322.
6577. gbvrl323.seq - Viral sequence entries, part 323.
6578. gbvrl324.seq - Viral sequence entries, part 324.
6579. gbvrl325.seq - Viral sequence entries, part 325.
6580. gbvrl326.seq - Viral sequence entries, part 326.
6581. gbvrl327.seq - Viral sequence entries, part 327.
6582. gbvrl328.seq - Viral sequence entries, part 328.
6583. gbvrl329.seq - Viral sequence entries, part 329.
6584. gbvrl33.seq - Viral sequence entries, part 33.
6585. gbvrl330.seq - Viral sequence entries, part 330.
6586. gbvrl331.seq - Viral sequence entries, part 331.
6587. gbvrl332.seq - Viral sequence entries, part 332.
6588. gbvrl333.seq - Viral sequence entries, part 333.
6589. gbvrl334.seq - Viral sequence entries, part 334.
6590. gbvrl335.seq - Viral sequence entries, part 335.
6591. gbvrl336.seq - Viral sequence entries, part 336.
6592. gbvrl337.seq - Viral sequence entries, part 337.
6593. gbvrl338.seq - Viral sequence entries, part 338.
6594. gbvrl339.seq - Viral sequence entries, part 339.
6595. gbvrl34.seq - Viral sequence entries, part 34.
6596. gbvrl340.seq - Viral sequence entries, part 340.
6597. gbvrl341.seq - Viral sequence entries, part 341.
6598. gbvrl342.seq - Viral sequence entries, part 342.
6599. gbvrl343.seq - Viral sequence entries, part 343.
6600. gbvrl344.seq - Viral sequence entries, part 344.
6601. gbvrl345.seq - Viral sequence entries, part 345.
6602. gbvrl346.seq - Viral sequence entries, part 346.
6603. gbvrl347.seq - Viral sequence entries, part 347.
6604. gbvrl348.seq - Viral sequence entries, part 348.
6605. gbvrl349.seq - Viral sequence entries, part 349.
6606. gbvrl35.seq - Viral sequence entries, part 35.
6607. gbvrl350.seq - Viral sequence entries, part 350.
6608. gbvrl351.seq - Viral sequence entries, part 351.
6609. gbvrl352.seq - Viral sequence entries, part 352.
6610. gbvrl353.seq - Viral sequence entries, part 353.
6611. gbvrl354.seq - Viral sequence entries, part 354.
6612. gbvrl355.seq - Viral sequence entries, part 355.
6613. gbvrl356.seq - Viral sequence entries, part 356.
6614. gbvrl357.seq - Viral sequence entries, part 357.
6615. gbvrl358.seq - Viral sequence entries, part 358.
6616. gbvrl359.seq - Viral sequence entries, part 359.
6617. gbvrl36.seq - Viral sequence entries, part 36.
6618. gbvrl360.seq - Viral sequence entries, part 360.
6619. gbvrl361.seq - Viral sequence entries, part 361.
6620. gbvrl362.seq - Viral sequence entries, part 362.
6621. gbvrl363.seq - Viral sequence entries, part 363.
6622. gbvrl364.seq - Viral sequence entries, part 364.
6623. gbvrl365.seq - Viral sequence entries, part 365.
6624. gbvrl366.seq - Viral sequence entries, part 366.
6625. gbvrl367.seq - Viral sequence entries, part 367.
6626. gbvrl368.seq - Viral sequence entries, part 368.
6627. gbvrl369.seq - Viral sequence entries, part 369.
6628. gbvrl37.seq - Viral sequence entries, part 37.
6629. gbvrl370.seq - Viral sequence entries, part 370.
6630. gbvrl371.seq - Viral sequence entries, part 371.
6631. gbvrl372.seq - Viral sequence entries, part 372.
6632. gbvrl373.seq - Viral sequence entries, part 373.
6633. gbvrl374.seq - Viral sequence entries, part 374.
6634. gbvrl375.seq - Viral sequence entries, part 375.
6635. gbvrl376.seq - Viral sequence entries, part 376.
6636. gbvrl377.seq - Viral sequence entries, part 377.
6637. gbvrl378.seq - Viral sequence entries, part 378.
6638. gbvrl379.seq - Viral sequence entries, part 379.
6639. gbvrl38.seq - Viral sequence entries, part 38.
6640. gbvrl380.seq - Viral sequence entries, part 380.
6641. gbvrl381.seq - Viral sequence entries, part 381.
6642. gbvrl382.seq - Viral sequence entries, part 382.
6643. gbvrl383.seq - Viral sequence entries, part 383.
6644. gbvrl384.seq - Viral sequence entries, part 384.
6645. gbvrl385.seq - Viral sequence entries, part 385.
6646. gbvrl386.seq - Viral sequence entries, part 386.
6647. gbvrl387.seq - Viral sequence entries, part 387.
6648. gbvrl388.seq - Viral sequence entries, part 388.
6649. gbvrl389.seq - Viral sequence entries, part 389.
6650. gbvrl39.seq - Viral sequence entries, part 39.
6651. gbvrl390.seq - Viral sequence entries, part 390.
6652. gbvrl391.seq - Viral sequence entries, part 391.
6653. gbvrl392.seq - Viral sequence entries, part 392.
6654. gbvrl393.seq - Viral sequence entries, part 393.
6655. gbvrl394.seq - Viral sequence entries, part 394.
6656. gbvrl395.seq - Viral sequence entries, part 395.
6657. gbvrl396.seq - Viral sequence entries, part 396.
6658. gbvrl397.seq - Viral sequence entries, part 397.
6659. gbvrl398.seq - Viral sequence entries, part 398.
6660. gbvrl399.seq - Viral sequence entries, part 399.
6661. gbvrl4.seq - Viral sequence entries, part 4.
6662. gbvrl40.seq - Viral sequence entries, part 40.
6663. gbvrl400.seq - Viral sequence entries, part 400.
6664. gbvrl401.seq - Viral sequence entries, part 401.
6665. gbvrl402.seq - Viral sequence entries, part 402.
6666. gbvrl403.seq - Viral sequence entries, part 403.
6667. gbvrl404.seq - Viral sequence entries, part 404.
6668. gbvrl405.seq - Viral sequence entries, part 405.
6669. gbvrl406.seq - Viral sequence entries, part 406.
6670. gbvrl407.seq - Viral sequence entries, part 407.
6671. gbvrl408.seq - Viral sequence entries, part 408.
6672. gbvrl409.seq - Viral sequence entries, part 409.
6673. gbvrl41.seq - Viral sequence entries, part 41.
6674. gbvrl410.seq - Viral sequence entries, part 410.
6675. gbvrl411.seq - Viral sequence entries, part 411.
6676. gbvrl412.seq - Viral sequence entries, part 412.
6677. gbvrl413.seq - Viral sequence entries, part 413.
6678. gbvrl414.seq - Viral sequence entries, part 414.
6679. gbvrl415.seq - Viral sequence entries, part 415.
6680. gbvrl416.seq - Viral sequence entries, part 416.
6681. gbvrl417.seq - Viral sequence entries, part 417.
6682. gbvrl418.seq - Viral sequence entries, part 418.
6683. gbvrl419.seq - Viral sequence entries, part 419.
6684. gbvrl42.seq - Viral sequence entries, part 42.
6685. gbvrl420.seq - Viral sequence entries, part 420.
6686. gbvrl421.seq - Viral sequence entries, part 421.
6687. gbvrl422.seq - Viral sequence entries, part 422.
6688. gbvrl423.seq - Viral sequence entries, part 423.
6689. gbvrl424.seq - Viral sequence entries, part 424.
6690. gbvrl425.seq - Viral sequence entries, part 425.
6691. gbvrl426.seq - Viral sequence entries, part 426.
6692. gbvrl427.seq - Viral sequence entries, part 427.
6693. gbvrl428.seq - Viral sequence entries, part 428.
6694. gbvrl429.seq - Viral sequence entries, part 429.
6695. gbvrl43.seq - Viral sequence entries, part 43.
6696. gbvrl430.seq - Viral sequence entries, part 430.
6697. gbvrl431.seq - Viral sequence entries, part 431.
6698. gbvrl432.seq - Viral sequence entries, part 432.
6699. gbvrl433.seq - Viral sequence entries, part 433.
6700. gbvrl434.seq - Viral sequence entries, part 434.
6701. gbvrl435.seq - Viral sequence entries, part 435.
6702. gbvrl436.seq - Viral sequence entries, part 436.
6703. gbvrl437.seq - Viral sequence entries, part 437.
6704. gbvrl438.seq - Viral sequence entries, part 438.
6705. gbvrl439.seq - Viral sequence entries, part 439.
6706. gbvrl44.seq - Viral sequence entries, part 44.
6707. gbvrl440.seq - Viral sequence entries, part 440.
6708. gbvrl441.seq - Viral sequence entries, part 441.
6709. gbvrl442.seq - Viral sequence entries, part 442.
6710. gbvrl443.seq - Viral sequence entries, part 443.
6711. gbvrl444.seq - Viral sequence entries, part 444.
6712. gbvrl445.seq - Viral sequence entries, part 445.
6713. gbvrl446.seq - Viral sequence entries, part 446.
6714. gbvrl447.seq - Viral sequence entries, part 447.
6715. gbvrl448.seq - Viral sequence entries, part 448.
6716. gbvrl449.seq - Viral sequence entries, part 449.
6717. gbvrl45.seq - Viral sequence entries, part 45.
6718. gbvrl450.seq - Viral sequence entries, part 450.
6719. gbvrl451.seq - Viral sequence entries, part 451.
6720. gbvrl452.seq - Viral sequence entries, part 452.
6721. gbvrl453.seq - Viral sequence entries, part 453.
6722. gbvrl454.seq - Viral sequence entries, part 454.
6723. gbvrl455.seq - Viral sequence entries, part 455.
6724. gbvrl456.seq - Viral sequence entries, part 456.
6725. gbvrl457.seq - Viral sequence entries, part 457.
6726. gbvrl458.seq - Viral sequence entries, part 458.
6727. gbvrl459.seq - Viral sequence entries, part 459.
6728. gbvrl46.seq - Viral sequence entries, part 46.
6729. gbvrl460.seq - Viral sequence entries, part 460.
6730. gbvrl461.seq - Viral sequence entries, part 461.
6731. gbvrl462.seq - Viral sequence entries, part 462.
6732. gbvrl463.seq - Viral sequence entries, part 463.
6733. gbvrl464.seq - Viral sequence entries, part 464.
6734. gbvrl465.seq - Viral sequence entries, part 465.
6735. gbvrl466.seq - Viral sequence entries, part 466.
6736. gbvrl467.seq - Viral sequence entries, part 467.
6737. gbvrl468.seq - Viral sequence entries, part 468.
6738. gbvrl469.seq - Viral sequence entries, part 469.
6739. gbvrl47.seq - Viral sequence entries, part 47.
6740. gbvrl470.seq - Viral sequence entries, part 470.
6741. gbvrl471.seq - Viral sequence entries, part 471.
6742. gbvrl472.seq - Viral sequence entries, part 472.
6743. gbvrl473.seq - Viral sequence entries, part 473.
6744. gbvrl474.seq - Viral sequence entries, part 474.
6745. gbvrl475.seq - Viral sequence entries, part 475.
6746. gbvrl476.seq - Viral sequence entries, part 476.
6747. gbvrl477.seq - Viral sequence entries, part 477.
6748. gbvrl478.seq - Viral sequence entries, part 478.
6749. gbvrl479.seq - Viral sequence entries, part 479.
6750. gbvrl48.seq - Viral sequence entries, part 48.
6751. gbvrl480.seq - Viral sequence entries, part 480.
6752. gbvrl481.seq - Viral sequence entries, part 481.
6753. gbvrl482.seq - Viral sequence entries, part 482.
6754. gbvrl483.seq - Viral sequence entries, part 483.
6755. gbvrl484.seq - Viral sequence entries, part 484.
6756. gbvrl485.seq - Viral sequence entries, part 485.
6757. gbvrl486.seq - Viral sequence entries, part 486.
6758. gbvrl487.seq - Viral sequence entries, part 487.
6759. gbvrl488.seq - Viral sequence entries, part 488.
6760. gbvrl489.seq - Viral sequence entries, part 489.
6761. gbvrl49.seq - Viral sequence entries, part 49.
6762. gbvrl490.seq - Viral sequence entries, part 490.
6763. gbvrl491.seq - Viral sequence entries, part 491.
6764. gbvrl492.seq - Viral sequence entries, part 492.
6765. gbvrl493.seq - Viral sequence entries, part 493.
6766. gbvrl494.seq - Viral sequence entries, part 494.
6767. gbvrl495.seq - Viral sequence entries, part 495.
6768. gbvrl496.seq - Viral sequence entries, part 496.
6769. gbvrl497.seq - Viral sequence entries, part 497.
6770. gbvrl498.seq - Viral sequence entries, part 498.
6771. gbvrl499.seq - Viral sequence entries, part 499.
6772. gbvrl5.seq - Viral sequence entries, part 5.
6773. gbvrl50.seq - Viral sequence entries, part 50.
6774. gbvrl500.seq - Viral sequence entries, part 500.
6775. gbvrl501.seq - Viral sequence entries, part 501.
6776. gbvrl502.seq - Viral sequence entries, part 502.
6777. gbvrl503.seq - Viral sequence entries, part 503.
6778. gbvrl504.seq - Viral sequence entries, part 504.
6779. gbvrl505.seq - Viral sequence entries, part 505.
6780. gbvrl506.seq - Viral sequence entries, part 506.
6781. gbvrl507.seq - Viral sequence entries, part 507.
6782. gbvrl508.seq - Viral sequence entries, part 508.
6783. gbvrl509.seq - Viral sequence entries, part 509.
6784. gbvrl51.seq - Viral sequence entries, part 51.
6785. gbvrl510.seq - Viral sequence entries, part 510.
6786. gbvrl511.seq - Viral sequence entries, part 511.
6787. gbvrl512.seq - Viral sequence entries, part 512.
6788. gbvrl513.seq - Viral sequence entries, part 513.
6789. gbvrl514.seq - Viral sequence entries, part 514.
6790. gbvrl515.seq - Viral sequence entries, part 515.
6791. gbvrl516.seq - Viral sequence entries, part 516.
6792. gbvrl517.seq - Viral sequence entries, part 517.
6793. gbvrl518.seq - Viral sequence entries, part 518.
6794. gbvrl519.seq - Viral sequence entries, part 519.
6795. gbvrl52.seq - Viral sequence entries, part 52.
6796. gbvrl520.seq - Viral sequence entries, part 520.
6797. gbvrl521.seq - Viral sequence entries, part 521.
6798. gbvrl522.seq - Viral sequence entries, part 522.
6799. gbvrl523.seq - Viral sequence entries, part 523.
6800. gbvrl524.seq - Viral sequence entries, part 524.
6801. gbvrl525.seq - Viral sequence entries, part 525.
6802. gbvrl526.seq - Viral sequence entries, part 526.
6803. gbvrl527.seq - Viral sequence entries, part 527.
6804. gbvrl528.seq - Viral sequence entries, part 528.
6805. gbvrl529.seq - Viral sequence entries, part 529.
6806. gbvrl53.seq - Viral sequence entries, part 53.
6807. gbvrl530.seq - Viral sequence entries, part 530.
6808. gbvrl531.seq - Viral sequence entries, part 531.
6809. gbvrl532.seq - Viral sequence entries, part 532.
6810. gbvrl533.seq - Viral sequence entries, part 533.
6811. gbvrl534.seq - Viral sequence entries, part 534.
6812. gbvrl535.seq - Viral sequence entries, part 535.
6813. gbvrl536.seq - Viral sequence entries, part 536.
6814. gbvrl537.seq - Viral sequence entries, part 537.
6815. gbvrl538.seq - Viral sequence entries, part 538.
6816. gbvrl539.seq - Viral sequence entries, part 539.
6817. gbvrl54.seq - Viral sequence entries, part 54.
6818. gbvrl540.seq - Viral sequence entries, part 540.
6819. gbvrl541.seq - Viral sequence entries, part 541.
6820. gbvrl542.seq - Viral sequence entries, part 542.
6821. gbvrl543.seq - Viral sequence entries, part 543.
6822. gbvrl544.seq - Viral sequence entries, part 544.
6823. gbvrl545.seq - Viral sequence entries, part 545.
6824. gbvrl546.seq - Viral sequence entries, part 546.
6825. gbvrl547.seq - Viral sequence entries, part 547.
6826. gbvrl548.seq - Viral sequence entries, part 548.
6827. gbvrl549.seq - Viral sequence entries, part 549.
6828. gbvrl55.seq - Viral sequence entries, part 55.
6829. gbvrl550.seq - Viral sequence entries, part 550.
6830. gbvrl551.seq - Viral sequence entries, part 551.
6831. gbvrl552.seq - Viral sequence entries, part 552.
6832. gbvrl553.seq - Viral sequence entries, part 553.
6833. gbvrl554.seq - Viral sequence entries, part 554.
6834. gbvrl555.seq - Viral sequence entries, part 555.
6835. gbvrl556.seq - Viral sequence entries, part 556.
6836. gbvrl557.seq - Viral sequence entries, part 557.
6837. gbvrl558.seq - Viral sequence entries, part 558.
6838. gbvrl559.seq - Viral sequence entries, part 559.
6839. gbvrl56.seq - Viral sequence entries, part 56.
6840. gbvrl560.seq - Viral sequence entries, part 560.
6841. gbvrl561.seq - Viral sequence entries, part 561.
6842. gbvrl562.seq - Viral sequence entries, part 562.
6843. gbvrl563.seq - Viral sequence entries, part 563.
6844. gbvrl564.seq - Viral sequence entries, part 564.
6845. gbvrl565.seq - Viral sequence entries, part 565.
6846. gbvrl566.seq - Viral sequence entries, part 566.
6847. gbvrl567.seq - Viral sequence entries, part 567.
6848. gbvrl568.seq - Viral sequence entries, part 568.
6849. gbvrl569.seq - Viral sequence entries, part 569.
6850. gbvrl57.seq - Viral sequence entries, part 57.
6851. gbvrl570.seq - Viral sequence entries, part 570.
6852. gbvrl571.seq - Viral sequence entries, part 571.
6853. gbvrl572.seq - Viral sequence entries, part 572.
6854. gbvrl573.seq - Viral sequence entries, part 573.
6855. gbvrl574.seq - Viral sequence entries, part 574.
6856. gbvrl575.seq - Viral sequence entries, part 575.
6857. gbvrl576.seq - Viral sequence entries, part 576.
6858. gbvrl577.seq - Viral sequence entries, part 577.
6859. gbvrl578.seq - Viral sequence entries, part 578.
6860. gbvrl579.seq - Viral sequence entries, part 579.
6861. gbvrl58.seq - Viral sequence entries, part 58.
6862. gbvrl580.seq - Viral sequence entries, part 580.
6863. gbvrl581.seq - Viral sequence entries, part 581.
6864. gbvrl582.seq - Viral sequence entries, part 582.
6865. gbvrl583.seq - Viral sequence entries, part 583.
6866. gbvrl584.seq - Viral sequence entries, part 584.
6867. gbvrl585.seq - Viral sequence entries, part 585.
6868. gbvrl586.seq - Viral sequence entries, part 586.
6869. gbvrl587.seq - Viral sequence entries, part 587.
6870. gbvrl588.seq - Viral sequence entries, part 588.
6871. gbvrl589.seq - Viral sequence entries, part 589.
6872. gbvrl59.seq - Viral sequence entries, part 59.
6873. gbvrl590.seq - Viral sequence entries, part 590.
6874. gbvrl591.seq - Viral sequence entries, part 591.
6875. gbvrl592.seq - Viral sequence entries, part 592.
6876. gbvrl593.seq - Viral sequence entries, part 593.
6877. gbvrl594.seq - Viral sequence entries, part 594.
6878. gbvrl595.seq - Viral sequence entries, part 595.
6879. gbvrl596.seq - Viral sequence entries, part 596.
6880. gbvrl597.seq - Viral sequence entries, part 597.
6881. gbvrl598.seq - Viral sequence entries, part 598.
6882. gbvrl599.seq - Viral sequence entries, part 599.
6883. gbvrl6.seq - Viral sequence entries, part 6.
6884. gbvrl60.seq - Viral sequence entries, part 60.
6885. gbvrl600.seq - Viral sequence entries, part 600.
6886. gbvrl601.seq - Viral sequence entries, part 601.
6887. gbvrl602.seq - Viral sequence entries, part 602.
6888. gbvrl603.seq - Viral sequence entries, part 603.
6889. gbvrl604.seq - Viral sequence entries, part 604.
6890. gbvrl605.seq - Viral sequence entries, part 605.
6891. gbvrl606.seq - Viral sequence entries, part 606.
6892. gbvrl607.seq - Viral sequence entries, part 607.
6893. gbvrl608.seq - Viral sequence entries, part 608.
6894. gbvrl609.seq - Viral sequence entries, part 609.
6895. gbvrl61.seq - Viral sequence entries, part 61.
6896. gbvrl610.seq - Viral sequence entries, part 610.
6897. gbvrl611.seq - Viral sequence entries, part 611.
6898. gbvrl612.seq - Viral sequence entries, part 612.
6899. gbvrl613.seq - Viral sequence entries, part 613.
6900. gbvrl614.seq - Viral sequence entries, part 614.
6901. gbvrl615.seq - Viral sequence entries, part 615.
6902. gbvrl616.seq - Viral sequence entries, part 616.
6903. gbvrl617.seq - Viral sequence entries, part 617.
6904. gbvrl618.seq - Viral sequence entries, part 618.
6905. gbvrl619.seq - Viral sequence entries, part 619.
6906. gbvrl62.seq - Viral sequence entries, part 62.
6907. gbvrl620.seq - Viral sequence entries, part 620.
6908. gbvrl621.seq - Viral sequence entries, part 621.
6909. gbvrl622.seq - Viral sequence entries, part 622.
6910. gbvrl623.seq - Viral sequence entries, part 623.
6911. gbvrl624.seq - Viral sequence entries, part 624.
6912. gbvrl625.seq - Viral sequence entries, part 625.
6913. gbvrl626.seq - Viral sequence entries, part 626.
6914. gbvrl627.seq - Viral sequence entries, part 627.
6915. gbvrl628.seq - Viral sequence entries, part 628.
6916. gbvrl629.seq - Viral sequence entries, part 629.
6917. gbvrl63.seq - Viral sequence entries, part 63.
6918. gbvrl630.seq - Viral sequence entries, part 630.
6919. gbvrl631.seq - Viral sequence entries, part 631.
6920. gbvrl632.seq - Viral sequence entries, part 632.
6921. gbvrl633.seq - Viral sequence entries, part 633.
6922. gbvrl634.seq - Viral sequence entries, part 634.
6923. gbvrl635.seq - Viral sequence entries, part 635.
6924. gbvrl636.seq - Viral sequence entries, part 636.
6925. gbvrl637.seq - Viral sequence entries, part 637.
6926. gbvrl638.seq - Viral sequence entries, part 638.
6927. gbvrl639.seq - Viral sequence entries, part 639.
6928. gbvrl64.seq - Viral sequence entries, part 64.
6929. gbvrl640.seq - Viral sequence entries, part 640.
6930. gbvrl641.seq - Viral sequence entries, part 641.
6931. gbvrl642.seq - Viral sequence entries, part 642.
6932. gbvrl643.seq - Viral sequence entries, part 643.
6933. gbvrl644.seq - Viral sequence entries, part 644.
6934. gbvrl645.seq - Viral sequence entries, part 645.
6935. gbvrl646.seq - Viral sequence entries, part 646.
6936. gbvrl647.seq - Viral sequence entries, part 647.
6937. gbvrl648.seq - Viral sequence entries, part 648.
6938. gbvrl649.seq - Viral sequence entries, part 649.
6939. gbvrl65.seq - Viral sequence entries, part 65.
6940. gbvrl650.seq - Viral sequence entries, part 650.
6941. gbvrl651.seq - Viral sequence entries, part 651.
6942. gbvrl652.seq - Viral sequence entries, part 652.
6943. gbvrl653.seq - Viral sequence entries, part 653.
6944. gbvrl654.seq - Viral sequence entries, part 654.
6945. gbvrl655.seq - Viral sequence entries, part 655.
6946. gbvrl656.seq - Viral sequence entries, part 656.
6947. gbvrl657.seq - Viral sequence entries, part 657.
6948. gbvrl658.seq - Viral sequence entries, part 658.
6949. gbvrl659.seq - Viral sequence entries, part 659.
6950. gbvrl66.seq - Viral sequence entries, part 66.
6951. gbvrl660.seq - Viral sequence entries, part 660.
6952. gbvrl661.seq - Viral sequence entries, part 661.
6953. gbvrl662.seq - Viral sequence entries, part 662.
6954. gbvrl663.seq - Viral sequence entries, part 663.
6955. gbvrl664.seq - Viral sequence entries, part 664.
6956. gbvrl665.seq - Viral sequence entries, part 665.
6957. gbvrl666.seq - Viral sequence entries, part 666.
6958. gbvrl667.seq - Viral sequence entries, part 667.
6959. gbvrl668.seq - Viral sequence entries, part 668.
6960. gbvrl669.seq - Viral sequence entries, part 669.
6961. gbvrl67.seq - Viral sequence entries, part 67.
6962. gbvrl670.seq - Viral sequence entries, part 670.
6963. gbvrl671.seq - Viral sequence entries, part 671.
6964. gbvrl672.seq - Viral sequence entries, part 672.
6965. gbvrl673.seq - Viral sequence entries, part 673.
6966. gbvrl674.seq - Viral sequence entries, part 674.
6967. gbvrl675.seq - Viral sequence entries, part 675.
6968. gbvrl676.seq - Viral sequence entries, part 676.
6969. gbvrl677.seq - Viral sequence entries, part 677.
6970. gbvrl678.seq - Viral sequence entries, part 678.
6971. gbvrl679.seq - Viral sequence entries, part 679.
6972. gbvrl68.seq - Viral sequence entries, part 68.
6973. gbvrl680.seq - Viral sequence entries, part 680.
6974. gbvrl681.seq - Viral sequence entries, part 681.
6975. gbvrl682.seq - Viral sequence entries, part 682.
6976. gbvrl683.seq - Viral sequence entries, part 683.
6977. gbvrl684.seq - Viral sequence entries, part 684.
6978. gbvrl685.seq - Viral sequence entries, part 685.
6979. gbvrl686.seq - Viral sequence entries, part 686.
6980. gbvrl687.seq - Viral sequence entries, part 687.
6981. gbvrl688.seq - Viral sequence entries, part 688.
6982. gbvrl689.seq - Viral sequence entries, part 689.
6983. gbvrl69.seq - Viral sequence entries, part 69.
6984. gbvrl690.seq - Viral sequence entries, part 690.
6985. gbvrl691.seq - Viral sequence entries, part 691.
6986. gbvrl692.seq - Viral sequence entries, part 692.
6987. gbvrl693.seq - Viral sequence entries, part 693.
6988. gbvrl694.seq - Viral sequence entries, part 694.
6989. gbvrl695.seq - Viral sequence entries, part 695.
6990. gbvrl696.seq - Viral sequence entries, part 696.
6991. gbvrl697.seq - Viral sequence entries, part 697.
6992. gbvrl698.seq - Viral sequence entries, part 698.
6993. gbvrl699.seq - Viral sequence entries, part 699.
6994. gbvrl7.seq - Viral sequence entries, part 7.
6995. gbvrl70.seq - Viral sequence entries, part 70.
6996. gbvrl700.seq - Viral sequence entries, part 700.
6997. gbvrl701.seq - Viral sequence entries, part 701.
6998. gbvrl702.seq - Viral sequence entries, part 702.
6999. gbvrl703.seq - Viral sequence entries, part 703.
7000. gbvrl704.seq - Viral sequence entries, part 704.
7001. gbvrl705.seq - Viral sequence entries, part 705.
7002. gbvrl706.seq - Viral sequence entries, part 706.
7003. gbvrl707.seq - Viral sequence entries, part 707.
7004. gbvrl708.seq - Viral sequence entries, part 708.
7005. gbvrl709.seq - Viral sequence entries, part 709.
7006. gbvrl71.seq - Viral sequence entries, part 71.
7007. gbvrl710.seq - Viral sequence entries, part 710.
7008. gbvrl711.seq - Viral sequence entries, part 711.
7009. gbvrl712.seq - Viral sequence entries, part 712.
7010. gbvrl713.seq - Viral sequence entries, part 713.
7011. gbvrl714.seq - Viral sequence entries, part 714.
7012. gbvrl715.seq - Viral sequence entries, part 715.
7013. gbvrl716.seq - Viral sequence entries, part 716.
7014. gbvrl717.seq - Viral sequence entries, part 717.
7015. gbvrl718.seq - Viral sequence entries, part 718.
7016. gbvrl719.seq - Viral sequence entries, part 719.
7017. gbvrl72.seq - Viral sequence entries, part 72.
7018. gbvrl720.seq - Viral sequence entries, part 720.
7019. gbvrl721.seq - Viral sequence entries, part 721.
7020. gbvrl722.seq - Viral sequence entries, part 722.
7021. gbvrl723.seq - Viral sequence entries, part 723.
7022. gbvrl724.seq - Viral sequence entries, part 724.
7023. gbvrl725.seq - Viral sequence entries, part 725.
7024. gbvrl726.seq - Viral sequence entries, part 726.
7025. gbvrl727.seq - Viral sequence entries, part 727.
7026. gbvrl728.seq - Viral sequence entries, part 728.
7027. gbvrl729.seq - Viral sequence entries, part 729.
7028. gbvrl73.seq - Viral sequence entries, part 73.
7029. gbvrl730.seq - Viral sequence entries, part 730.
7030. gbvrl731.seq - Viral sequence entries, part 731.
7031. gbvrl732.seq - Viral sequence entries, part 732.
7032. gbvrl733.seq - Viral sequence entries, part 733.
7033. gbvrl734.seq - Viral sequence entries, part 734.
7034. gbvrl735.seq - Viral sequence entries, part 735.
7035. gbvrl736.seq - Viral sequence entries, part 736.
7036. gbvrl737.seq - Viral sequence entries, part 737.
7037. gbvrl738.seq - Viral sequence entries, part 738.
7038. gbvrl739.seq - Viral sequence entries, part 739.
7039. gbvrl74.seq - Viral sequence entries, part 74.
7040. gbvrl740.seq - Viral sequence entries, part 740.
7041. gbvrl741.seq - Viral sequence entries, part 741.
7042. gbvrl742.seq - Viral sequence entries, part 742.
7043. gbvrl743.seq - Viral sequence entries, part 743.
7044. gbvrl744.seq - Viral sequence entries, part 744.
7045. gbvrl745.seq - Viral sequence entries, part 745.
7046. gbvrl746.seq - Viral sequence entries, part 746.
7047. gbvrl747.seq - Viral sequence entries, part 747.
7048. gbvrl748.seq - Viral sequence entries, part 748.
7049. gbvrl749.seq - Viral sequence entries, part 749.
7050. gbvrl75.seq - Viral sequence entries, part 75.
7051. gbvrl750.seq - Viral sequence entries, part 750.
7052. gbvrl751.seq - Viral sequence entries, part 751.
7053. gbvrl752.seq - Viral sequence entries, part 752.
7054. gbvrl753.seq - Viral sequence entries, part 753.
7055. gbvrl754.seq - Viral sequence entries, part 754.
7056. gbvrl755.seq - Viral sequence entries, part 755.
7057. gbvrl756.seq - Viral sequence entries, part 756.
7058. gbvrl757.seq - Viral sequence entries, part 757.
7059. gbvrl758.seq - Viral sequence entries, part 758.
7060. gbvrl759.seq - Viral sequence entries, part 759.
7061. gbvrl76.seq - Viral sequence entries, part 76.
7062. gbvrl760.seq - Viral sequence entries, part 760.
7063. gbvrl761.seq - Viral sequence entries, part 761.
7064. gbvrl762.seq - Viral sequence entries, part 762.
7065. gbvrl763.seq - Viral sequence entries, part 763.
7066. gbvrl764.seq - Viral sequence entries, part 764.
7067. gbvrl765.seq - Viral sequence entries, part 765.
7068. gbvrl766.seq - Viral sequence entries, part 766.
7069. gbvrl767.seq - Viral sequence entries, part 767.
7070. gbvrl768.seq - Viral sequence entries, part 768.
7071. gbvrl769.seq - Viral sequence entries, part 769.
7072. gbvrl77.seq - Viral sequence entries, part 77.
7073. gbvrl770.seq - Viral sequence entries, part 770.
7074. gbvrl771.seq - Viral sequence entries, part 771.
7075. gbvrl772.seq - Viral sequence entries, part 772.
7076. gbvrl773.seq - Viral sequence entries, part 773.
7077. gbvrl774.seq - Viral sequence entries, part 774.
7078. gbvrl775.seq - Viral sequence entries, part 775.
7079. gbvrl776.seq - Viral sequence entries, part 776.
7080. gbvrl777.seq - Viral sequence entries, part 777.
7081. gbvrl778.seq - Viral sequence entries, part 778.
7082. gbvrl779.seq - Viral sequence entries, part 779.
7083. gbvrl78.seq - Viral sequence entries, part 78.
7084. gbvrl780.seq - Viral sequence entries, part 780.
7085. gbvrl781.seq - Viral sequence entries, part 781.
7086. gbvrl782.seq - Viral sequence entries, part 782.
7087. gbvrl783.seq - Viral sequence entries, part 783.
7088. gbvrl784.seq - Viral sequence entries, part 784.
7089. gbvrl785.seq - Viral sequence entries, part 785.
7090. gbvrl786.seq - Viral sequence entries, part 786.
7091. gbvrl787.seq - Viral sequence entries, part 787.
7092. gbvrl788.seq - Viral sequence entries, part 788.
7093. gbvrl789.seq - Viral sequence entries, part 789.
7094. gbvrl79.seq - Viral sequence entries, part 79.
7095. gbvrl790.seq - Viral sequence entries, part 790.
7096. gbvrl791.seq - Viral sequence entries, part 791.
7097. gbvrl792.seq - Viral sequence entries, part 792.
7098. gbvrl793.seq - Viral sequence entries, part 793.
7099. gbvrl794.seq - Viral sequence entries, part 794.
7100. gbvrl795.seq - Viral sequence entries, part 795.
7101. gbvrl796.seq - Viral sequence entries, part 796.
7102. gbvrl797.seq - Viral sequence entries, part 797.
7103. gbvrl798.seq - Viral sequence entries, part 798.
7104. gbvrl799.seq - Viral sequence entries, part 799.
7105. gbvrl8.seq - Viral sequence entries, part 8.
7106. gbvrl80.seq - Viral sequence entries, part 80.
7107. gbvrl800.seq - Viral sequence entries, part 800.
7108. gbvrl801.seq - Viral sequence entries, part 801.
7109. gbvrl802.seq - Viral sequence entries, part 802.
7110. gbvrl803.seq - Viral sequence entries, part 803.
7111. gbvrl804.seq - Viral sequence entries, part 804.
7112. gbvrl805.seq - Viral sequence entries, part 805.
7113. gbvrl806.seq - Viral sequence entries, part 806.
7114. gbvrl807.seq - Viral sequence entries, part 807.
7115. gbvrl808.seq - Viral sequence entries, part 808.
7116. gbvrl809.seq - Viral sequence entries, part 809.
7117. gbvrl81.seq - Viral sequence entries, part 81.
7118. gbvrl810.seq - Viral sequence entries, part 810.
7119. gbvrl811.seq - Viral sequence entries, part 811.
7120. gbvrl812.seq - Viral sequence entries, part 812.
7121. gbvrl813.seq - Viral sequence entries, part 813.
7122. gbvrl814.seq - Viral sequence entries, part 814.
7123. gbvrl815.seq - Viral sequence entries, part 815.
7124. gbvrl816.seq - Viral sequence entries, part 816.
7125. gbvrl817.seq - Viral sequence entries, part 817.
7126. gbvrl818.seq - Viral sequence entries, part 818.
7127. gbvrl819.seq - Viral sequence entries, part 819.
7128. gbvrl82.seq - Viral sequence entries, part 82.
7129. gbvrl820.seq - Viral sequence entries, part 820.
7130. gbvrl821.seq - Viral sequence entries, part 821.
7131. gbvrl822.seq - Viral sequence entries, part 822.
7132. gbvrl823.seq - Viral sequence entries, part 823.
7133. gbvrl824.seq - Viral sequence entries, part 824.
7134. gbvrl825.seq - Viral sequence entries, part 825.
7135. gbvrl826.seq - Viral sequence entries, part 826.
7136. gbvrl827.seq - Viral sequence entries, part 827.
7137. gbvrl828.seq - Viral sequence entries, part 828.
7138. gbvrl829.seq - Viral sequence entries, part 829.
7139. gbvrl83.seq - Viral sequence entries, part 83.
7140. gbvrl830.seq - Viral sequence entries, part 830.
7141. gbvrl831.seq - Viral sequence entries, part 831.
7142. gbvrl832.seq - Viral sequence entries, part 832.
7143. gbvrl833.seq - Viral sequence entries, part 833.
7144. gbvrl834.seq - Viral sequence entries, part 834.
7145. gbvrl835.seq - Viral sequence entries, part 835.
7146. gbvrl836.seq - Viral sequence entries, part 836.
7147. gbvrl837.seq - Viral sequence entries, part 837.
7148. gbvrl838.seq - Viral sequence entries, part 838.
7149. gbvrl839.seq - Viral sequence entries, part 839.
7150. gbvrl84.seq - Viral sequence entries, part 84.
7151. gbvrl840.seq - Viral sequence entries, part 840.
7152. gbvrl841.seq - Viral sequence entries, part 841.
7153. gbvrl842.seq - Viral sequence entries, part 842.
7154. gbvrl843.seq - Viral sequence entries, part 843.
7155. gbvrl844.seq - Viral sequence entries, part 844.
7156. gbvrl845.seq - Viral sequence entries, part 845.
7157. gbvrl846.seq - Viral sequence entries, part 846.
7158. gbvrl847.seq - Viral sequence entries, part 847.
7159. gbvrl848.seq - Viral sequence entries, part 848.
7160. gbvrl849.seq - Viral sequence entries, part 849.
7161. gbvrl85.seq - Viral sequence entries, part 85.
7162. gbvrl850.seq - Viral sequence entries, part 850.
7163. gbvrl851.seq - Viral sequence entries, part 851.
7164. gbvrl852.seq - Viral sequence entries, part 852.
7165. gbvrl853.seq - Viral sequence entries, part 853.
7166. gbvrl854.seq - Viral sequence entries, part 854.
7167. gbvrl855.seq - Viral sequence entries, part 855.
7168. gbvrl856.seq - Viral sequence entries, part 856.
7169. gbvrl857.seq - Viral sequence entries, part 857.
7170. gbvrl858.seq - Viral sequence entries, part 858.
7171. gbvrl859.seq - Viral sequence entries, part 859.
7172. gbvrl86.seq - Viral sequence entries, part 86.
7173. gbvrl860.seq - Viral sequence entries, part 860.
7174. gbvrl861.seq - Viral sequence entries, part 861.
7175. gbvrl862.seq - Viral sequence entries, part 862.
7176. gbvrl863.seq - Viral sequence entries, part 863.
7177. gbvrl864.seq - Viral sequence entries, part 864.
7178. gbvrl865.seq - Viral sequence entries, part 865.
7179. gbvrl866.seq - Viral sequence entries, part 866.
7180. gbvrl867.seq - Viral sequence entries, part 867.
7181. gbvrl868.seq - Viral sequence entries, part 868.
7182. gbvrl869.seq - Viral sequence entries, part 869.
7183. gbvrl87.seq - Viral sequence entries, part 87.
7184. gbvrl870.seq - Viral sequence entries, part 870.
7185. gbvrl871.seq - Viral sequence entries, part 871.
7186. gbvrl872.seq - Viral sequence entries, part 872.
7187. gbvrl873.seq - Viral sequence entries, part 873.
7188. gbvrl874.seq - Viral sequence entries, part 874.
7189. gbvrl875.seq - Viral sequence entries, part 875.
7190. gbvrl876.seq - Viral sequence entries, part 876.
7191. gbvrl877.seq - Viral sequence entries, part 877.
7192. gbvrl878.seq - Viral sequence entries, part 878.
7193. gbvrl879.seq - Viral sequence entries, part 879.
7194. gbvrl88.seq - Viral sequence entries, part 88.
7195. gbvrl880.seq - Viral sequence entries, part 880.
7196. gbvrl881.seq - Viral sequence entries, part 881.
7197. gbvrl882.seq - Viral sequence entries, part 882.
7198. gbvrl883.seq - Viral sequence entries, part 883.
7199. gbvrl884.seq - Viral sequence entries, part 884.
7200. gbvrl885.seq - Viral sequence entries, part 885.
7201. gbvrl886.seq - Viral sequence entries, part 886.
7202. gbvrl887.seq - Viral sequence entries, part 887.
7203. gbvrl888.seq - Viral sequence entries, part 888.
7204. gbvrl889.seq - Viral sequence entries, part 889.
7205. gbvrl89.seq - Viral sequence entries, part 89.
7206. gbvrl890.seq - Viral sequence entries, part 890.
7207. gbvrl891.seq - Viral sequence entries, part 891.
7208. gbvrl892.seq - Viral sequence entries, part 892.
7209. gbvrl893.seq - Viral sequence entries, part 893.
7210. gbvrl894.seq - Viral sequence entries, part 894.
7211. gbvrl895.seq - Viral sequence entries, part 895.
7212. gbvrl896.seq - Viral sequence entries, part 896.
7213. gbvrl897.seq - Viral sequence entries, part 897.
7214. gbvrl898.seq - Viral sequence entries, part 898.
7215. gbvrl899.seq - Viral sequence entries, part 899.
7216. gbvrl9.seq - Viral sequence entries, part 9.
7217. gbvrl90.seq - Viral sequence entries, part 90.
7218. gbvrl900.seq - Viral sequence entries, part 900.
7219. gbvrl901.seq - Viral sequence entries, part 901.
7220. gbvrl902.seq - Viral sequence entries, part 902.
7221. gbvrl903.seq - Viral sequence entries, part 903.
7222. gbvrl904.seq - Viral sequence entries, part 904.
7223. gbvrl905.seq - Viral sequence entries, part 905.
7224. gbvrl906.seq - Viral sequence entries, part 906.
7225. gbvrl907.seq - Viral sequence entries, part 907.
7226. gbvrl908.seq - Viral sequence entries, part 908.
7227. gbvrl909.seq - Viral sequence entries, part 909.
7228. gbvrl91.seq - Viral sequence entries, part 91.
7229. gbvrl910.seq - Viral sequence entries, part 910.
7230. gbvrl911.seq - Viral sequence entries, part 911.
7231. gbvrl912.seq - Viral sequence entries, part 912.
7232. gbvrl913.seq - Viral sequence entries, part 913.
7233. gbvrl914.seq - Viral sequence entries, part 914.
7234. gbvrl915.seq - Viral sequence entries, part 915.
7235. gbvrl916.seq - Viral sequence entries, part 916.
7236. gbvrl917.seq - Viral sequence entries, part 917.
7237. gbvrl918.seq - Viral sequence entries, part 918.
7238. gbvrl919.seq - Viral sequence entries, part 919.
7239. gbvrl92.seq - Viral sequence entries, part 92.
7240. gbvrl920.seq - Viral sequence entries, part 920.
7241. gbvrl921.seq - Viral sequence entries, part 921.
7242. gbvrl922.seq - Viral sequence entries, part 922.
7243. gbvrl923.seq - Viral sequence entries, part 923.
7244. gbvrl924.seq - Viral sequence entries, part 924.
7245. gbvrl925.seq - Viral sequence entries, part 925.
7246. gbvrl926.seq - Viral sequence entries, part 926.
7247. gbvrl927.seq - Viral sequence entries, part 927.
7248. gbvrl928.seq - Viral sequence entries, part 928.
7249. gbvrl929.seq - Viral sequence entries, part 929.
7250. gbvrl93.seq - Viral sequence entries, part 93.
7251. gbvrl930.seq - Viral sequence entries, part 930.
7252. gbvrl931.seq - Viral sequence entries, part 931.
7253. gbvrl932.seq - Viral sequence entries, part 932.
7254. gbvrl933.seq - Viral sequence entries, part 933.
7255. gbvrl934.seq - Viral sequence entries, part 934.
7256. gbvrl935.seq - Viral sequence entries, part 935.
7257. gbvrl936.seq - Viral sequence entries, part 936.
7258. gbvrl937.seq - Viral sequence entries, part 937.
7259. gbvrl938.seq - Viral sequence entries, part 938.
7260. gbvrl939.seq - Viral sequence entries, part 939.
7261. gbvrl94.seq - Viral sequence entries, part 94.
7262. gbvrl940.seq - Viral sequence entries, part 940.
7263. gbvrl941.seq - Viral sequence entries, part 941.
7264. gbvrl942.seq - Viral sequence entries, part 942.
7265. gbvrl943.seq - Viral sequence entries, part 943.
7266. gbvrl944.seq - Viral sequence entries, part 944.
7267. gbvrl945.seq - Viral sequence entries, part 945.
7268. gbvrl946.seq - Viral sequence entries, part 946.
7269. gbvrl947.seq - Viral sequence entries, part 947.
7270. gbvrl948.seq - Viral sequence entries, part 948.
7271. gbvrl949.seq - Viral sequence entries, part 949.
7272. gbvrl95.seq - Viral sequence entries, part 95.
7273. gbvrl950.seq - Viral sequence entries, part 950.
7274. gbvrl951.seq - Viral sequence entries, part 951.
7275. gbvrl952.seq - Viral sequence entries, part 952.
7276. gbvrl953.seq - Viral sequence entries, part 953.
7277. gbvrl954.seq - Viral sequence entries, part 954.
7278. gbvrl955.seq - Viral sequence entries, part 955.
7279. gbvrl956.seq - Viral sequence entries, part 956.
7280. gbvrl957.seq - Viral sequence entries, part 957.
7281. gbvrl958.seq - Viral sequence entries, part 958.
7282. gbvrl959.seq - Viral sequence entries, part 959.
7283. gbvrl96.seq - Viral sequence entries, part 96.
7284. gbvrl960.seq - Viral sequence entries, part 960.
7285. gbvrl961.seq - Viral sequence entries, part 961.
7286. gbvrl962.seq - Viral sequence entries, part 962.
7287. gbvrl963.seq - Viral sequence entries, part 963.
7288. gbvrl964.seq - Viral sequence entries, part 964.
7289. gbvrl965.seq - Viral sequence entries, part 965.
7290. gbvrl966.seq - Viral sequence entries, part 966.
7291. gbvrl967.seq - Viral sequence entries, part 967.
7292. gbvrl968.seq - Viral sequence entries, part 968.
7293. gbvrl969.seq - Viral sequence entries, part 969.
7294. gbvrl97.seq - Viral sequence entries, part 97.
7295. gbvrl970.seq - Viral sequence entries, part 970.
7296. gbvrl971.seq - Viral sequence entries, part 971.
7297. gbvrl972.seq - Viral sequence entries, part 972.
7298. gbvrl973.seq - Viral sequence entries, part 973.
7299. gbvrl974.seq - Viral sequence entries, part 974.
7300. gbvrl975.seq - Viral sequence entries, part 975.
7301. gbvrl976.seq - Viral sequence entries, part 976.
7302. gbvrl977.seq - Viral sequence entries, part 977.
7303. gbvrl978.seq - Viral sequence entries, part 978.
7304. gbvrl979.seq - Viral sequence entries, part 979.
7305. gbvrl98.seq - Viral sequence entries, part 98.
7306. gbvrl980.seq - Viral sequence entries, part 980.
7307. gbvrl981.seq - Viral sequence entries, part 981.
7308. gbvrl982.seq - Viral sequence entries, part 982.
7309. gbvrl983.seq - Viral sequence entries, part 983.
7310. gbvrl984.seq - Viral sequence entries, part 984.
7311. gbvrl985.seq - Viral sequence entries, part 985.
7312. gbvrl986.seq - Viral sequence entries, part 986.
7313. gbvrl987.seq - Viral sequence entries, part 987.
7314. gbvrl988.seq - Viral sequence entries, part 988.
7315. gbvrl989.seq - Viral sequence entries, part 989.
7316. gbvrl99.seq - Viral sequence entries, part 99.
7317. gbvrl990.seq - Viral sequence entries, part 990.
7318. gbvrl991.seq - Viral sequence entries, part 991.
7319. gbvrl992.seq - Viral sequence entries, part 992.
7320. gbvrl993.seq - Viral sequence entries, part 993.
7321. gbvrl994.seq - Viral sequence entries, part 994.
7322. gbvrl995.seq - Viral sequence entries, part 995.
7323. gbvrl996.seq - Viral sequence entries, part 996.
7324. gbvrl997.seq - Viral sequence entries, part 997.
7325. gbvrl998.seq - Viral sequence entries, part 998.
7326. gbvrl999.seq - Viral sequence entries, part 999.
7327. gbvrt1.seq - Other vertebrate sequence entries, part 1.
7328. gbvrt10.seq - Other vertebrate sequence entries, part 10.
7329. gbvrt100.seq - Other vertebrate sequence entries, part 100.
7330. gbvrt101.seq - Other vertebrate sequence entries, part 101.
7331. gbvrt102.seq - Other vertebrate sequence entries, part 102.
7332. gbvrt103.seq - Other vertebrate sequence entries, part 103.
7333. gbvrt104.seq - Other vertebrate sequence entries, part 104.
7334. gbvrt105.seq - Other vertebrate sequence entries, part 105.
7335. gbvrt106.seq - Other vertebrate sequence entries, part 106.
7336. gbvrt107.seq - Other vertebrate sequence entries, part 107.
7337. gbvrt108.seq - Other vertebrate sequence entries, part 108.
7338. gbvrt109.seq - Other vertebrate sequence entries, part 109.
7339. gbvrt11.seq - Other vertebrate sequence entries, part 11.
7340. gbvrt110.seq - Other vertebrate sequence entries, part 110.
7341. gbvrt111.seq - Other vertebrate sequence entries, part 111.
7342. gbvrt112.seq - Other vertebrate sequence entries, part 112.
7343. gbvrt113.seq - Other vertebrate sequence entries, part 113.
7344. gbvrt114.seq - Other vertebrate sequence entries, part 114.
7345. gbvrt115.seq - Other vertebrate sequence entries, part 115.
7346. gbvrt116.seq - Other vertebrate sequence entries, part 116.
7347. gbvrt117.seq - Other vertebrate sequence entries, part 117.
7348. gbvrt118.seq - Other vertebrate sequence entries, part 118.
7349. gbvrt119.seq - Other vertebrate sequence entries, part 119.
7350. gbvrt12.seq - Other vertebrate sequence entries, part 12.
7351. gbvrt120.seq - Other vertebrate sequence entries, part 120.
7352. gbvrt121.seq - Other vertebrate sequence entries, part 121.
7353. gbvrt122.seq - Other vertebrate sequence entries, part 122.
7354. gbvrt123.seq - Other vertebrate sequence entries, part 123.
7355. gbvrt124.seq - Other vertebrate sequence entries, part 124.
7356. gbvrt125.seq - Other vertebrate sequence entries, part 125.
7357. gbvrt126.seq - Other vertebrate sequence entries, part 126.
7358. gbvrt127.seq - Other vertebrate sequence entries, part 127.
7359. gbvrt128.seq - Other vertebrate sequence entries, part 128.
7360. gbvrt129.seq - Other vertebrate sequence entries, part 129.
7361. gbvrt13.seq - Other vertebrate sequence entries, part 13.
7362. gbvrt130.seq - Other vertebrate sequence entries, part 130.
7363. gbvrt131.seq - Other vertebrate sequence entries, part 131.
7364. gbvrt132.seq - Other vertebrate sequence entries, part 132.
7365. gbvrt133.seq - Other vertebrate sequence entries, part 133.
7366. gbvrt134.seq - Other vertebrate sequence entries, part 134.
7367. gbvrt135.seq - Other vertebrate sequence entries, part 135.
7368. gbvrt136.seq - Other vertebrate sequence entries, part 136.
7369. gbvrt137.seq - Other vertebrate sequence entries, part 137.
7370. gbvrt138.seq - Other vertebrate sequence entries, part 138.
7371. gbvrt139.seq - Other vertebrate sequence entries, part 139.
7372. gbvrt14.seq - Other vertebrate sequence entries, part 14.
7373. gbvrt140.seq - Other vertebrate sequence entries, part 140.
7374. gbvrt141.seq - Other vertebrate sequence entries, part 141.
7375. gbvrt142.seq - Other vertebrate sequence entries, part 142.
7376. gbvrt143.seq - Other vertebrate sequence entries, part 143.
7377. gbvrt144.seq - Other vertebrate sequence entries, part 144.
7378. gbvrt145.seq - Other vertebrate sequence entries, part 145.
7379. gbvrt146.seq - Other vertebrate sequence entries, part 146.
7380. gbvrt147.seq - Other vertebrate sequence entries, part 147.
7381. gbvrt148.seq - Other vertebrate sequence entries, part 148.
7382. gbvrt149.seq - Other vertebrate sequence entries, part 149.
7383. gbvrt15.seq - Other vertebrate sequence entries, part 15.
7384. gbvrt150.seq - Other vertebrate sequence entries, part 150.
7385. gbvrt151.seq - Other vertebrate sequence entries, part 151.
7386. gbvrt152.seq - Other vertebrate sequence entries, part 152.
7387. gbvrt153.seq - Other vertebrate sequence entries, part 153.
7388. gbvrt154.seq - Other vertebrate sequence entries, part 154.
7389. gbvrt155.seq - Other vertebrate sequence entries, part 155.
7390. gbvrt156.seq - Other vertebrate sequence entries, part 156.
7391. gbvrt157.seq - Other vertebrate sequence entries, part 157.
7392. gbvrt158.seq - Other vertebrate sequence entries, part 158.
7393. gbvrt159.seq - Other vertebrate sequence entries, part 159.
7394. gbvrt16.seq - Other vertebrate sequence entries, part 16.
7395. gbvrt160.seq - Other vertebrate sequence entries, part 160.
7396. gbvrt161.seq - Other vertebrate sequence entries, part 161.
7397. gbvrt162.seq - Other vertebrate sequence entries, part 162.
7398. gbvrt163.seq - Other vertebrate sequence entries, part 163.
7399. gbvrt164.seq - Other vertebrate sequence entries, part 164.
7400. gbvrt165.seq - Other vertebrate sequence entries, part 165.
7401. gbvrt166.seq - Other vertebrate sequence entries, part 166.
7402. gbvrt167.seq - Other vertebrate sequence entries, part 167.
7403. gbvrt168.seq - Other vertebrate sequence entries, part 168.
7404. gbvrt169.seq - Other vertebrate sequence entries, part 169.
7405. gbvrt17.seq - Other vertebrate sequence entries, part 17.
7406. gbvrt170.seq - Other vertebrate sequence entries, part 170.
7407. gbvrt171.seq - Other vertebrate sequence entries, part 171.
7408. gbvrt172.seq - Other vertebrate sequence entries, part 172.
7409. gbvrt173.seq - Other vertebrate sequence entries, part 173.
7410. gbvrt174.seq - Other vertebrate sequence entries, part 174.
7411. gbvrt175.seq - Other vertebrate sequence entries, part 175.
7412. gbvrt176.seq - Other vertebrate sequence entries, part 176.
7413. gbvrt177.seq - Other vertebrate sequence entries, part 177.
7414. gbvrt178.seq - Other vertebrate sequence entries, part 178.
7415. gbvrt179.seq - Other vertebrate sequence entries, part 179.
7416. gbvrt18.seq - Other vertebrate sequence entries, part 18.
7417. gbvrt180.seq - Other vertebrate sequence entries, part 180.
7418. gbvrt181.seq - Other vertebrate sequence entries, part 181.
7419. gbvrt182.seq - Other vertebrate sequence entries, part 182.
7420. gbvrt183.seq - Other vertebrate sequence entries, part 183.
7421. gbvrt184.seq - Other vertebrate sequence entries, part 184.
7422. gbvrt185.seq - Other vertebrate sequence entries, part 185.
7423. gbvrt186.seq - Other vertebrate sequence entries, part 186.
7424. gbvrt187.seq - Other vertebrate sequence entries, part 187.
7425. gbvrt188.seq - Other vertebrate sequence entries, part 188.
7426. gbvrt189.seq - Other vertebrate sequence entries, part 189.
7427. gbvrt19.seq - Other vertebrate sequence entries, part 19.
7428. gbvrt190.seq - Other vertebrate sequence entries, part 190.
7429. gbvrt191.seq - Other vertebrate sequence entries, part 191.
7430. gbvrt192.seq - Other vertebrate sequence entries, part 192.
7431. gbvrt193.seq - Other vertebrate sequence entries, part 193.
7432. gbvrt194.seq - Other vertebrate sequence entries, part 194.
7433. gbvrt195.seq - Other vertebrate sequence entries, part 195.
7434. gbvrt196.seq - Other vertebrate sequence entries, part 196.
7435. gbvrt197.seq - Other vertebrate sequence entries, part 197.
7436. gbvrt198.seq - Other vertebrate sequence entries, part 198.
7437. gbvrt199.seq - Other vertebrate sequence entries, part 199.
7438. gbvrt2.seq - Other vertebrate sequence entries, part 2.
7439. gbvrt20.seq - Other vertebrate sequence entries, part 20.
7440. gbvrt200.seq - Other vertebrate sequence entries, part 200.
7441. gbvrt201.seq - Other vertebrate sequence entries, part 201.
7442. gbvrt202.seq - Other vertebrate sequence entries, part 202.
7443. gbvrt203.seq - Other vertebrate sequence entries, part 203.
7444. gbvrt204.seq - Other vertebrate sequence entries, part 204.
7445. gbvrt205.seq - Other vertebrate sequence entries, part 205.
7446. gbvrt206.seq - Other vertebrate sequence entries, part 206.
7447. gbvrt207.seq - Other vertebrate sequence entries, part 207.
7448. gbvrt208.seq - Other vertebrate sequence entries, part 208.
7449. gbvrt209.seq - Other vertebrate sequence entries, part 209.
7450. gbvrt21.seq - Other vertebrate sequence entries, part 21.
7451. gbvrt210.seq - Other vertebrate sequence entries, part 210.
7452. gbvrt211.seq - Other vertebrate sequence entries, part 211.
7453. gbvrt212.seq - Other vertebrate sequence entries, part 212.
7454. gbvrt213.seq - Other vertebrate sequence entries, part 213.
7455. gbvrt214.seq - Other vertebrate sequence entries, part 214.
7456. gbvrt215.seq - Other vertebrate sequence entries, part 215.
7457. gbvrt216.seq - Other vertebrate sequence entries, part 216.
7458. gbvrt217.seq - Other vertebrate sequence entries, part 217.
7459. gbvrt218.seq - Other vertebrate sequence entries, part 218.
7460. gbvrt219.seq - Other vertebrate sequence entries, part 219.
7461. gbvrt22.seq - Other vertebrate sequence entries, part 22.
7462. gbvrt220.seq - Other vertebrate sequence entries, part 220.
7463. gbvrt221.seq - Other vertebrate sequence entries, part 221.
7464. gbvrt222.seq - Other vertebrate sequence entries, part 222.
7465. gbvrt223.seq - Other vertebrate sequence entries, part 223.
7466. gbvrt224.seq - Other vertebrate sequence entries, part 224.
7467. gbvrt225.seq - Other vertebrate sequence entries, part 225.
7468. gbvrt226.seq - Other vertebrate sequence entries, part 226.
7469. gbvrt227.seq - Other vertebrate sequence entries, part 227.
7470. gbvrt228.seq - Other vertebrate sequence entries, part 228.
7471. gbvrt229.seq - Other vertebrate sequence entries, part 229.
7472. gbvrt23.seq - Other vertebrate sequence entries, part 23.
7473. gbvrt230.seq - Other vertebrate sequence entries, part 230.
7474. gbvrt231.seq - Other vertebrate sequence entries, part 231.
7475. gbvrt232.seq - Other vertebrate sequence entries, part 232.
7476. gbvrt233.seq - Other vertebrate sequence entries, part 233.
7477. gbvrt234.seq - Other vertebrate sequence entries, part 234.
7478. gbvrt235.seq - Other vertebrate sequence entries, part 235.
7479. gbvrt236.seq - Other vertebrate sequence entries, part 236.
7480. gbvrt237.seq - Other vertebrate sequence entries, part 237.
7481. gbvrt238.seq - Other vertebrate sequence entries, part 238.
7482. gbvrt239.seq - Other vertebrate sequence entries, part 239.
7483. gbvrt24.seq - Other vertebrate sequence entries, part 24.
7484. gbvrt240.seq - Other vertebrate sequence entries, part 240.
7485. gbvrt241.seq - Other vertebrate sequence entries, part 241.
7486. gbvrt242.seq - Other vertebrate sequence entries, part 242.
7487. gbvrt243.seq - Other vertebrate sequence entries, part 243.
7488. gbvrt244.seq - Other vertebrate sequence entries, part 244.
7489. gbvrt245.seq - Other vertebrate sequence entries, part 245.
7490. gbvrt246.seq - Other vertebrate sequence entries, part 246.
7491. gbvrt247.seq - Other vertebrate sequence entries, part 247.
7492. gbvrt248.seq - Other vertebrate sequence entries, part 248.
7493. gbvrt249.seq - Other vertebrate sequence entries, part 249.
7494. gbvrt25.seq - Other vertebrate sequence entries, part 25.
7495. gbvrt250.seq - Other vertebrate sequence entries, part 250.
7496. gbvrt251.seq - Other vertebrate sequence entries, part 251.
7497. gbvrt252.seq - Other vertebrate sequence entries, part 252.
7498. gbvrt253.seq - Other vertebrate sequence entries, part 253.
7499. gbvrt254.seq - Other vertebrate sequence entries, part 254.
7500. gbvrt255.seq - Other vertebrate sequence entries, part 255.
7501. gbvrt256.seq - Other vertebrate sequence entries, part 256.
7502. gbvrt257.seq - Other vertebrate sequence entries, part 257.
7503. gbvrt258.seq - Other vertebrate sequence entries, part 258.
7504. gbvrt259.seq - Other vertebrate sequence entries, part 259.
7505. gbvrt26.seq - Other vertebrate sequence entries, part 26.
7506. gbvrt260.seq - Other vertebrate sequence entries, part 260.
7507. gbvrt261.seq - Other vertebrate sequence entries, part 261.
7508. gbvrt262.seq - Other vertebrate sequence entries, part 262.
7509. gbvrt263.seq - Other vertebrate sequence entries, part 263.
7510. gbvrt264.seq - Other vertebrate sequence entries, part 264.
7511. gbvrt265.seq - Other vertebrate sequence entries, part 265.
7512. gbvrt266.seq - Other vertebrate sequence entries, part 266.
7513. gbvrt267.seq - Other vertebrate sequence entries, part 267.
7514. gbvrt268.seq - Other vertebrate sequence entries, part 268.
7515. gbvrt269.seq - Other vertebrate sequence entries, part 269.
7516. gbvrt27.seq - Other vertebrate sequence entries, part 27.
7517. gbvrt270.seq - Other vertebrate sequence entries, part 270.
7518. gbvrt271.seq - Other vertebrate sequence entries, part 271.
7519. gbvrt272.seq - Other vertebrate sequence entries, part 272.
7520. gbvrt273.seq - Other vertebrate sequence entries, part 273.
7521. gbvrt274.seq - Other vertebrate sequence entries, part 274.
7522. gbvrt275.seq - Other vertebrate sequence entries, part 275.
7523. gbvrt276.seq - Other vertebrate sequence entries, part 276.
7524. gbvrt277.seq - Other vertebrate sequence entries, part 277.
7525. gbvrt278.seq - Other vertebrate sequence entries, part 278.
7526. gbvrt279.seq - Other vertebrate sequence entries, part 279.
7527. gbvrt28.seq - Other vertebrate sequence entries, part 28.
7528. gbvrt280.seq - Other vertebrate sequence entries, part 280.
7529. gbvrt281.seq - Other vertebrate sequence entries, part 281.
7530. gbvrt282.seq - Other vertebrate sequence entries, part 282.
7531. gbvrt283.seq - Other vertebrate sequence entries, part 283.
7532. gbvrt284.seq - Other vertebrate sequence entries, part 284.
7533. gbvrt285.seq - Other vertebrate sequence entries, part 285.
7534. gbvrt286.seq - Other vertebrate sequence entries, part 286.
7535. gbvrt287.seq - Other vertebrate sequence entries, part 287.
7536. gbvrt288.seq - Other vertebrate sequence entries, part 288.
7537. gbvrt289.seq - Other vertebrate sequence entries, part 289.
7538. gbvrt29.seq - Other vertebrate sequence entries, part 29.
7539. gbvrt290.seq - Other vertebrate sequence entries, part 290.
7540. gbvrt291.seq - Other vertebrate sequence entries, part 291.
7541. gbvrt292.seq - Other vertebrate sequence entries, part 292.
7542. gbvrt293.seq - Other vertebrate sequence entries, part 293.
7543. gbvrt294.seq - Other vertebrate sequence entries, part 294.
7544. gbvrt295.seq - Other vertebrate sequence entries, part 295.
7545. gbvrt296.seq - Other vertebrate sequence entries, part 296.
7546. gbvrt297.seq - Other vertebrate sequence entries, part 297.
7547. gbvrt298.seq - Other vertebrate sequence entries, part 298.
7548. gbvrt299.seq - Other vertebrate sequence entries, part 299.
7549. gbvrt3.seq - Other vertebrate sequence entries, part 3.
7550. gbvrt30.seq - Other vertebrate sequence entries, part 30.
7551. gbvrt300.seq - Other vertebrate sequence entries, part 300.
7552. gbvrt301.seq - Other vertebrate sequence entries, part 301.
7553. gbvrt302.seq - Other vertebrate sequence entries, part 302.
7554. gbvrt303.seq - Other vertebrate sequence entries, part 303.
7555. gbvrt304.seq - Other vertebrate sequence entries, part 304.
7556. gbvrt305.seq - Other vertebrate sequence entries, part 305.
7557. gbvrt306.seq - Other vertebrate sequence entries, part 306.
7558. gbvrt307.seq - Other vertebrate sequence entries, part 307.
7559. gbvrt308.seq - Other vertebrate sequence entries, part 308.
7560. gbvrt309.seq - Other vertebrate sequence entries, part 309.
7561. gbvrt31.seq - Other vertebrate sequence entries, part 31.
7562. gbvrt310.seq - Other vertebrate sequence entries, part 310.
7563. gbvrt311.seq - Other vertebrate sequence entries, part 311.
7564. gbvrt312.seq - Other vertebrate sequence entries, part 312.
7565. gbvrt313.seq - Other vertebrate sequence entries, part 313.
7566. gbvrt314.seq - Other vertebrate sequence entries, part 314.
7567. gbvrt315.seq - Other vertebrate sequence entries, part 315.
7568. gbvrt316.seq - Other vertebrate sequence entries, part 316.
7569. gbvrt317.seq - Other vertebrate sequence entries, part 317.
7570. gbvrt318.seq - Other vertebrate sequence entries, part 318.
7571. gbvrt319.seq - Other vertebrate sequence entries, part 319.
7572. gbvrt32.seq - Other vertebrate sequence entries, part 32.
7573. gbvrt320.seq - Other vertebrate sequence entries, part 320.
7574. gbvrt321.seq - Other vertebrate sequence entries, part 321.
7575. gbvrt322.seq - Other vertebrate sequence entries, part 322.
7576. gbvrt323.seq - Other vertebrate sequence entries, part 323.
7577. gbvrt324.seq - Other vertebrate sequence entries, part 324.
7578. gbvrt325.seq - Other vertebrate sequence entries, part 325.
7579. gbvrt326.seq - Other vertebrate sequence entries, part 326.
7580. gbvrt327.seq - Other vertebrate sequence entries, part 327.
7581. gbvrt328.seq - Other vertebrate sequence entries, part 328.
7582. gbvrt329.seq - Other vertebrate sequence entries, part 329.
7583. gbvrt33.seq - Other vertebrate sequence entries, part 33.
7584. gbvrt330.seq - Other vertebrate sequence entries, part 330.
7585. gbvrt331.seq - Other vertebrate sequence entries, part 331.
7586. gbvrt332.seq - Other vertebrate sequence entries, part 332.
7587. gbvrt333.seq - Other vertebrate sequence entries, part 333.
7588. gbvrt334.seq - Other vertebrate sequence entries, part 334.
7589. gbvrt335.seq - Other vertebrate sequence entries, part 335.
7590. gbvrt336.seq - Other vertebrate sequence entries, part 336.
7591. gbvrt337.seq - Other vertebrate sequence entries, part 337.
7592. gbvrt338.seq - Other vertebrate sequence entries, part 338.
7593. gbvrt339.seq - Other vertebrate sequence entries, part 339.
7594. gbvrt34.seq - Other vertebrate sequence entries, part 34.
7595. gbvrt340.seq - Other vertebrate sequence entries, part 340.
7596. gbvrt341.seq - Other vertebrate sequence entries, part 341.
7597. gbvrt342.seq - Other vertebrate sequence entries, part 342.
7598. gbvrt343.seq - Other vertebrate sequence entries, part 343.
7599. gbvrt344.seq - Other vertebrate sequence entries, part 344.
7600. gbvrt345.seq - Other vertebrate sequence entries, part 345.
7601. gbvrt346.seq - Other vertebrate sequence entries, part 346.
7602. gbvrt347.seq - Other vertebrate sequence entries, part 347.
7603. gbvrt348.seq - Other vertebrate sequence entries, part 348.
7604. gbvrt349.seq - Other vertebrate sequence entries, part 349.
7605. gbvrt35.seq - Other vertebrate sequence entries, part 35.
7606. gbvrt350.seq - Other vertebrate sequence entries, part 350.
7607. gbvrt351.seq - Other vertebrate sequence entries, part 351.
7608. gbvrt352.seq - Other vertebrate sequence entries, part 352.
7609. gbvrt353.seq - Other vertebrate sequence entries, part 353.
7610. gbvrt354.seq - Other vertebrate sequence entries, part 354.
7611. gbvrt355.seq - Other vertebrate sequence entries, part 355.
7612. gbvrt356.seq - Other vertebrate sequence entries, part 356.
7613. gbvrt357.seq - Other vertebrate sequence entries, part 357.
7614. gbvrt358.seq - Other vertebrate sequence entries, part 358.
7615. gbvrt359.seq - Other vertebrate sequence entries, part 359.
7616. gbvrt36.seq - Other vertebrate sequence entries, part 36.
7617. gbvrt360.seq - Other vertebrate sequence entries, part 360.
7618. gbvrt361.seq - Other vertebrate sequence entries, part 361.
7619. gbvrt362.seq - Other vertebrate sequence entries, part 362.
7620. gbvrt363.seq - Other vertebrate sequence entries, part 363.
7621. gbvrt364.seq - Other vertebrate sequence entries, part 364.
7622. gbvrt365.seq - Other vertebrate sequence entries, part 365.
7623. gbvrt366.seq - Other vertebrate sequence entries, part 366.
7624. gbvrt367.seq - Other vertebrate sequence entries, part 367.
7625. gbvrt368.seq - Other vertebrate sequence entries, part 368.
7626. gbvrt369.seq - Other vertebrate sequence entries, part 369.
7627. gbvrt37.seq - Other vertebrate sequence entries, part 37.
7628. gbvrt370.seq - Other vertebrate sequence entries, part 370.
7629. gbvrt371.seq - Other vertebrate sequence entries, part 371.
7630. gbvrt372.seq - Other vertebrate sequence entries, part 372.
7631. gbvrt373.seq - Other vertebrate sequence entries, part 373.
7632. gbvrt374.seq - Other vertebrate sequence entries, part 374.
7633. gbvrt375.seq - Other vertebrate sequence entries, part 375.
7634. gbvrt376.seq - Other vertebrate sequence entries, part 376.
7635. gbvrt377.seq - Other vertebrate sequence entries, part 377.
7636. gbvrt378.seq - Other vertebrate sequence entries, part 378.
7637. gbvrt379.seq - Other vertebrate sequence entries, part 379.
7638. gbvrt38.seq - Other vertebrate sequence entries, part 38.
7639. gbvrt380.seq - Other vertebrate sequence entries, part 380.
7640. gbvrt381.seq - Other vertebrate sequence entries, part 381.
7641. gbvrt382.seq - Other vertebrate sequence entries, part 382.
7642. gbvrt383.seq - Other vertebrate sequence entries, part 383.
7643. gbvrt384.seq - Other vertebrate sequence entries, part 384.
7644. gbvrt385.seq - Other vertebrate sequence entries, part 385.
7645. gbvrt386.seq - Other vertebrate sequence entries, part 386.
7646. gbvrt387.seq - Other vertebrate sequence entries, part 387.
7647. gbvrt388.seq - Other vertebrate sequence entries, part 388.
7648. gbvrt389.seq - Other vertebrate sequence entries, part 389.
7649. gbvrt39.seq - Other vertebrate sequence entries, part 39.
7650. gbvrt390.seq - Other vertebrate sequence entries, part 390.
7651. gbvrt391.seq - Other vertebrate sequence entries, part 391.
7652. gbvrt392.seq - Other vertebrate sequence entries, part 392.
7653. gbvrt393.seq - Other vertebrate sequence entries, part 393.
7654. gbvrt394.seq - Other vertebrate sequence entries, part 394.
7655. gbvrt395.seq - Other vertebrate sequence entries, part 395.
7656. gbvrt396.seq - Other vertebrate sequence entries, part 396.
7657. gbvrt397.seq - Other vertebrate sequence entries, part 397.
7658. gbvrt398.seq - Other vertebrate sequence entries, part 398.
7659. gbvrt399.seq - Other vertebrate sequence entries, part 399.
7660. gbvrt4.seq - Other vertebrate sequence entries, part 4.
7661. gbvrt40.seq - Other vertebrate sequence entries, part 40.
7662. gbvrt400.seq - Other vertebrate sequence entries, part 400.
7663. gbvrt401.seq - Other vertebrate sequence entries, part 401.
7664. gbvrt402.seq - Other vertebrate sequence entries, part 402.
7665. gbvrt403.seq - Other vertebrate sequence entries, part 403.
7666. gbvrt404.seq - Other vertebrate sequence entries, part 404.
7667. gbvrt405.seq - Other vertebrate sequence entries, part 405.
7668. gbvrt406.seq - Other vertebrate sequence entries, part 406.
7669. gbvrt407.seq - Other vertebrate sequence entries, part 407.
7670. gbvrt408.seq - Other vertebrate sequence entries, part 408.
7671. gbvrt409.seq - Other vertebrate sequence entries, part 409.
7672. gbvrt41.seq - Other vertebrate sequence entries, part 41.
7673. gbvrt410.seq - Other vertebrate sequence entries, part 410.
7674. gbvrt411.seq - Other vertebrate sequence entries, part 411.
7675. gbvrt412.seq - Other vertebrate sequence entries, part 412.
7676. gbvrt413.seq - Other vertebrate sequence entries, part 413.
7677. gbvrt414.seq - Other vertebrate sequence entries, part 414.
7678. gbvrt415.seq - Other vertebrate sequence entries, part 415.
7679. gbvrt416.seq - Other vertebrate sequence entries, part 416.
7680. gbvrt417.seq - Other vertebrate sequence entries, part 417.
7681. gbvrt418.seq - Other vertebrate sequence entries, part 418.
7682. gbvrt419.seq - Other vertebrate sequence entries, part 419.
7683. gbvrt42.seq - Other vertebrate sequence entries, part 42.
7684. gbvrt420.seq - Other vertebrate sequence entries, part 420.
7685. gbvrt421.seq - Other vertebrate sequence entries, part 421.
7686. gbvrt422.seq - Other vertebrate sequence entries, part 422.
7687. gbvrt423.seq - Other vertebrate sequence entries, part 423.
7688. gbvrt43.seq - Other vertebrate sequence entries, part 43.
7689. gbvrt44.seq - Other vertebrate sequence entries, part 44.
7690. gbvrt45.seq - Other vertebrate sequence entries, part 45.
7691. gbvrt46.seq - Other vertebrate sequence entries, part 46.
7692. gbvrt47.seq - Other vertebrate sequence entries, part 47.
7693. gbvrt48.seq - Other vertebrate sequence entries, part 48.
7694. gbvrt49.seq - Other vertebrate sequence entries, part 49.
7695. gbvrt5.seq - Other vertebrate sequence entries, part 5.
7696. gbvrt50.seq - Other vertebrate sequence entries, part 50.
7697. gbvrt51.seq - Other vertebrate sequence entries, part 51.
7698. gbvrt52.seq - Other vertebrate sequence entries, part 52.
7699. gbvrt53.seq - Other vertebrate sequence entries, part 53.
7700. gbvrt54.seq - Other vertebrate sequence entries, part 54.
7701. gbvrt55.seq - Other vertebrate sequence entries, part 55.
7702. gbvrt56.seq - Other vertebrate sequence entries, part 56.
7703. gbvrt57.seq - Other vertebrate sequence entries, part 57.
7704. gbvrt58.seq - Other vertebrate sequence entries, part 58.
7705. gbvrt59.seq - Other vertebrate sequence entries, part 59.
7706. gbvrt6.seq - Other vertebrate sequence entries, part 6.
7707. gbvrt60.seq - Other vertebrate sequence entries, part 60.
7708. gbvrt61.seq - Other vertebrate sequence entries, part 61.
7709. gbvrt62.seq - Other vertebrate sequence entries, part 62.
7710. gbvrt63.seq - Other vertebrate sequence entries, part 63.
7711. gbvrt64.seq - Other vertebrate sequence entries, part 64.
7712. gbvrt65.seq - Other vertebrate sequence entries, part 65.
7713. gbvrt66.seq - Other vertebrate sequence entries, part 66.
7714. gbvrt67.seq - Other vertebrate sequence entries, part 67.
7715. gbvrt68.seq - Other vertebrate sequence entries, part 68.
7716. gbvrt69.seq - Other vertebrate sequence entries, part 69.
7717. gbvrt7.seq - Other vertebrate sequence entries, part 7.
7718. gbvrt70.seq - Other vertebrate sequence entries, part 70.
7719. gbvrt71.seq - Other vertebrate sequence entries, part 71.
7720. gbvrt72.seq - Other vertebrate sequence entries, part 72.
7721. gbvrt73.seq - Other vertebrate sequence entries, part 73.
7722. gbvrt74.seq - Other vertebrate sequence entries, part 74.
7723. gbvrt75.seq - Other vertebrate sequence entries, part 75.
7724. gbvrt76.seq - Other vertebrate sequence entries, part 76.
7725. gbvrt77.seq - Other vertebrate sequence entries, part 77.
7726. gbvrt78.seq - Other vertebrate sequence entries, part 78.
7727. gbvrt79.seq - Other vertebrate sequence entries, part 79.
7728. gbvrt8.seq - Other vertebrate sequence entries, part 8.
7729. gbvrt80.seq - Other vertebrate sequence entries, part 80.
7730. gbvrt81.seq - Other vertebrate sequence entries, part 81.
7731. gbvrt82.seq - Other vertebrate sequence entries, part 82.
7732. gbvrt83.seq - Other vertebrate sequence entries, part 83.
7733. gbvrt84.seq - Other vertebrate sequence entries, part 84.
7734. gbvrt85.seq - Other vertebrate sequence entries, part 85.
7735. gbvrt86.seq - Other vertebrate sequence entries, part 86.
7736. gbvrt87.seq - Other vertebrate sequence entries, part 87.
7737. gbvrt88.seq - Other vertebrate sequence entries, part 88.
7738. gbvrt89.seq - Other vertebrate sequence entries, part 89.
7739. gbvrt9.seq - Other vertebrate sequence entries, part 9.
7740. gbvrt90.seq - Other vertebrate sequence entries, part 90.
7741. gbvrt91.seq - Other vertebrate sequence entries, part 91.
7742. gbvrt92.seq - Other vertebrate sequence entries, part 92.
7743. gbvrt93.seq - Other vertebrate sequence entries, part 93.
7744. gbvrt94.seq - Other vertebrate sequence entries, part 94.
7745. gbvrt95.seq - Other vertebrate sequence entries, part 95.
7746. gbvrt96.seq - Other vertebrate sequence entries, part 96.
7747. gbvrt97.seq - Other vertebrate sequence entries, part 97.
7748. gbvrt98.seq - Other vertebrate sequence entries, part 98.
7749. gbvrt99.seq - Other vertebrate sequence entries, part 99.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 257.0 flatfiles require roughly 3575 GB, including the sequence files and the *.txt files.

  The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 496243512     gbbct1.seq
 494251980     gbbct10.seq
 498718687     gbbct100.seq
 498338739     gbbct1000.se
 498433841     gbbct1001.se
 495474043     gbbct1002.se
 497231916     gbbct1003.se
 122463870     gbbct1004.se
 499023843     gbbct1005.se
 494495174     gbbct1006.se
 496926721     gbbct1007.se
 496309819     gbbct1008.se
 499067937     gbbct1009.se
 499103803     gbbct101.seq
 326441220     gbbct1010.se
 261686726     gbbct102.seq
 498131287     gbbct103.seq
 499519598     gbbct104.seq
 498963442     gbbct105.seq
 488108603     gbbct106.seq
 397950750     gbbct107.seq
 498261614     gbbct108.seq
 492775885     gbbct109.seq
 498490131     gbbct11.seq
 495523592     gbbct110.seq
 300972567     gbbct111.seq
 491271704     gbbct112.seq
 498541527     gbbct113.seq
 498106214     gbbct114.seq
  92795089     gbbct115.seq
 489628464     gbbct116.seq
 499324230     gbbct117.seq
 499931720     gbbct118.seq
 389028534     gbbct119.seq
 497844475     gbbct12.seq
 499874269     gbbct120.seq
 499836580     gbbct121.seq
 499886211     gbbct122.seq
 499926771     gbbct123.seq
  13835705     gbbct124.seq
 493589468     gbbct125.seq
 494743943     gbbct126.seq
 495417083     gbbct127.seq
 491069782     gbbct128.seq
 195549944     gbbct129.seq
  33498510     gbbct13.seq
 494137325     gbbct130.seq
 492532713     gbbct131.seq
 493222696     gbbct132.seq
 497234652     gbbct133.seq
  99480571     gbbct134.seq
 499011110     gbbct135.seq
 494100520     gbbct136.seq
 498830214     gbbct137.seq
 333294140     gbbct138.seq
 490710401     gbbct139.seq
 487419646     gbbct14.seq
 498618665     gbbct140.seq
 488692929     gbbct141.seq
 494287749     gbbct142.seq
  18986455     gbbct143.seq
 495984015     gbbct144.seq
 489083690     gbbct145.seq
 487156697     gbbct146.seq
 496236444     gbbct147.seq
 497104631     gbbct148.seq
 488626816     gbbct149.seq
 487741973     gbbct15.seq
 425698526     gbbct150.seq
 498287386     gbbct151.seq
 489448227     gbbct152.seq
 499735001     gbbct153.seq
 461302578     gbbct154.seq
 495776236     gbbct155.seq
 493829919     gbbct156.seq
 491661245     gbbct157.seq
 498685717     gbbct158.seq
 499806228     gbbct159.seq
 494172943     gbbct16.seq
 147979388     gbbct160.seq
 497197642     gbbct161.seq
 494838868     gbbct162.seq
 493252149     gbbct163.seq
 494938546     gbbct164.seq
 404787642     gbbct165.seq
 489367719     gbbct166.seq
 490447295     gbbct167.seq
 488202089     gbbct168.seq
 496590180     gbbct169.seq
 494426730     gbbct17.seq
 497570965     gbbct170.seq
 443840945     gbbct171.seq
 493068741     gbbct172.seq
 494195818     gbbct173.seq
 496241648     gbbct174.seq
 490190213     gbbct175.seq
 496549067     gbbct176.seq
 496435821     gbbct177.seq
 204323486     gbbct178.seq
 494954589     gbbct179.seq
 128500932     gbbct18.seq
 491514326     gbbct180.seq
 499168832     gbbct181.seq
 486267948     gbbct182.seq
 497456534     gbbct183.seq
 491062036     gbbct184.seq
 495175628     gbbct185.seq
 498913498     gbbct186.seq
  23086762     gbbct187.seq
 493968493     gbbct188.seq
 491061938     gbbct189.seq
 494541128     gbbct19.seq
 494910983     gbbct190.seq
 495985799     gbbct191.seq
 204649716     gbbct192.seq
 493675946     gbbct193.seq
 491173639     gbbct194.seq
 499375502     gbbct195.seq
 273476043     gbbct196.seq
 495005792     gbbct197.seq
 495932756     gbbct198.seq
 489789976     gbbct199.seq
 496211469     gbbct2.seq
 496123472     gbbct20.seq
 303707270     gbbct200.seq
 499227728     gbbct201.seq
 499996866     gbbct202.seq
 495765195     gbbct203.seq
 496021888     gbbct204.seq
  78326746     gbbct205.seq
 498036931     gbbct206.seq
 499411211     gbbct207.seq
 492695626     gbbct208.seq
 498015765     gbbct209.seq
 490072401     gbbct21.seq
 490659469     gbbct210.seq
 223651078     gbbct211.seq
 498767435     gbbct212.seq
 497238753     gbbct213.seq
 494572619     gbbct214.seq
 497330392     gbbct215.seq
 275862694     gbbct216.seq
 495095400     gbbct217.seq
 495971840     gbbct218.seq
 496465165     gbbct219.seq
 499143021     gbbct22.seq
 499477177     gbbct220.seq
 258503230     gbbct221.seq
 499816819     gbbct222.seq
 497425893     gbbct223.seq
 497029407     gbbct224.seq
 497534357     gbbct225.seq
 440229874     gbbct226.seq
 499335068     gbbct227.seq
 499194801     gbbct228.seq
 491641917     gbbct229.seq
 147824787     gbbct23.seq
 492379063     gbbct230.seq
 499896235     gbbct231.seq
 493328722     gbbct232.seq
 411207296     gbbct233.seq
 497109684     gbbct234.seq
 493797230     gbbct235.seq
 496714946     gbbct236.seq
 378276833     gbbct237.seq
 484833405     gbbct238.seq
 495933660     gbbct239.seq
 492482053     gbbct24.seq
 496841588     gbbct240.seq
 499799723     gbbct241.seq
 241101614     gbbct242.seq
 494770125     gbbct243.seq
 490932398     gbbct244.seq
 491178264     gbbct245.seq
 207236528     gbbct246.seq
 493892730     gbbct247.seq
 496233151     gbbct248.seq
 499658512     gbbct249.seq
 490124725     gbbct25.seq
 495112805     gbbct250.seq
 184138816     gbbct251.seq
 494063188     gbbct252.seq
 488281790     gbbct253.seq
 489824750     gbbct254.seq
 488530275     gbbct255.seq
 157432032     gbbct256.seq
 483160902     gbbct257.seq
 493212872     gbbct258.seq
 489922676     gbbct259.seq
 498215112     gbbct26.seq
 495741984     gbbct260.seq
  65305181     gbbct261.seq
 492193975     gbbct262.seq
 487559489     gbbct263.seq
 492444546     gbbct264.seq
 467375865     gbbct265.seq
 498159017     gbbct266.seq
 490705586     gbbct267.seq
 496101821     gbbct268.seq
 494853071     gbbct269.seq
 492065538     gbbct27.seq
 496630909     gbbct270.seq
 145951585     gbbct271.seq
 492031399     gbbct272.seq
 498468936     gbbct273.seq
 484960307     gbbct274.seq
 462509857     gbbct275.seq
 497610369     gbbct276.seq
 496248013     gbbct277.seq
 496576110     gbbct278.seq
 492200318     gbbct279.seq
 484403599     gbbct28.seq
  79411871     gbbct280.seq
 496061714     gbbct281.seq
 492890776     gbbct282.seq
 496405538     gbbct283.seq
 492437479     gbbct284.seq
 491980814     gbbct285.seq
 499779517     gbbct286.seq
 493162864     gbbct287.seq
 301876941     gbbct288.seq
 491163437     gbbct289.seq
  60915698     gbbct29.seq
 488410892     gbbct290.seq
 499068851     gbbct291.seq
 423342833     gbbct292.seq
 497188760     gbbct293.seq
 496648115     gbbct294.seq
 496913431     gbbct295.seq
 469193846     gbbct296.seq
 495339097     gbbct297.seq
 499422165     gbbct298.seq
 499643473     gbbct299.seq
 306959112     gbbct3.seq
 490496973     gbbct30.seq
 499684846     gbbct300.seq
  41768798     gbbct301.seq
 496934493     gbbct302.seq
 495160513     gbbct303.seq
 499828705     gbbct304.seq
 494345225     gbbct305.seq
  96357788     gbbct306.seq
 498905666     gbbct307.seq
 490839498     gbbct308.seq
 495726066     gbbct309.seq
 493807118     gbbct31.seq
 488834247     gbbct310.seq
 499696968     gbbct311.seq
 492931031     gbbct312.seq
 379872740     gbbct313.seq
 492233209     gbbct314.seq
 490787305     gbbct315.seq
 493826685     gbbct316.seq
 499495303     gbbct317.seq
 419419915     gbbct318.seq
 493089434     gbbct319.seq
 480651846     gbbct32.seq
 494093409     gbbct320.seq
 489966741     gbbct321.seq
 493459402     gbbct322.seq
 449948014     gbbct323.seq
 498703691     gbbct324.seq
 497743953     gbbct325.seq
 489574828     gbbct326.seq
 495982538     gbbct327.seq
 498393188     gbbct328.seq
  23849985     gbbct329.seq
 497455838     gbbct33.seq
 498785676     gbbct330.seq
 497116300     gbbct331.seq
 497441848     gbbct332.seq
 497888944     gbbct333.seq
 404359833     gbbct334.seq
 491217193     gbbct335.seq
 490815979     gbbct336.seq
 491231605     gbbct337.seq
 495603062     gbbct338.seq
 499559349     gbbct339.seq
 156444887     gbbct34.seq
 172565087     gbbct340.seq
 495566508     gbbct341.seq
 494438770     gbbct342.seq
 495091042     gbbct343.seq
 498263560     gbbct344.seq
 263588539     gbbct345.seq
 498444518     gbbct346.seq
 488346394     gbbct347.seq
 490825977     gbbct348.seq
 490001722     gbbct349.seq
 489377654     gbbct35.seq
 498584067     gbbct350.seq
  34513818     gbbct351.seq
 494686798     gbbct352.seq
 492315531     gbbct353.seq
 497177727     gbbct354.seq
 498199995     gbbct355.seq
 496450650     gbbct356.seq
 499463041     gbbct357.seq
 496402109     gbbct358.seq
 380192188     gbbct359.seq
 495704414     gbbct36.seq
 497476174     gbbct360.seq
 497184589     gbbct361.seq
 490324854     gbbct362.seq
 499750219     gbbct363.seq
 494815176     gbbct364.seq
 494368852     gbbct365.seq
 296175453     gbbct366.seq
 499934203     gbbct367.seq
 494918531     gbbct368.seq
 499105295     gbbct369.seq
 490766461     gbbct37.seq
 489422027     gbbct370.seq
 497844016     gbbct371.seq
  63763834     gbbct372.seq
 499660340     gbbct373.seq
 493536254     gbbct374.seq
 493525083     gbbct375.seq
 488163956     gbbct376.seq
 499090333     gbbct377.seq
 499519156     gbbct378.seq
 498494475     gbbct379.seq
 495159138     gbbct38.seq
  44978842     gbbct380.seq
 488618104     gbbct381.seq
 499584300     gbbct382.seq
 493277941     gbbct383.seq
 498905652     gbbct384.seq
 239477237     gbbct385.seq
 498252718     gbbct386.seq
 490199157     gbbct387.seq
 491454197     gbbct388.seq
 499237446     gbbct389.seq
 337451479     gbbct39.seq
 169554493     gbbct390.seq
 497759841     gbbct391.seq
 496982352     gbbct392.seq
 499316677     gbbct393.seq
 498214800     gbbct394.seq
 490987737     gbbct395.seq
 494186416     gbbct396.seq
 497216016     gbbct397.seq
  69319885     gbbct398.seq
 497028059     gbbct399.seq
 394752542     gbbct4.seq
 486858968     gbbct40.seq
 489398082     gbbct400.seq
 489177325     gbbct401.seq
 490129819     gbbct402.seq
 492334481     gbbct403.seq
 492637102     gbbct404.seq
 472304767     gbbct405.seq
 489741626     gbbct406.seq
 489855451     gbbct407.seq
 487046951     gbbct408.seq
 487809507     gbbct409.seq
 492482008     gbbct41.seq
 489424692     gbbct410.seq
 285123552     gbbct411.seq
 496006267     gbbct412.seq
 499738718     gbbct413.seq
 498949447     gbbct414.seq
 499696868     gbbct415.seq
 499675367     gbbct416.seq
 493594960     gbbct417.seq
 281241163     gbbct418.seq
 492474236     gbbct419.seq
 497258250     gbbct42.seq
 493348219     gbbct420.seq
 488235737     gbbct421.seq
 499804088     gbbct422.seq
 497607941     gbbct423.seq
 493329202     gbbct424.seq
 489095638     gbbct425.seq
 218287198     gbbct426.seq
 497624057     gbbct427.seq
 499092518     gbbct428.seq
 495168504     gbbct429.seq
 494060590     gbbct43.seq
 498411623     gbbct430.seq
 494851599     gbbct431.seq
  97103164     gbbct432.seq
 484011186     gbbct433.seq
 499765651     gbbct434.seq
 496608341     gbbct435.seq
 492466540     gbbct436.seq
 492815902     gbbct437.seq
 499952027     gbbct438.seq
 486127973     gbbct439.seq
  58042678     gbbct44.seq
 496090339     gbbct440.seq
 496388697     gbbct441.seq
 308316949     gbbct442.seq
 495477408     gbbct443.seq
 492644393     gbbct444.seq
 497637840     gbbct445.seq
 486495877     gbbct446.seq
 411106240     gbbct447.seq
 492341455     gbbct448.seq
 496407771     gbbct449.seq
 499427339     gbbct45.seq
 493158602     gbbct450.seq
 488758804     gbbct451.seq
 164173209     gbbct452.seq
 494159514     gbbct453.seq
 494444974     gbbct454.seq
 493700863     gbbct455.seq
 499969675     gbbct456.seq
  27014882     gbbct457.seq
 493433738     gbbct458.seq
 492700729     gbbct459.seq
 489001589     gbbct46.seq
 497334211     gbbct460.seq
 497146734     gbbct461.seq
 497594285     gbbct462.seq
 328581930     gbbct463.seq
 498313481     gbbct464.seq
 498681405     gbbct465.seq
 499281241     gbbct466.seq
 489146172     gbbct467.seq
 496938154     gbbct468.seq
 497700245     gbbct469.seq
 493930026     gbbct47.seq
 326142728     gbbct470.seq
 497824572     gbbct471.seq
 498555178     gbbct472.seq
 493182743     gbbct473.seq
 494255642     gbbct474.seq
  86825136     gbbct475.seq
 485664252     gbbct476.seq
 492762413     gbbct477.seq
 493976820     gbbct478.seq
 498624920     gbbct479.seq
 422790519     gbbct48.seq
 495051074     gbbct480.seq
 483776187     gbbct481.seq
 492628986     gbbct482.seq
 497575580     gbbct483.seq
 491147927     gbbct484.seq
 495372480     gbbct485.seq
 172098631     gbbct486.seq
 488399361     gbbct487.seq
 497609771     gbbct488.seq
 493602123     gbbct489.seq
 495543359     gbbct49.seq
 499477169     gbbct490.seq
 490837891     gbbct491.seq
 457708752     gbbct492.seq
 494383928     gbbct493.seq
 493402330     gbbct494.seq
 495774412     gbbct495.seq
 498340162     gbbct496.seq
 225256784     gbbct497.seq
 498948470     gbbct498.seq
 493893805     gbbct499.seq
 440879612     gbbct5.seq
 499662279     gbbct50.seq
 495951568     gbbct500.seq
 497906040     gbbct501.seq
  29360100     gbbct502.seq
 499644869     gbbct503.seq
 497721086     gbbct504.seq
 499705912     gbbct505.seq
 497292785     gbbct506.seq
 147178693     gbbct507.seq
 490781428     gbbct508.seq
 491825581     gbbct509.seq
 493083075     gbbct51.seq
 497965134     gbbct510.seq
 493465752     gbbct511.seq
 495756445     gbbct512.seq
 489031295     gbbct513.seq
 324241289     gbbct514.seq
 496815387     gbbct515.seq
 495894736     gbbct516.seq
 496919221     gbbct517.seq
 498915298     gbbct518.seq
 490956192     gbbct519.seq
 494599816     gbbct52.seq
 487289399     gbbct520.seq
 499232971     gbbct521.seq
  20072397     gbbct522.seq
 496504166     gbbct523.seq
 494196865     gbbct524.seq
 491425834     gbbct525.seq
 493795133     gbbct526.seq
 120147859     gbbct527.seq
 495729566     gbbct528.seq
 499951839     gbbct529.seq
 491188426     gbbct53.seq
 491684752     gbbct530.seq
 493977412     gbbct531.seq
 156474307     gbbct532.seq
 489613743     gbbct533.seq
 496013526     gbbct534.seq
 497792053     gbbct535.seq
 492186062     gbbct536.seq
 493342388     gbbct537.seq
 497350400     gbbct538.seq
 493716502     gbbct539.seq
 374593448     gbbct54.seq
 184449731     gbbct540.seq
 490091495     gbbct541.seq
 488287411     gbbct542.seq
 497232585     gbbct543.seq
 494188784     gbbct544.seq
 499784990     gbbct545.seq
 294114374     gbbct546.seq
 498599992     gbbct547.seq
 499966912     gbbct548.seq
 498301065     gbbct549.seq
  21422687     gbbct55.seq
 489056192     gbbct550.seq
 497247067     gbbct551.seq
 182974922     gbbct552.seq
 499605223     gbbct553.seq
 498413363     gbbct554.seq
 494321141     gbbct555.seq
 488737991     gbbct556.seq
 493654191     gbbct557.seq
 492441672     gbbct558.seq
 227319570     gbbct559.seq
  38669395     gbbct56.seq
 489360452     gbbct560.seq
 496232132     gbbct561.seq
 499644022     gbbct562.seq
 499053517     gbbct563.seq
 344855568     gbbct564.seq
 497665663     gbbct565.seq
 498846279     gbbct566.seq
 496910342     gbbct567.seq
 497597094     gbbct568.seq
 490846285     gbbct569.seq
 499533400     gbbct57.seq
 441215744     gbbct570.seq
 499932651     gbbct571.seq
 492753892     gbbct572.seq
 490407067     gbbct573.seq
 497293274     gbbct574.seq
 496382627     gbbct575.seq
  65191689     gbbct576.seq
 491480368     gbbct577.seq
 498032582     gbbct578.seq
 496801977     gbbct579.seq
 484470206     gbbct58.seq
 499998011     gbbct580.seq
 492895223     gbbct581.seq
  84038456     gbbct582.seq
 498299128     gbbct583.seq
 497665413     gbbct584.seq
 495788990     gbbct585.seq
 498920463     gbbct586.seq
 490232308     gbbct587.seq
 497455299     gbbct588.seq
 291276104     gbbct589.seq
 495470250     gbbct59.seq
 499291931     gbbct590.seq
 496184725     gbbct591.seq
 497683754     gbbct592.seq
 494237521     gbbct593.seq
 493055724     gbbct594.seq
 370271817     gbbct595.seq
 496708610     gbbct596.seq
 497463199     gbbct597.seq
 497716036     gbbct598.seq
 499783400     gbbct599.seq
 102348257     gbbct6.seq
 480119338     gbbct60.seq
 498704313     gbbct600.seq
 493520927     gbbct601.seq
 412974908     gbbct602.seq
 497836995     gbbct603.seq
 489654826     gbbct604.seq
 491054702     gbbct605.seq
 497706529     gbbct606.seq
 496583924     gbbct607.seq
 433905257     gbbct608.seq
 495272517     gbbct609.seq
 497462858     gbbct61.seq
 496956179     gbbct610.seq
 488006644     gbbct611.seq
 491473627     gbbct612.seq
 339817851     gbbct613.seq
 494009509     gbbct614.seq
 494634341     gbbct615.seq
 493680575     gbbct616.seq
 495249560     gbbct617.seq
 336973710     gbbct618.seq
 490780670     gbbct619.seq
 491185015     gbbct62.seq
 491958302     gbbct620.seq
 491822313     gbbct621.seq
 497257398     gbbct622.seq
 489363618     gbbct623.seq
 492141132     gbbct624.seq
 492200203     gbbct625.seq
 260293744     gbbct626.seq
 498744205     gbbct627.seq
 496347086     gbbct628.seq
 497967794     gbbct629.seq
 489161828     gbbct63.seq
 499463885     gbbct630.seq
 488319559     gbbct631.seq
 498810393     gbbct632.seq
 492145711     gbbct633.seq
 495613924     gbbct634.seq
 499638486     gbbct635.seq
 497662636     gbbct636.seq
 499056657     gbbct637.seq
 490556366     gbbct638.seq
 172222174     gbbct639.seq
 497807524     gbbct64.seq
 489897247     gbbct640.seq
 498830276     gbbct641.seq
 495980515     gbbct642.seq
 491554835     gbbct643.seq
  72674618     gbbct644.seq
 494346868     gbbct645.seq
 497780954     gbbct646.seq
 488535138     gbbct647.seq
 494050016     gbbct648.seq
 168797561     gbbct649.seq
 499633564     gbbct65.seq
 497477346     gbbct650.seq
 495817018     gbbct651.seq
 491503492     gbbct652.seq
 496790691     gbbct653.seq
 493465897     gbbct654.seq
 154427803     gbbct655.seq
 494999630     gbbct656.seq
 499490465     gbbct657.seq
 499133952     gbbct658.seq
 492174780     gbbct659.seq
 309170151     gbbct66.seq
  59927786     gbbct660.seq
 492651932     gbbct661.seq
 490980127     gbbct662.seq
 489246422     gbbct663.seq
 494834519     gbbct664.seq
 420406296     gbbct665.seq
 494603040     gbbct666.seq
 489081027     gbbct667.seq
 494847372     gbbct668.seq
 490093304     gbbct669.seq
 496358999     gbbct67.seq
 261624146     gbbct670.seq
 492971725     gbbct671.seq
 499137299     gbbct672.seq
 499551483     gbbct673.seq
 494410376     gbbct674.seq
 498268588     gbbct675.seq
 415835033     gbbct676.seq
 498585011     gbbct677.seq
 497874822     gbbct678.seq
 488404604     gbbct679.seq
 491310643     gbbct68.seq
 494091530     gbbct680.seq
 428215526     gbbct681.seq
 495687860     gbbct682.seq
 495588177     gbbct683.seq
 498239790     gbbct684.seq
 489905336     gbbct685.seq
 496000503     gbbct686.seq
 490434408     gbbct687.seq
 497452229     gbbct688.seq
 119869954     gbbct689.seq
 499896947     gbbct69.seq
 489500612     gbbct690.seq
 499400864     gbbct691.seq
 489883836     gbbct692.seq
 491499364     gbbct693.seq
 497510258     gbbct694.seq
 149306247     gbbct695.seq
 489374489     gbbct696.seq
 497451108     gbbct697.seq
 496646071     gbbct698.seq
 493494360     gbbct699.seq
 282572033     gbbct7.seq
 492176821     gbbct70.seq
 384506340     gbbct700.seq
 497699801     gbbct701.seq
 488532823     gbbct702.seq
 498993672     gbbct703.seq
 491309823     gbbct704.seq
 495789131     gbbct705.seq
 499438755     gbbct706.seq
 241823223     gbbct707.seq
 499130242     gbbct708.seq
 496018987     gbbct709.seq
 495817495     gbbct71.seq
 494876442     gbbct710.seq
 493333296     gbbct711.seq
 176769098     gbbct712.seq
 495669235     gbbct713.seq
 496736764     gbbct714.seq
 497827402     gbbct715.seq
 491235709     gbbct716.seq
 265602948     gbbct717.seq
 489239696     gbbct718.seq
 495250207     gbbct719.seq
 356563184     gbbct72.seq
 493352072     gbbct720.seq
 498966757     gbbct721.seq
 498471406     gbbct722.seq
 498901258     gbbct723.seq
 196660176     gbbct724.seq
 491706492     gbbct725.seq
 498111677     gbbct726.seq
 498941051     gbbct727.seq
 494543699     gbbct728.seq
 497093295     gbbct729.seq
 499974849     gbbct73.seq
 434899859     gbbct730.seq
 496927908     gbbct731.seq
 499598277     gbbct732.seq
 498953975     gbbct733.seq
 493546151     gbbct734.seq
 264655339     gbbct735.seq
 493929932     gbbct736.seq
 498576653     gbbct737.seq
 498051138     gbbct738.seq
 499598050     gbbct739.seq
 492293277     gbbct74.seq
 226814321     gbbct740.seq
 493214508     gbbct741.seq
 499473128     gbbct742.seq
 497057368     gbbct743.seq
 498073141     gbbct744.seq
 492530010     gbbct745.seq
 373304570     gbbct746.seq
 492931452     gbbct747.seq
 499054585     gbbct748.seq
 495961434     gbbct749.seq
 489450316     gbbct75.seq
 488839346     gbbct750.seq
 490193012     gbbct751.seq
 495097445     gbbct752.seq
 491337361     gbbct753.seq
  44326502     gbbct754.seq
 495901038     gbbct755.seq
 498190682     gbbct756.seq
 498631363     gbbct757.seq
 495210674     gbbct758.seq
 494312137     gbbct759.seq
 497371783     gbbct76.seq
 422095347     gbbct760.seq
 493723299     gbbct761.seq
 495133538     gbbct762.seq
 493770606     gbbct763.seq
 499816404     gbbct764.seq
 491260349     gbbct765.seq
 135501396     gbbct766.seq
 493624806     gbbct767.seq
 497074565     gbbct768.seq
 491638513     gbbct769.seq
 499930534     gbbct77.seq
 491398441     gbbct770.seq
 497776093     gbbct771.seq
  97161375     gbbct772.seq
 489321030     gbbct773.seq
 495369845     gbbct774.seq
 497052695     gbbct775.seq
 493966712     gbbct776.seq
 489770098     gbbct777.seq
 482146385     gbbct778.seq
 168002730     gbbct779.seq
 495180673     gbbct78.seq
 488237338     gbbct780.seq
 491055058     gbbct781.seq
 498608451     gbbct782.seq
 490862913     gbbct783.seq
  50742391     gbbct784.seq
 495137429     gbbct785.seq
 497388216     gbbct786.seq
 494078934     gbbct787.seq
 486947798     gbbct788.seq
  61664599     gbbct789.seq
 112142536     gbbct79.seq
 495181148     gbbct790.seq
 499983744     gbbct791.seq
 499992737     gbbct792.seq
 497620055     gbbct793.seq
 118340553     gbbct794.seq
 495637220     gbbct795.seq
 498318396     gbbct796.seq
 493687124     gbbct797.seq
 498432387     gbbct798.seq
 492531847     gbbct799.seq
 493056976     gbbct8.seq
 498097184     gbbct80.seq
  10759305     gbbct800.seq
 490139097     gbbct801.seq
 490649351     gbbct802.seq
 491077104     gbbct803.seq
 495146591     gbbct804.seq
 408836248     gbbct805.seq
 485148521     gbbct806.seq
 494024559     gbbct807.seq
 489734774     gbbct808.seq
 492395486     gbbct809.seq
 499071354     gbbct81.seq
 499136519     gbbct810.seq
 395449344     gbbct811.seq
 494280463     gbbct812.seq
 496563528     gbbct813.seq
 490569478     gbbct814.seq
 492634217     gbbct815.seq
 492508925     gbbct816.seq
 489669016     gbbct817.seq
 259053126     gbbct818.seq
 499699778     gbbct819.seq
 496564068     gbbct82.seq
 499470694     gbbct820.seq
 487124043     gbbct821.seq
 499771665     gbbct822.seq
 493916662     gbbct823.seq
 489975982     gbbct824.seq
 495302528     gbbct825.seq
 489143764     gbbct826.seq
 491329628     gbbct827.seq
 489310048     gbbct828.seq
 154290448     gbbct829.seq
 497567986     gbbct83.seq
 493691158     gbbct830.seq
 499800144     gbbct831.seq
 494526353     gbbct832.seq
 492584263     gbbct833.seq
 320362923     gbbct834.seq
 495800385     gbbct835.seq
 495835117     gbbct836.seq
 488652626     gbbct837.seq
 498567203     gbbct838.seq
 440911501     gbbct839.seq
 499752697     gbbct84.seq
 492296402     gbbct840.seq
 493901091     gbbct841.seq
 496990977     gbbct842.seq
 489620902     gbbct843.seq
 499845137     gbbct844.seq
 436841727     gbbct845.seq
 474769897     gbbct846.seq
 496794985     gbbct847.seq
 494091622     gbbct848.seq
 498354253     gbbct849.seq
 490382204     gbbct85.seq
 457546243     gbbct850.seq
 495715598     gbbct851.seq
 498183833     gbbct852.seq
 492560882     gbbct853.seq
 491604347     gbbct854.seq
 456561787     gbbct855.seq
 494469365     gbbct856.seq
 496568308     gbbct857.seq
 491614435     gbbct858.seq
 499127745     gbbct859.seq
 257413042     gbbct86.seq
 489216850     gbbct860.seq
 258850135     gbbct861.seq
 496858570     gbbct862.seq
 499643243     gbbct863.seq
 487925663     gbbct864.seq
 494253837     gbbct865.seq
 104640122     gbbct866.seq
 499038096     gbbct867.seq
 492975664     gbbct868.seq
 489173802     gbbct869.seq
 499969489     gbbct87.seq
 490198972     gbbct870.seq
 495933101     gbbct871.seq
 497400050     gbbct872.seq
 269812405     gbbct873.seq
 491405665     gbbct874.seq
 497174740     gbbct875.seq
 496243912     gbbct876.seq
 482860152     gbbct877.seq
 482234133     gbbct878.seq
 493200512     gbbct879.seq
 495193976     gbbct88.seq
 493832931     gbbct880.seq
 492694305     gbbct881.seq
 490062186     gbbct882.seq
 493175540     gbbct883.seq
  33290777     gbbct884.seq
 499792984     gbbct885.seq
 496021250     gbbct886.seq
 488745868     gbbct887.seq
 498935238     gbbct888.seq
 493584390     gbbct889.seq
 486287671     gbbct89.seq
  14157685     gbbct890.seq
 493975631     gbbct891.seq
 493522579     gbbct892.seq
 499788530     gbbct893.seq
 495629202     gbbct894.seq
 273212962     gbbct895.seq
 485227533     gbbct896.seq
 485133554     gbbct897.seq
 490670164     gbbct898.seq
 491086294     gbbct899.seq
 493341809     gbbct9.seq
 493211142     gbbct90.seq
 128478302     gbbct900.seq
 491289362     gbbct901.seq
 498033206     gbbct902.seq
 494317973     gbbct903.seq
 491272581     gbbct904.seq
 157704733     gbbct905.seq
 491551097     gbbct906.seq
 499800934     gbbct907.seq
 489184376     gbbct908.seq
 496404084     gbbct909.seq
 464468094     gbbct91.seq
 497385180     gbbct910.seq
 492361979     gbbct911.seq
 175428718     gbbct912.seq
 305004800     gbbct913.seq
   6890459     gbbct914.seq
  14163645     gbbct915.seq
  22793654     gbbct916.seq
  44488137     gbbct917.seq
  86611667     gbbct918.seq
 168488704     gbbct919.seq
 490192791     gbbct92.seq
 499999500     gbbct920.seq
 492427104     gbbct921.seq
 498178021     gbbct922.seq
 499250160     gbbct923.seq
 498145387     gbbct924.seq
 499998524     gbbct925.seq
 131025386     gbbct926.seq
 499998809     gbbct927.seq
 492645133     gbbct928.seq
 494513734     gbbct929.seq
 489868611     gbbct93.seq
 499969851     gbbct930.seq
 208742725     gbbct931.seq
 499997648     gbbct932.seq
 290424762     gbbct933.seq
 500000079     gbbct934.seq
  85279029     gbbct935.seq
 499983430     gbbct936.seq
 125215102     gbbct937.seq
 499998328     gbbct938.seq
  43521552     gbbct939.seq
 497985073     gbbct94.seq
 148181971     gbbct940.seq
 498604555     gbbct941.seq
 496959397     gbbct942.seq
  91325510     gbbct943.seq
 497083712     gbbct944.seq
 489910050     gbbct945.seq
 494007425     gbbct946.seq
 497933106     gbbct947.seq
 497254622     gbbct948.seq
 488464409     gbbct949.seq
 498936947     gbbct95.seq
 305471125     gbbct950.seq
 495496652     gbbct951.seq
 498006019     gbbct952.seq
 498178008     gbbct953.seq
 168612703     gbbct954.seq
 472461247     gbbct955.seq
 498353053     gbbct956.seq
 494354808     gbbct957.seq
 496897141     gbbct958.seq
 150527797     gbbct959.seq
 306897241     gbbct96.seq
 487524044     gbbct960.seq
 499384856     gbbct961.seq
 499022760     gbbct962.seq
 267916234     gbbct963.seq
 498499361     gbbct964.seq
 497461802     gbbct965.seq
 480796819     gbbct966.seq
 497715134     gbbct967.seq
  50153913     gbbct968.seq
 496306792     gbbct969.seq
 491474485     gbbct97.seq
 497541980     gbbct970.seq
 499039279     gbbct971.seq
 243471059     gbbct972.seq
 492627297     gbbct973.seq
 496920896     gbbct974.seq
 498726004     gbbct975.seq
 498558094     gbbct976.seq
 105681493     gbbct977.seq
 499379829     gbbct978.seq
 499045535     gbbct979.seq
 494310549     gbbct98.seq
 496138154     gbbct980.seq
 480916994     gbbct981.seq
  51240681     gbbct982.seq
 107869028     gbbct983.seq
 499999998     gbbct984.seq
 499999974     gbbct985.seq
 418807389     gbbct986.seq
 499932097     gbbct987.seq
 498970394     gbbct988.seq
 499998500     gbbct989.seq
 495814627     gbbct99.seq
 499997878     gbbct990.seq
 496380139     gbbct991.seq
  43259231     gbbct992.seq
 494019029     gbbct993.seq
 489527894     gbbct994.seq
 499850837     gbbct995.seq
 493961341     gbbct996.seq
 497301388     gbbct997.seq
 489872293     gbbct998.seq
 176217546     gbbct999.seq
    543458     gbchg.txt
 499986801     gbcon1.seq
 499936780     gbcon10.seq
 499998763     gbcon100.seq
 266690984     gbcon101.seq
 499999207     gbcon102.seq
 499999760     gbcon103.seq
 169651221     gbcon104.seq
 498619715     gbcon105.seq
 497622218     gbcon106.seq
 499996912     gbcon107.seq
 499957642     gbcon108.seq
 298259760     gbcon109.seq
 498641897     gbcon11.seq
 499974130     gbcon110.seq
 499998492     gbcon111.seq
 301832536     gbcon112.seq
 499999499     gbcon113.seq
 499999492     gbcon114.seq
 132527703     gbcon115.seq
 499884760     gbcon116.seq
 499998115     gbcon117.seq
 499871951     gbcon118.seq
 277072431     gbcon119.seq
 499918621     gbcon12.seq
 499999876     gbcon120.seq
 499999395     gbcon121.seq
 222253215     gbcon122.seq
  45836617     gbcon123.seq
 499997550     gbcon124.seq
 499997048     gbcon125.seq
 447038623     gbcon126.seq
 500000180     gbcon127.seq
 500000159     gbcon128.seq
 500000149     gbcon129.seq
 498805320     gbcon13.seq
 196167796     gbcon130.seq
 499995599     gbcon131.seq
 499999036     gbcon132.seq
 238748401     gbcon133.seq
 499998325     gbcon134.seq
 467661972     gbcon135.seq
 499999914     gbcon136.seq
 499998953     gbcon137.seq
 260268367     gbcon138.seq
 499999998     gbcon139.seq
 498700127     gbcon14.seq
 499999247     gbcon140.seq
 498207713     gbcon141.seq
 499999536     gbcon142.seq
 499996334     gbcon143.seq
 179609408     gbcon144.seq
 499998259     gbcon145.seq
 499998534     gbcon146.seq
  23267891     gbcon147.seq
 499895508     gbcon148.seq
 499998608     gbcon149.seq
 497489318     gbcon15.seq
 410312685     gbcon150.seq
 499990000     gbcon151.seq
 499984769     gbcon152.seq
 378760506     gbcon153.seq
 499995981     gbcon154.seq
 499995750     gbcon155.seq
 265279813     gbcon156.seq
 499999808     gbcon157.seq
 499998096     gbcon158.seq
  78092623     gbcon159.seq
 170068320     gbcon16.seq
 500000141     gbcon160.seq
 499756967     gbcon161.seq
 499997753     gbcon162.seq
 143068669     gbcon163.seq
 499889851     gbcon164.seq
 499990720     gbcon165.seq
 499985012     gbcon166.seq
 336382862     gbcon167.seq
 499997937     gbcon168.seq
 499999984     gbcon169.seq
 494906768     gbcon17.seq
 188501739     gbcon170.seq
 499998956     gbcon171.seq
 499998775     gbcon172.seq
 499998835     gbcon173.seq
 274172100     gbcon174.seq
 499999711     gbcon175.seq
 499998667     gbcon176.seq
 499614792     gbcon177.seq
 499997930     gbcon178.seq
 146641660     gbcon179.seq
 496941073     gbcon18.seq
 499999965     gbcon180.seq
 499997467     gbcon181.seq
 135137207     gbcon182.seq
 499997148     gbcon183.seq
 499996990     gbcon184.seq
 499999297     gbcon185.seq
 299155059     gbcon186.seq
 499967446     gbcon187.seq
 499998122     gbcon188.seq
 474669064     gbcon189.seq
 497062972     gbcon19.seq
 499996896     gbcon190.seq
 499991545     gbcon191.seq
 380634045     gbcon192.seq
 499914217     gbcon193.seq
 499999252     gbcon194.seq
 499993655     gbcon195.seq
 139298938     gbcon196.seq
 499998392     gbcon197.seq
 499997881     gbcon198.seq
  38637152     gbcon199.seq
 499999147     gbcon2.seq
 498554874     gbcon20.seq
 499998672     gbcon200.seq
 499998964     gbcon201.seq
 499991855     gbcon202.seq
 500000032     gbcon203.seq
 499993734     gbcon204.seq
 277693297     gbcon205.seq
 499999940     gbcon206.seq
 484917287     gbcon207.seq
 499989577     gbcon208.seq
 499922342     gbcon209.seq
 493805871     gbcon21.seq
 499997656     gbcon210.seq
   4041174     gbcon211.seq
 499999381     gbcon212.seq
 499999019     gbcon213.seq
 499997621     gbcon214.seq
  13869368     gbcon215.seq
 499960644     gbcon216.seq
 499977895     gbcon217.seq
 499998549     gbcon218.seq
 276951509     gbcon219.seq
 499998788     gbcon22.seq
 499898553     gbcon220.seq
 499856643     gbcon221.seq
 499991808     gbcon222.seq
 290885094     gbcon223.seq
 499887467     gbcon224.seq
 499999255     gbcon225.seq
 499688252     gbcon226.seq
 345759611     gbcon227.seq
 499678868     gbcon228.seq
 499918621     gbcon229.seq
 499998935     gbcon23.seq
 499999897     gbcon230.seq
 149584141     gbcon231.seq
 499755037     gbcon232.seq
 499999155     gbcon233.seq
 499992704     gbcon234.seq
 498738705     gbcon235.seq
  39118816     gbcon236.seq
 499999534     gbcon24.seq
  84517707     gbcon25.seq
 499999901     gbcon26.seq
 499494513     gbcon27.seq
 498850599     gbcon28.seq
 318196954     gbcon29.seq
 499998934     gbcon3.seq
 499998397     gbcon30.seq
 135784709     gbcon31.seq
 126581536     gbcon32.seq
 499918920     gbcon33.seq
 499998468     gbcon34.seq
  27859502     gbcon35.seq
 499999414     gbcon36.seq
 499998297     gbcon37.seq
 444125732     gbcon38.seq
 499999754     gbcon39.seq
 106336744     gbcon4.seq
 499996186     gbcon40.seq
 499996876     gbcon41.seq
  43314086     gbcon42.seq
 499997302     gbcon43.seq
 499996762     gbcon44.seq
 278164332     gbcon45.seq
 499999359     gbcon46.seq
 499996983     gbcon47.seq
 271759840     gbcon48.seq
 499993774     gbcon49.seq
 499940282     gbcon5.seq
 499997972     gbcon50.seq
 386626626     gbcon51.seq
 499998746     gbcon52.seq
 499998567     gbcon53.seq
 177827600     gbcon54.seq
 499999775     gbcon55.seq
 499998019     gbcon56.seq
 240103744     gbcon57.seq
 499999949     gbcon58.seq
 499999067     gbcon59.seq
 494454779     gbcon6.seq
 337031547     gbcon60.seq
 499998864     gbcon61.seq
 499994811     gbcon62.seq
 299682797     gbcon63.seq
 500000005     gbcon64.seq
 499997545     gbcon65.seq
 261117917     gbcon66.seq
 499995467     gbcon67.seq
 499999403     gbcon68.seq
 188551188     gbcon69.seq
 494751662     gbcon7.seq
 499996910     gbcon70.seq
 499996842     gbcon71.seq
 365761631     gbcon72.seq
 499997884     gbcon73.seq
 499996070     gbcon74.seq
 387269601     gbcon75.seq
 499993101     gbcon76.seq
 473419617     gbcon77.seq
 174082386     gbcon78.seq
 499962637     gbcon79.seq
 499999694     gbcon8.seq
  23946021     gbcon80.seq
 499992212     gbcon81.seq
 205225187     gbcon82.seq
 199581426     gbcon83.seq
 499973462     gbcon84.seq
 499997159     gbcon85.seq
 338361276     gbcon86.seq
 499606703     gbcon87.seq
 495956208     gbcon88.seq
 499889427     gbcon89.seq
  61944694     gbcon9.seq
 205299811     gbcon90.seq
 499944761     gbcon91.seq
 499999482     gbcon92.seq
 499726999     gbcon93.seq
 167922790     gbcon94.seq
 499999726     gbcon95.seq
 500000232     gbcon96.seq
 131866331     gbcon97.seq
 499990588     gbcon98.seq
 499997926     gbcon99.seq
      3558     gbdel.txt
 499999545     gbenv1.seq
 489563299     gbenv10.seq
 488496156     gbenv11.seq
 495290854     gbenv12.seq
 499997285     gbenv13.seq
 499997873     gbenv14.seq
 137067780     gbenv15.seq
 499997409     gbenv16.seq
 499999065     gbenv17.seq
  53927371     gbenv18.seq
 499999736     gbenv19.seq
 499998007     gbenv2.seq
 499998805     gbenv20.seq
 499999105     gbenv21.seq
 499996813     gbenv22.seq
   5221860     gbenv23.seq
 499999841     gbenv24.seq
 499999757     gbenv25.seq
 190623249     gbenv26.seq
 499981979     gbenv27.seq
 499999039     gbenv28.seq
 499998075     gbenv29.seq
 451582703     gbenv3.seq
  84235590     gbenv30.seq
 499999034     gbenv31.seq
 499998359     gbenv32.seq
 177743594     gbenv33.seq
 499999437     gbenv34.seq
 500000014     gbenv35.seq
 500000054     gbenv36.seq
  46472037     gbenv37.seq
 499998882     gbenv38.seq
 499999649     gbenv39.seq
 498295082     gbenv4.seq
 192871048     gbenv40.seq
 499998774     gbenv41.seq
 499999748     gbenv42.seq
 334979996     gbenv43.seq
 499999648     gbenv44.seq
 499997825     gbenv45.seq
 471553295     gbenv46.seq
 499997816     gbenv47.seq
 499999138     gbenv48.seq
 338694889     gbenv49.seq
 497343821     gbenv5.seq
 499999617     gbenv50.seq
 499999506     gbenv51.seq
 394550521     gbenv52.seq
 499999787     gbenv53.seq
 499999025     gbenv54.seq
 345572429     gbenv55.seq
 499999527     gbenv56.seq
 499999749     gbenv57.seq
 237998882     gbenv58.seq
 499999902     gbenv59.seq
 498155658     gbenv6.seq
 499997995     gbenv60.seq
 391430762     gbenv61.seq
 499998348     gbenv62.seq
 499982443     gbenv63.seq
 499998633     gbenv64.seq
 147286904     gbenv65.seq
 499998329     gbenv66.seq
 500000046     gbenv67.seq
 499999130     gbenv68.seq
 222942139     gbenv69.seq
 499147378     gbenv7.seq
 499997516     gbenv70.seq
 499899689     gbenv71.seq
 314860173     gbenv72.seq
 499974846     gbenv73.seq
 499999981     gbenv74.seq
 473976246     gbenv75.seq
 499998842     gbenv76.seq
 494665858     gbenv77.seq
 497108417     gbenv78.seq
 379102778     gbenv79.seq
 102354062     gbenv8.seq
 497122399     gbenv9.seq
 499999886     gbest1.seq
 499999635     gbest10.seq
 499997424     gbest100.seq
 500000102     gbest101.seq
 499997928     gbest102.seq
 499999586     gbest103.seq
  27058254     gbest104.seq
 499996554     gbest105.seq
 499997290     gbest106.seq
 499999575     gbest107.seq
 499999528     gbest108.seq
   9862063     gbest109.seq
 499997770     gbest11.seq
 500000213     gbest110.seq
 499997713     gbest111.seq
 499998641     gbest112.seq
 499999145     gbest113.seq
  21766373     gbest114.seq
 500000014     gbest115.seq
 499999751     gbest116.seq
 499996861     gbest117.seq
  18205696     gbest118.seq
 499998016     gbest119.seq
 475347609     gbest12.seq
 499998546     gbest120.seq
 499997661     gbest121.seq
  69242600     gbest122.seq
 499997996     gbest123.seq
 499996364     gbest124.seq
 223780385     gbest125.seq
 499997461     gbest126.seq
 499998633     gbest127.seq
 195307357     gbest128.seq
 499997173     gbest129.seq
 499999099     gbest13.seq
 499998792     gbest130.seq
 499995025     gbest131.seq
 499996839     gbest132.seq
  85321549     gbest133.seq
 499999011     gbest134.seq
 500000103     gbest135.seq
 499997620     gbest136.seq
 499998847     gbest137.seq
 103557175     gbest138.seq
 499999885     gbest139.seq
 249985067     gbest14.seq
 499996904     gbest140.seq
 500000218     gbest141.seq
 499998495     gbest142.seq
  28439876     gbest143.seq
 499998499     gbest144.seq
 499995866     gbest145.seq
 499997128     gbest146.seq
 499998371     gbest147.seq
  30830682     gbest148.seq
 499998615     gbest149.seq
 499998470     gbest15.seq
 500000160     gbest150.seq
 499997750     gbest151.seq
 324374809     gbest152.seq
 499997344     gbest153.seq
 499999008     gbest154.seq
 499996792     gbest155.seq
 499998093     gbest156.seq
  26483164     gbest157.seq
 500000031     gbest158.seq
 499999571     gbest159.seq
 499998407     gbest16.seq
 499998740     gbest160.seq
 499999772     gbest161.seq
  11191143     gbest162.seq
 499999738     gbest163.seq
 499999513     gbest164.seq
 499999792     gbest165.seq
 499998438     gbest166.seq
  86376407     gbest167.seq
 500000180     gbest168.seq
 499996624     gbest169.seq
 421197303     gbest17.seq
 499997982     gbest170.seq
 499996832     gbest171.seq
 120388331     gbest172.seq
 499998796     gbest173.seq
 499999076     gbest174.seq
 500000124     gbest175.seq
 500000114     gbest176.seq
  65991139     gbest177.seq
 499999609     gbest178.seq
 403619645     gbest179.seq
 500000212     gbest18.seq
 500000063     gbest180.seq
 500000137     gbest181.seq
 499998032     gbest182.seq
 499996516     gbest183.seq
  42970207     gbest184.seq
 499999115     gbest185.seq
 499999094     gbest186.seq
 499999271     gbest187.seq
 499997793     gbest188.seq
  42245476     gbest189.seq
 499997392     gbest19.seq
 499998700     gbest190.seq
 499999296     gbest191.seq
 499999092     gbest192.seq
 500000084     gbest193.seq
  11591845     gbest194.seq
 499996962     gbest195.seq
 499998729     gbest196.seq
 499997401     gbest197.seq
 499998525     gbest198.seq
  28665019     gbest199.seq
 499997555     gbest2.seq
 262827667     gbest20.seq
 499998890     gbest200.seq
 499999939     gbest201.seq
 500000077     gbest202.seq
 499998043     gbest203.seq
  34247817     gbest204.seq
  13610371     gbest205.seq
 499997133     gbest206.seq
 499998950     gbest207.seq
 329518743     gbest208.seq
 499997954     gbest209.seq
 499999305     gbest21.seq
 500000064     gbest210.seq
 321738245     gbest211.seq
 499999454     gbest212.seq
 499997334     gbest213.seq
 267676365     gbest214.seq
 499997450     gbest215.seq
 499999542     gbest216.seq
 270148029     gbest217.seq
 499996173     gbest218.seq
 499998682     gbest219.seq
 499998133     gbest22.seq
 499996701     gbest220.seq
 500000034     gbest221.seq
  52041103     gbest222.seq
 499999123     gbest223.seq
 499996186     gbest224.seq
 499998911     gbest225.seq
 499997023     gbest226.seq
  47688177     gbest227.seq
 499998310     gbest228.seq
 499999275     gbest229.seq
 244498539     gbest23.seq
 176584566     gbest230.seq
 500000143     gbest231.seq
 499999766     gbest232.seq
 499999388     gbest233.seq
 478350574     gbest234.seq
 499997785     gbest235.seq
 499999603     gbest236.seq
 499997429     gbest237.seq
 462328784     gbest238.seq
 499999067     gbest239.seq
 499997973     gbest24.seq
 499999466     gbest240.seq
 499997812     gbest241.seq
 495965189     gbest242.seq
 499999965     gbest243.seq
 499998071     gbest244.seq
 499999534     gbest245.seq
 499997094     gbest246.seq
  25247852     gbest247.seq
 499999885     gbest248.seq
 499998834     gbest249.seq
 500000249     gbest25.seq
 497204590     gbest250.seq
 499999018     gbest251.seq
 499998363     gbest252.seq
 499998003     gbest253.seq
 499998855     gbest254.seq
  21635727     gbest255.seq
 499997327     gbest256.seq
 499995735     gbest257.seq
 499995987     gbest258.seq
 499999920     gbest259.seq
 499999489     gbest26.seq
  76725347     gbest260.seq
 499998298     gbest261.seq
 499998862     gbest262.seq
 499999803     gbest263.seq
 499999748     gbest264.seq
  15153140     gbest265.seq
 499999709     gbest266.seq
 499999528     gbest267.seq
 499996240     gbest268.seq
 499999976     gbest269.seq
 500000205     gbest27.seq
  61175538     gbest270.seq
 499998700     gbest271.seq
 499999812     gbest272.seq
 499998613     gbest273.seq
 122786557     gbest274.seq
 499996420     gbest275.seq
 499996347     gbest276.seq
 499996697     gbest277.seq
 499997998     gbest278.seq
  54096018     gbest279.seq
  49054642     gbest28.seq
 499997300     gbest280.seq
 499998093     gbest281.seq
 499998043     gbest282.seq
 499998230     gbest283.seq
  57212436     gbest284.seq
 499999206     gbest285.seq
 499999297     gbest286.seq
 499995779     gbest287.seq
 499998776     gbest288.seq
  12647131     gbest289.seq
 499998393     gbest29.seq
 500000262     gbest290.seq
 499999019     gbest291.seq
 499998375     gbest292.seq
 499998356     gbest293.seq
  25130664     gbest294.seq
 499999905     gbest295.seq
 499999169     gbest296.seq
 485346130     gbest297.seq
 499998242     gbest298.seq
 499997484     gbest299.seq
 499998861     gbest3.seq
 499999804     gbest30.seq
 499999992     gbest300.seq
 499999761     gbest301.seq
   5975334     gbest302.seq
 499998628     gbest303.seq
 499998004     gbest304.seq
 499998183     gbest305.seq
 499998614     gbest306.seq
   8752709     gbest307.seq
 499999082     gbest308.seq
 499999747     gbest309.seq
 499997642     gbest31.seq
 499997747     gbest310.seq
 425300390     gbest311.seq
 499998617     gbest312.seq
 499998547     gbest313.seq
 499997281     gbest314.seq
 499998682     gbest315.seq
   2054700     gbest316.seq
 499999089     gbest317.seq
 499999575     gbest318.seq
 469366010     gbest319.seq
 487083596     gbest32.seq
 499999477     gbest320.seq
 499998262     gbest321.seq
 499999719     gbest322.seq
 499998371     gbest323.seq
  40423642     gbest324.seq
 499997688     gbest325.seq
 499998667     gbest326.seq
 499998460     gbest327.seq
 494327711     gbest328.seq
 499998307     gbest329.seq
 499996778     gbest33.seq
 499998827     gbest330.seq
 499998018     gbest331.seq
 499996993     gbest332.seq
  57561412     gbest333.seq
 500000164     gbest334.seq
 500000124     gbest335.seq
 499998630     gbest336.seq
 469710586     gbest337.seq
 499996848     gbest338.seq
 499997513     gbest339.seq
 499998706     gbest34.seq
 499999142     gbest340.seq
 499997218     gbest341.seq
  19777362     gbest342.seq
 499997920     gbest343.seq
 493650648     gbest344.seq
 499997344     gbest345.seq
 499998393     gbest346.seq
 500000034     gbest347.seq
 500000073     gbest348.seq
   7042931     gbest349.seq
 500000165     gbest35.seq
 499999575     gbest350.seq
 499999980     gbest351.seq
 499999578     gbest352.seq
 445507381     gbest353.seq
 499999670     gbest354.seq
 499999568     gbest355.seq
 500000244     gbest356.seq
 385830792     gbest357.seq
 499999372     gbest358.seq
 499999677     gbest359.seq
 465822601     gbest36.seq
 499998309     gbest360.seq
 499997583     gbest361.seq
  23515852     gbest362.seq
 499999898     gbest363.seq
 499999146     gbest364.seq
 499998699     gbest365.seq
 500000175     gbest366.seq
  60455485     gbest367.seq
 166258344     gbest368.seq
 499999253     gbest369.seq
 500000221     gbest37.seq
 499999145     gbest370.seq
 499997410     gbest371.seq
 499999501     gbest372.seq
  87762815     gbest373.seq
 499997252     gbest374.seq
 499999865     gbest375.seq
 499999625     gbest376.seq
 499998195     gbest377.seq
 167172696     gbest378.seq
 499996810     gbest379.seq
 499998451     gbest38.seq
 499998009     gbest380.seq
 499999556     gbest381.seq
 500000106     gbest382.seq
 155202666     gbest383.seq
 499997530     gbest384.seq
 499998520     gbest385.seq
 499999295     gbest386.seq
 496942011     gbest387.seq
 499998244     gbest388.seq
 499997393     gbest389.seq
 499999976     gbest39.seq
 499997868     gbest390.seq
  68565600     gbest391.seq
 499998199     gbest392.seq
 499995697     gbest393.seq
 499997473     gbest394.seq
 499998850     gbest395.seq
  84720974     gbest396.seq
 499996726     gbest397.seq
 499997638     gbest398.seq
 499999194     gbest399.seq
 434902865     gbest4.seq
 499997651     gbest40.seq
 499999980     gbest400.seq
  88024158     gbest401.seq
 499997789     gbest402.seq
 499998566     gbest403.seq
 499999548     gbest404.seq
 499998233     gbest405.seq
  49239860     gbest406.seq
 499999872     gbest407.seq
 499999311     gbest408.seq
 499999930     gbest409.seq
 191428295     gbest41.seq
 499999455     gbest410.seq
  89134158     gbest411.seq
 499999602     gbest412.seq
 499998388     gbest413.seq
 499996769     gbest414.seq
 499993591     gbest415.seq
 124887049     gbest416.seq
 499997121     gbest417.seq
 328041859     gbest418.seq
 499997537     gbest419.seq
 499997364     gbest42.seq
 499999392     gbest420.seq
 499999368     gbest421.seq
 499999290     gbest422.seq
  60418424     gbest423.seq
 499999712     gbest424.seq
 499999639     gbest425.seq
 499997596     gbest426.seq
 410464048     gbest427.seq
 499997260     gbest428.seq
 499999283     gbest429.seq
 499997237     gbest43.seq
 335979604     gbest430.seq
 499997448     gbest431.seq
 500000055     gbest432.seq
 261735757     gbest433.seq
 499999054     gbest434.seq
 499999565     gbest435.seq
 457029835     gbest436.seq
 499997677     gbest437.seq
 499997592     gbest438.seq
 305631978     gbest439.seq
 499997245     gbest44.seq
 499996212     gbest440.seq
 499998106     gbest441.seq
 336207493     gbest442.seq
 499998798     gbest443.seq
 499999337     gbest444.seq
 188594473     gbest445.seq
 499998567     gbest446.seq
 499997513     gbest447.seq
 120724820     gbest448.seq
 499998099     gbest449.seq
 499996431     gbest45.seq
 499998378     gbest450.seq
 144958145     gbest451.seq
 499997877     gbest452.seq
 499999922     gbest453.seq
 146697887     gbest454.seq
 499998626     gbest455.seq
 499997991     gbest456.seq
 499998447     gbest457.seq
 499999530     gbest458.seq
    619778     gbest459.seq
 189558363     gbest46.seq
 499999562     gbest460.seq
 499998109     gbest461.seq
 500000069     gbest462.seq
 499998851     gbest463.seq
  23493823     gbest464.seq
 170019681     gbest465.seq
 499998234     gbest466.seq
 499997948     gbest467.seq
 499998330     gbest468.seq
 499998840     gbest469.seq
 499999360     gbest47.seq
  28589640     gbest470.seq
 499999508     gbest471.seq
 499999012     gbest472.seq
 499998631     gbest473.seq
 499997270     gbest474.seq
  68554444     gbest475.seq
 499997202     gbest476.seq
 499997120     gbest477.seq
 499997133     gbest478.seq
 499996553     gbest479.seq
 499998265     gbest48.seq
  58819344     gbest480.seq
 499997522     gbest481.seq
 499997564     gbest482.seq
 499997692     gbest483.seq
 499998314     gbest484.seq
  36875050     gbest485.seq
 499997365     gbest486.seq
 499997555     gbest487.seq
 499999144     gbest488.seq
 500000134     gbest489.seq
 499997971     gbest49.seq
  74693787     gbest490.seq
 499999195     gbest491.seq
 499999368     gbest492.seq
 499998525     gbest493.seq
 208394234     gbest494.seq
 499996334     gbest495.seq
 499999918     gbest496.seq
 499998673     gbest497.seq
 499998447     gbest498.seq
  93716532     gbest499.seq
 499999604     gbest5.seq
 477020055     gbest50.seq
 499998191     gbest500.seq
 499999459     gbest501.seq
 499997038     gbest502.seq
 499995086     gbest503.seq
  57685887     gbest504.seq
 499995678     gbest505.seq
 499998789     gbest506.seq
 499992702     gbest507.seq
 499997565     gbest508.seq
 144035608     gbest509.seq
 499999137     gbest51.seq
 499998165     gbest510.seq
 499996677     gbest511.seq
 499997275     gbest512.seq
 499999280     gbest513.seq
 144813181     gbest514.seq
 499998357     gbest515.seq
 499999868     gbest516.seq
 499998966     gbest517.seq
 499997659     gbest518.seq
  20752530     gbest519.seq
 356399962     gbest52.seq
 174271459     gbest520.seq
 500000045     gbest521.seq
 500000167     gbest522.seq
  86404104     gbest523.seq
 499998243     gbest524.seq
 499999107     gbest525.seq
  76884582     gbest526.seq
 499999644     gbest527.seq
 499999397     gbest528.seq
 499997123     gbest529.seq
 499997197     gbest53.seq
 499996576     gbest530.seq
 101183181     gbest531.seq
 499998563     gbest532.seq
 499999862     gbest533.seq
 499998938     gbest534.seq
 499999923     gbest535.seq
  11156072     gbest536.seq
 499998167     gbest537.seq
 499998641     gbest538.seq
 499997727     gbest539.seq
 499999759     gbest54.seq
 478138570     gbest540.seq
 499999636     gbest541.seq
 499999141     gbest542.seq
 499997428     gbest543.seq
 418221001     gbest544.seq
 499999742     gbest545.seq
 500000106     gbest546.seq
 499999793     gbest547.seq
 499998376     gbest548.seq
  83233267     gbest549.seq
 499997752     gbest55.seq
 499999613     gbest550.seq
 499999398     gbest551.seq
 499999882     gbest552.seq
 499997233     gbest553.seq
  32975971     gbest554.seq
 499996586     gbest555.seq
 499998720     gbest556.seq
 499999177     gbest557.seq
 499997099     gbest558.seq
  44533458     gbest559.seq
 483694647     gbest56.seq
 499998311     gbest560.seq
 499999739     gbest561.seq
 499998866     gbest562.seq
 499999777     gbest563.seq
  12024764     gbest564.seq
 499997844     gbest565.seq
 499998568     gbest566.seq
 393292620     gbest567.seq
 500000061     gbest568.seq
 499998196     gbest569.seq
 500000017     gbest57.seq
 107976046     gbest570.seq
 499998740     gbest571.seq
 499998382     gbest572.seq
  50523126     gbest573.seq
 499999830     gbest574.seq
 499997898     gbest575.seq
 499999399     gbest576.seq
 499998593     gbest577.seq
 294338068     gbest578.seq
 499999533     gbest58.seq
 500000156     gbest59.seq
 499998716     gbest6.seq
 464399310     gbest60.seq
 499999821     gbest61.seq
 499998690     gbest62.seq
 499998613     gbest63.seq
 500000006     gbest64.seq
   7795899     gbest65.seq
 499997879     gbest66.seq
 499997947     gbest67.seq
 499999722     gbest68.seq
 484302223     gbest69.seq
 499996768     gbest7.seq
 499999502     gbest70.seq
 499996969     gbest71.seq
 499998145     gbest72.seq
 500000007     gbest73.seq
  10257936     gbest74.seq
 123414980     gbest75.seq
 499999298     gbest76.seq
 499998245     gbest77.seq
 499998907     gbest78.seq
 499999038     gbest79.seq
 469442002     gbest8.seq
   6590015     gbest80.seq
 499998041     gbest81.seq
 499995370     gbest82.seq
 499997091     gbest83.seq
 500000235     gbest84.seq
  47028589     gbest85.seq
 500000165     gbest86.seq
 499999018     gbest87.seq
 499996860     gbest88.seq
 499998671     gbest89.seq
 499998427     gbest9.seq
  53783169     gbest90.seq
 499998173     gbest91.seq
 499999170     gbest92.seq
 499996091     gbest93.seq
 472256473     gbest94.seq
 499999347     gbest95.seq
 499999956     gbest96.seq
 499996717     gbest97.seq
 499913849     gbest98.seq
  35244903     gbest99.seq
 499997905     gbgss1.seq
  55726731     gbgss10.seq
 499997670     gbgss100.seq
  45810173     gbgss101.seq
 499998092     gbgss102.seq
 499998065     gbgss103.seq
 499997907     gbgss104.seq
 468721568     gbgss105.seq
 499997879     gbgss106.seq
 499999105     gbgss107.seq
 499998583     gbgss108.seq
 499999879     gbgss109.seq
 499999685     gbgss11.seq
  42543282     gbgss110.seq
 499997770     gbgss111.seq
 499999226     gbgss112.seq
 499999399     gbgss113.seq
 319587338     gbgss114.seq
 499997568     gbgss115.seq
 499999109     gbgss116.seq
 499998390     gbgss117.seq
 499998207     gbgss118.seq
 105488645     gbgss119.seq
 499998785     gbgss12.seq
 499997351     gbgss120.seq
 499997815     gbgss121.seq
 499997392     gbgss122.seq
 499998819     gbgss123.seq
   8930221     gbgss124.seq
 499999955     gbgss125.seq
 499998685     gbgss126.seq
 499999539     gbgss127.seq
 451766712     gbgss128.seq
 499998361     gbgss129.seq
 499999479     gbgss13.seq
 499999211     gbgss130.seq
 499997711     gbgss131.seq
 499998622     gbgss132.seq
  29785783     gbgss133.seq
 499997877     gbgss134.seq
 209679641     gbgss135.seq
 500000110     gbgss136.seq
 499999602     gbgss137.seq
 499997969     gbgss138.seq
 500000125     gbgss139.seq
 499998835     gbgss14.seq
  14831686     gbgss140.seq
 499996726     gbgss141.seq
 499997951     gbgss142.seq
 499999528     gbgss143.seq
 499997001     gbgss144.seq
  16786266     gbgss145.seq
 499997786     gbgss146.seq
 499996974     gbgss147.seq
 499999546     gbgss148.seq
 499996547     gbgss149.seq
   4967295     gbgss15.seq
   2045398     gbgss150.seq
 499997382     gbgss151.seq
 499998165     gbgss152.seq
 499998480     gbgss153.seq
 499997367     gbgss154.seq
   6835799     gbgss155.seq
 373333029     gbgss156.seq
 500000248     gbgss157.seq
 499998076     gbgss158.seq
 499998945     gbgss159.seq
 499997800     gbgss16.seq
 456471839     gbgss160.seq
 499999836     gbgss161.seq
 499999876     gbgss162.seq
 499997705     gbgss163.seq
 458288348     gbgss164.seq
 499997998     gbgss165.seq
 499999955     gbgss166.seq
 499998714     gbgss167.seq
 456858700     gbgss168.seq
 499996207     gbgss169.seq
 499999691     gbgss17.seq
 499998104     gbgss170.seq
 499998398     gbgss171.seq
 364091904     gbgss172.seq
 500000047     gbgss173.seq
 499997174     gbgss174.seq
 215800781     gbgss175.seq
 500000172     gbgss176.seq
 499997918     gbgss177.seq
  68464120     gbgss178.seq
 499999079     gbgss179.seq
 500000078     gbgss18.seq
 499999336     gbgss180.seq
 499998518     gbgss181.seq
 499999975     gbgss182.seq
  49671428     gbgss183.seq
 500000207     gbgss184.seq
 499998668     gbgss185.seq
 499998448     gbgss186.seq
 500000134     gbgss187.seq
  41156795     gbgss188.seq
 499999015     gbgss189.seq
 483120869     gbgss19.seq
 499999977     gbgss190.seq
  57632314     gbgss191.seq
 499998791     gbgss192.seq
 499996639     gbgss193.seq
 499997685     gbgss194.seq
 496087090     gbgss195.seq
 499999000     gbgss196.seq
 499999717     gbgss197.seq
 499997473     gbgss198.seq
 499997724     gbgss199.seq
 499997209     gbgss2.seq
 500000074     gbgss20.seq
  55766098     gbgss200.seq
 499998432     gbgss201.seq
 499999372     gbgss202.seq
 499999164     gbgss203.seq
 480794721     gbgss204.seq
 499999696     gbgss205.seq
 499998040     gbgss206.seq
  55217889     gbgss207.seq
 499999671     gbgss208.seq
 499999336     gbgss209.seq
 326435210     gbgss21.seq
 499999851     gbgss210.seq
 483131912     gbgss211.seq
 499997699     gbgss212.seq
 499998553     gbgss213.seq
 499999817     gbgss214.seq
 487680353     gbgss215.seq
 499998512     gbgss216.seq
 499999622     gbgss217.seq
 499998482     gbgss218.seq
 475203494     gbgss219.seq
 499996936     gbgss22.seq
 499999842     gbgss220.seq
 499997438     gbgss221.seq
 499998669     gbgss222.seq
   6150907     gbgss223.seq
 499999723     gbgss224.seq
 499999684     gbgss225.seq
 499998774     gbgss226.seq
 264586823     gbgss227.seq
 499998669     gbgss228.seq
 500000259     gbgss229.seq
 499999113     gbgss23.seq
 499998395     gbgss230.seq
 429771704     gbgss231.seq
 499998680     gbgss232.seq
 499997883     gbgss233.seq
 499999992     gbgss234.seq
 471956638     gbgss235.seq
 499999119     gbgss236.seq
 500000046     gbgss237.seq
 499997749     gbgss238.seq
 419219562     gbgss239.seq
 499998818     gbgss24.seq
 499999020     gbgss240.seq
 499999603     gbgss241.seq
 500000129     gbgss242.seq
 499997618     gbgss243.seq
  18225276     gbgss244.seq
 315572447     gbgss245.seq
 499997744     gbgss246.seq
 499999389     gbgss247.seq
 499998492     gbgss248.seq
 467298948     gbgss249.seq
 499999064     gbgss25.seq
 499999379     gbgss250.seq
 499998253     gbgss251.seq
 499998873     gbgss252.seq
 499997827     gbgss253.seq
  36132488     gbgss254.seq
 499998608     gbgss255.seq
 499999218     gbgss256.seq
 499998113     gbgss257.seq
 499998912     gbgss258.seq
  22042461     gbgss259.seq
  49836535     gbgss26.seq
 499997682     gbgss260.seq
 499997479     gbgss261.seq
 499997847     gbgss262.seq
   1966395     gbgss263.seq
 500000132     gbgss264.seq
 499998920     gbgss265.seq
 499998061     gbgss266.seq
 499491070     gbgss267.seq
 499999723     gbgss268.seq
 499998484     gbgss269.seq
 499996335     gbgss27.seq
 476820066     gbgss270.seq
 499996842     gbgss28.seq
 499997374     gbgss29.seq
 499996818     gbgss3.seq
 499999793     gbgss30.seq
  31342385     gbgss31.seq
 499998298     gbgss32.seq
 499999440     gbgss33.seq
 499999232     gbgss34.seq
 475323728     gbgss35.seq
 499997988     gbgss36.seq
 499998016     gbgss37.seq
 499999097     gbgss38.seq
 499998525     gbgss39.seq
 499999484     gbgss4.seq
  12514272     gbgss40.seq
 499998729     gbgss41.seq
 499997515     gbgss42.seq
 168546271     gbgss43.seq
 499997525     gbgss44.seq
 499997753     gbgss45.seq
 499999140     gbgss46.seq
 486883580     gbgss47.seq
 499998195     gbgss48.seq
 499997635     gbgss49.seq
  41480505     gbgss5.seq
 499997904     gbgss50.seq
 443945964     gbgss51.seq
 499998446     gbgss52.seq
 500000163     gbgss53.seq
 499998431     gbgss54.seq
 421055741     gbgss55.seq
 499998235     gbgss56.seq
 499999740     gbgss57.seq
 500000154     gbgss58.seq
 427947401     gbgss59.seq
 499999218     gbgss6.seq
  67665344     gbgss60.seq
 499997014     gbgss61.seq
 499998970     gbgss62.seq
 499999072     gbgss63.seq
 492396804     gbgss64.seq
 499999868     gbgss65.seq
 499998563     gbgss66.seq
 499998282     gbgss67.seq
 499998811     gbgss68.seq
   2280772     gbgss69.seq
 499997502     gbgss7.seq
 500000229     gbgss70.seq
 499999619     gbgss71.seq
 500000260     gbgss72.seq
 419366282     gbgss73.seq
 500000010     gbgss74.seq
 499997041     gbgss75.seq
 499997295     gbgss76.seq
  34859199     gbgss77.seq
 499997046     gbgss78.seq
 499999706     gbgss79.seq
 499998527     gbgss8.seq
 499999172     gbgss80.seq
 490143115     gbgss81.seq
 499999721     gbgss82.seq
 500000164     gbgss83.seq
 499998945     gbgss84.seq
 499998992     gbgss85.seq
   4092019     gbgss86.seq
 499998541     gbgss87.seq
 499997719     gbgss88.seq
 499999151     gbgss89.seq
 499998470     gbgss9.seq
 499996902     gbgss90.seq
  34174279     gbgss91.seq
 499998289     gbgss92.seq
 499998886     gbgss93.seq
 499998172     gbgss94.seq
 465185709     gbgss95.seq
 244248654     gbgss96.seq
 499999492     gbgss97.seq
 499998457     gbgss98.seq
 500000176     gbgss99.seq
 499999046     gbhtc1.seq
 499988632     gbhtc2.seq
 499995070     gbhtc3.seq
 331480491     gbhtc4.seq
 499997691     gbhtc5.seq
 439770801     gbhtc6.seq
 499998938     gbhtc7.seq
 215402908     gbhtc8.seq
 499949323     gbhtg1.seq
 499980488     gbhtg10.seq
 485100216     gbhtg11.seq
 499977040     gbhtg12.seq
 499847878     gbhtg13.seq
 499963905     gbhtg14.seq
 499701543     gbhtg15.seq
 474637795     gbhtg16.seq
 499709797     gbhtg17.seq
 499810685     gbhtg18.seq
 499965491     gbhtg19.seq
 499847286     gbhtg2.seq
 499990701     gbhtg20.seq
 473198726     gbhtg21.seq
 499919006     gbhtg22.seq
 499970126     gbhtg23.seq
 499100457     gbhtg24.seq
 499962926     gbhtg25.seq
 484453569     gbhtg26.seq
 499959716     gbhtg27.seq
 499868029     gbhtg28.seq
 268058563     gbhtg29.seq
 499869352     gbhtg3.seq
 499922791     gbhtg30.seq
 499807238     gbhtg31.seq
 224934479     gbhtg32.seq
 499945569     gbhtg33.seq
 499927151     gbhtg34.seq
 265477063     gbhtg35.seq
 499867320     gbhtg36.seq
 499972802     gbhtg37.seq
 223152146     gbhtg38.seq
 499806592     gbhtg39.seq
 499846790     gbhtg4.seq
 499974839     gbhtg40.seq
 234952893     gbhtg41.seq
 499825905     gbhtg42.seq
 499886151     gbhtg43.seq
 202125817     gbhtg44.seq
 499805593     gbhtg45.seq
 499927302     gbhtg46.seq
 205797145     gbhtg47.seq
 499976951     gbhtg48.seq
 499932272     gbhtg49.seq
 499934597     gbhtg5.seq
 193865096     gbhtg50.seq
 499927926     gbhtg51.seq
 499933183     gbhtg52.seq
 161356215     gbhtg53.seq
 499991294     gbhtg54.seq
 499991025     gbhtg55.seq
 252731163     gbhtg56.seq
 499944125     gbhtg57.seq
 499990303     gbhtg58.seq
 499843154     gbhtg59.seq
    507366     gbhtg6.seq
 167235083     gbhtg60.seq
 499934810     gbhtg61.seq
 499926029     gbhtg62.seq
 499881302     gbhtg63.seq
 468570824     gbhtg64.seq
 499882387     gbhtg65.seq
 499975194     gbhtg66.seq
 499952537     gbhtg67.seq
 499955759     gbhtg68.seq
 499868574     gbhtg69.seq
 499821957     gbhtg7.seq
 417842665     gbhtg70.seq
 499731470     gbhtg71.seq
 499823072     gbhtg72.seq
 385408676     gbhtg73.seq
 499947980     gbhtg74.seq
 499966538     gbhtg75.seq
 383565105     gbhtg76.seq
 499960780     gbhtg77.seq
 499985236     gbhtg78.seq
 499783878     gbhtg79.seq
 499933840     gbhtg8.seq
 499757763     gbhtg80.seq
 499919451     gbhtg81.seq
 306739672     gbhtg82.seq
 499899726     gbhtg9.seq
 499800267     gbinv1.seq
 448191281     gbinv10.seq
 243622469     gbinv100.seq
 603731371     gbinv1000.se
 441414339     gbinv1001.se
 420874955     gbinv1002.se
 364086765     gbinv1003.se
 301244939     gbinv1004.se
 281934492     gbinv1005.se
 496007176     gbinv1006.se
 465427121     gbinv1007.se
  64629178     gbinv1008.se
 464317098     gbinv1009.se
 499996169     gbinv101.seq
 481015217     gbinv1010.se
 495520063     gbinv1011.se
 318684601     gbinv1012.se
 481288702     gbinv1013.se
 485191239     gbinv1014.se
 489426703     gbinv1015.se
 448136762     gbinv1016.se
 470740251     gbinv1017.se
 459272447     gbinv1018.se
 495221156     gbinv1019.se
 406787100     gbinv102.seq
 293517225     gbinv1020.se
 491531607     gbinv1021.se
 484466364     gbinv1022.se
 496616157     gbinv1023.se
 243887807     gbinv1024.se
 442993412     gbinv1025.se
 489594973     gbinv1026.se
 473669853     gbinv1027.se
 317058683     gbinv1028.se
 496827832     gbinv1029.se
 497590798     gbinv103.seq
 475806379     gbinv1030.se
 483717479     gbinv1031.se
 279303308     gbinv1032.se
 442658448     gbinv1033.se
 154113444     gbinv1034.se
 479808194     gbinv1035.se
 344925105     gbinv1036.se
 389948491     gbinv1037.se
 495757112     gbinv1038.se
 486177963     gbinv1039.se
 491626356     gbinv104.seq
 474805896     gbinv1040.se
 332242655     gbinv1041.se
 470382100     gbinv1042.se
 467266108     gbinv1043.se
 443778631     gbinv1044.se
 437109989     gbinv1045.se
 476924489     gbinv1046.se
 491135272     gbinv1047.se
 490968147     gbinv1048.se
 346229875     gbinv1049.se
 468890974     gbinv105.seq
 496167175     gbinv1050.se
 491556023     gbinv1051.se
 497588780     gbinv1052.se
 487095100     gbinv1053.se
 487204794     gbinv1054.se
 476212892     gbinv1055.se
 485178393     gbinv1056.se
 488738035     gbinv1057.se
 156107164     gbinv1058.se
 497392167     gbinv1059.se
 480496392     gbinv106.seq
 482749954     gbinv1060.se
 496261622     gbinv1061.se
 494251519     gbinv1062.se
  53213160     gbinv1063.se
 442918226     gbinv1064.se
 496050726     gbinv1065.se
 497897538     gbinv1066.se
 481565834     gbinv1067.se
  75736927     gbinv1068.se
 496194879     gbinv1069.se
  96954550     gbinv107.seq
 464036016     gbinv1070.se
 428298459     gbinv1071.se
 382943578     gbinv1072.se
 379596877     gbinv1073.se
 342671608     gbinv1074.se
 493967462     gbinv1075.se
 478563134     gbinv1076.se
 148303346     gbinv1077.se
 480732928     gbinv1078.se
 469448865     gbinv1079.se
 495716317     gbinv108.seq
 488160790     gbinv1080.se
 392890907     gbinv1081.se
 481357065     gbinv1082.se
 493413425     gbinv1083.se
 487451909     gbinv1084.se
 394846711     gbinv1085.se
 488239358     gbinv1086.se
 483834908     gbinv1087.se
 490561398     gbinv1088.se
 316655906     gbinv1089.se
 459725127     gbinv109.seq
 464946114     gbinv1090.se
 492014258     gbinv1091.se
 471770137     gbinv1092.se
 461978252     gbinv1093.se
 379959406     gbinv1094.se
 408768843     gbinv1095.se
 472794533     gbinv1096.se
 321062867     gbinv1097.se
 353308729     gbinv1098.se
 483874842     gbinv1099.se
 460975353     gbinv11.seq
 481987025     gbinv110.seq
 484350001     gbinv1100.se
 489067895     gbinv1101.se
 329008329     gbinv1102.se
 476668232     gbinv1103.se
 480994325     gbinv1104.se
 495891814     gbinv1105.se
 483360160     gbinv1106.se
 132911965     gbinv1107.se
 487210140     gbinv1108.se
 448992266     gbinv1109.se
 494130819     gbinv111.seq
 498695833     gbinv1110.se
 444078900     gbinv1111.se
 215956096     gbinv1112.se
 487810620     gbinv1113.se
 482286892     gbinv1114.se
 497441252     gbinv1115.se
 467821328     gbinv1116.se
 154246756     gbinv1117.se
 466393483     gbinv1118.se
 489416936     gbinv1119.se
 170883605     gbinv112.seq
 498094362     gbinv1120.se
 484048889     gbinv1121.se
 107559872     gbinv1122.se
 496101873     gbinv1123.se
 486677933     gbinv1124.se
 491324260     gbinv1125.se
 473165407     gbinv1126.se
 140712569     gbinv1127.se
 498375180     gbinv1128.se
 479763923     gbinv1129.se
 473739682     gbinv113.seq
 484976323     gbinv1130.se
 482273285     gbinv1131.se
 478828590     gbinv1132.se
 491989005     gbinv1133.se
 447463190     gbinv1134.se
 487986285     gbinv1135.se
 346424265     gbinv1136.se
 460874738     gbinv1137.se
 470352434     gbinv1138.se
 496569150     gbinv1139.se
 489734098     gbinv114.seq
 495212210     gbinv1140.se
 443889162     gbinv1141.se
 496692637     gbinv1142.se
 473301815     gbinv1143.se
 493531126     gbinv1144.se
 483258684     gbinv1145.se
 403143105     gbinv1146.se
 492287961     gbinv1147.se
 492993389     gbinv1148.se
 329034299     gbinv1149.se
 481853020     gbinv115.seq
 461827784     gbinv1150.se
 482686927     gbinv1151.se
  99362650     gbinv1152.se
 443724048     gbinv1153.se
 367763998     gbinv1154.se
 353268604     gbinv1155.se
 350260612     gbinv1156.se
 341599132     gbinv1157.se
 461028723     gbinv1158.se
 495674250     gbinv1159.se
 480575065     gbinv116.seq
 283813945     gbinv1160.se
 495723890     gbinv1161.se
 495292964     gbinv1162.se
 476664181     gbinv1163.se
 446428554     gbinv1164.se
 382810689     gbinv1165.se
 448082904     gbinv1166.se
 453192257     gbinv1167.se
 484511211     gbinv1168.se
 284284487     gbinv1169.se
 175803748     gbinv117.seq
 476862131     gbinv1170.se
 464518126     gbinv1171.se
 496023268     gbinv1172.se
 484057968     gbinv1173.se
  64752815     gbinv1174.se
 453621523     gbinv1175.se
 477654378     gbinv1176.se
 484267949     gbinv1177.se
 455437646     gbinv1178.se
  89115533     gbinv1179.se
 495896541     gbinv118.seq
 483404516     gbinv1180.se
 390899518     gbinv1181.se
 452325242     gbinv1182.se
 384613513     gbinv1183.se
 229526122     gbinv1184.se
 486921431     gbinv1185.se
 496712223     gbinv1186.se
 435108906     gbinv1187.se
 287148864     gbinv1188.se
 277496405     gbinv1189.se
 496714826     gbinv119.seq
 488197542     gbinv1190.se
 493608297     gbinv1191.se
 489917099     gbinv1192.se
 468604289     gbinv1193.se
  78075814     gbinv1194.se
 463954346     gbinv1195.se
 444065721     gbinv1196.se
 463448466     gbinv1197.se
 479934750     gbinv1198.se
 498786146     gbinv1199.se
 491489172     gbinv12.seq
 484083643     gbinv120.seq
 472901111     gbinv1200.se
 163240230     gbinv1201.se
 487102736     gbinv1202.se
 492609813     gbinv1203.se
 481436962     gbinv1204.se
 460938379     gbinv1205.se
 478440248     gbinv1206.se
 498750906     gbinv1207.se
 164930006     gbinv1208.se
 492943115     gbinv1209.se
 472142529     gbinv121.seq
 490618893     gbinv1210.se
 492915933     gbinv1211.se
 480868563     gbinv1212.se
 489548617     gbinv1213.se
 493048930     gbinv1214.se
 481728782     gbinv1215.se
 491049473     gbinv1216.se
 497816475     gbinv1217.se
 349702816     gbinv1218.se
 480059395     gbinv1219.se
 487970521     gbinv122.seq
 384338991     gbinv1220.se
 495415147     gbinv1221.se
 494914864     gbinv1222.se
 464264813     gbinv1223.se
 412697818     gbinv1224.se
 493232928     gbinv1225.se
 486605755     gbinv1226.se
 476585175     gbinv1227.se
 199064605     gbinv1228.se
 490754089     gbinv1229.se
 473212644     gbinv123.seq
 472244532     gbinv1230.se
 489706010     gbinv1231.se
 464236921     gbinv1232.se
 467204993     gbinv1233.se
 499827123     gbinv1234.se
 345613253     gbinv1235.se
 483921508     gbinv1236.se
 478586227     gbinv1237.se
  94225785     gbinv1238.se
 472428904     gbinv1239.se
 119585424     gbinv124.seq
 497885447     gbinv1240.se
 457902545     gbinv1241.se
 498796484     gbinv1242.se
 467125389     gbinv1243.se
 497244361     gbinv1244.se
 487538660     gbinv1245.se
 499913920     gbinv1246.se
 406549774     gbinv1247.se
 430451685     gbinv1248.se
 472260007     gbinv1249.se
 483414568     gbinv125.seq
 475352175     gbinv1250.se
 452223380     gbinv1251.se
 497325130     gbinv1252.se
 494398316     gbinv1253.se
  54910173     gbinv1254.se
 492423538     gbinv1255.se
 491678341     gbinv1256.se
 467975788     gbinv1257.se
 477888370     gbinv1258.se
 439149787     gbinv1259.se
 490356176     gbinv126.seq
 107820209     gbinv1260.se
 491773954     gbinv1261.se
 479110373     gbinv1262.se
 496707613     gbinv1263.se
 498528229     gbinv1264.se
 462735347     gbinv1265.se
 402849455     gbinv1266.se
 491032865     gbinv1267.se
 476073140     gbinv1268.se
 456931139     gbinv1269.se
 487648026     gbinv127.seq
 478083309     gbinv1270.se
 457571010     gbinv1271.se
 490220501     gbinv1272.se
  26121678     gbinv1273.se
 481108642     gbinv1274.se
 343565210     gbinv1275.se
 496752688     gbinv1276.se
 480731694     gbinv1277.se
 478492919     gbinv1278.se
 487731779     gbinv1279.se
 482729414     gbinv128.seq
  76362062     gbinv1280.se
 436222895     gbinv1281.se
 469121536     gbinv1282.se
 488318181     gbinv1283.se
 457907158     gbinv1284.se
 288589895     gbinv1285.se
 413758380     gbinv1286.se
 227750852     gbinv1287.se
 499653408     gbinv1288.se
 263948525     gbinv1289.se
 499999592     gbinv129.seq
 490736102     gbinv1290.se
 499126557     gbinv1291.se
 490773865     gbinv1292.se
 480867825     gbinv1293.se
 488870121     gbinv1294.se
 158318713     gbinv1295.se
 494916186     gbinv1296.se
 471135774     gbinv1297.se
 484279868     gbinv1298.se
 469898457     gbinv1299.se
 487119482     gbinv13.seq
 420949256     gbinv130.seq
 461055681     gbinv1300.se
 273724334     gbinv1301.se
 281877207     gbinv1302.se
 479356634     gbinv1303.se
 463004791     gbinv1304.se
 225686207     gbinv1305.se
 489637921     gbinv1306.se
 496465279     gbinv1307.se
 484561817     gbinv1308.se
 477308789     gbinv1309.se
 485184677     gbinv131.seq
 258133115     gbinv1310.se
 493072880     gbinv1311.se
 490208988     gbinv1312.se
 492809523     gbinv1313.se
 474012633     gbinv1314.se
 200353570     gbinv1315.se
 477986454     gbinv1316.se
 491870466     gbinv1317.se
 472046257     gbinv1318.se
 484787948     gbinv1319.se
 497640651     gbinv132.seq
 240176778     gbinv1320.se
 481405748     gbinv1321.se
 492731277     gbinv1322.se
 480851291     gbinv1323.se
 381859195     gbinv1324.se
 479236800     gbinv1325.se
 489743792     gbinv1326.se
 497574828     gbinv1327.se
 381267248     gbinv1328.se
 450448665     gbinv1329.se
 492273365     gbinv133.seq
 484530441     gbinv1330.se
 394299446     gbinv1331.se
 425501799     gbinv1332.se
 115618359     gbinv1333.se
 431451977     gbinv1334.se
 498054878     gbinv1335.se
 479298950     gbinv1336.se
 467089340     gbinv1337.se
  70651447     gbinv1338.se
 278258267     gbinv1339.se
 493650305     gbinv134.seq
 440773903     gbinv1340.se
 470493499     gbinv1341.se
 476778459     gbinv1342.se
 486736873     gbinv1343.se
 223420398     gbinv1344.se
 471322661     gbinv1345.se
 489692789     gbinv1346.se
 493687885     gbinv1347.se
 389895514     gbinv1348.se
 489638363     gbinv1349.se
 319412812     gbinv135.seq
  35794018     gbinv1350.se
 115155809     gbinv1351.se
 615537581     gbinv1352.se
 272202298     gbinv1353.se
 480149302     gbinv1354.se
 476834871     gbinv1355.se
 477140077     gbinv1356.se
 491640835     gbinv1357.se
 403386359     gbinv1358.se
 297511488     gbinv1359.se
 495488980     gbinv136.seq
 400332784     gbinv1360.se
 498823027     gbinv1361.se
 483203009     gbinv1362.se
 482735960     gbinv1363.se
 489718628     gbinv1364.se
 494917649     gbinv1365.se
 464038534     gbinv1366.se
 489339776     gbinv1367.se
 491072844     gbinv1368.se
 485392941     gbinv1369.se
 496723739     gbinv137.seq
 485744007     gbinv1370.se
 436679593     gbinv1371.se
 104870652     gbinv1372.se
 487890253     gbinv1373.se
 491469693     gbinv1374.se
 492207810     gbinv1375.se
 277662520     gbinv1376.se
 465038797     gbinv1377.se
 484906173     gbinv1378.se
 455274642     gbinv1379.se
 492757168     gbinv138.seq
 319919307     gbinv1380.se
 441284320     gbinv1381.se
 415113809     gbinv1382.se
 401299897     gbinv1383.se
 395865604     gbinv1384.se
 258909090     gbinv1385.se
 514655388     gbinv1386.se
 393855324     gbinv1387.se
 492709181     gbinv1388.se
 187722486     gbinv1389.se
 483899601     gbinv139.seq
 316437995     gbinv1390.se
 404935920     gbinv1391.se
 377535768     gbinv1392.se
 357065535     gbinv1393.se
 306211988     gbinv1394.se
 475517285     gbinv1395.se
 487075677     gbinv1396.se
 416387225     gbinv1397.se
 134695954     gbinv1398.se
 430211421     gbinv1399.se
 490419901     gbinv14.seq
 478256053     gbinv140.seq
 468408575     gbinv1400.se
 436825552     gbinv1401.se
 499430139     gbinv1402.se
 151862240     gbinv1403.se
 462552718     gbinv1404.se
 491611432     gbinv1405.se
 498143107     gbinv1406.se
 338205053     gbinv1407.se
 497160898     gbinv1408.se
 493529280     gbinv1409.se
 492780857     gbinv141.seq
 490583969     gbinv1410.se
 296798816     gbinv1411.se
 327269135     gbinv1412.se
 374578168     gbinv1413.se
 464846984     gbinv1414.se
 483112113     gbinv1415.se
 134997033     gbinv1416.se
 435630019     gbinv1417.se
 484610659     gbinv1418.se
 421495202     gbinv1419.se
 499976012     gbinv142.seq
 397549582     gbinv1420.se
 481528936     gbinv1421.se
 458589607     gbinv1422.se
 472513592     gbinv1423.se
 337603339     gbinv1424.se
 484201127     gbinv1425.se
 385978713     gbinv1426.se
 440431049     gbinv1427.se
 460502362     gbinv1428.se
 495623919     gbinv1429.se
 498322008     gbinv143.seq
 476021491     gbinv1430.se
 461121425     gbinv1431.se
 344726041     gbinv1432.se
 460975459     gbinv1433.se
 487003903     gbinv1434.se
 498520425     gbinv1435.se
 418134448     gbinv1436.se
 427253029     gbinv1437.se
 486412807     gbinv1438.se
 383942184     gbinv1439.se
 483551083     gbinv144.seq
 477338574     gbinv1440.se
 490073097     gbinv1441.se
 478811262     gbinv1442.se
 496060117     gbinv1443.se
 340406228     gbinv1444.se
 449114541     gbinv1445.se
 199251506     gbinv1446.se
 221729756     gbinv1447.se
 327938029     gbinv1448.se
 425282426     gbinv1449.se
 444451735     gbinv145.seq
 313687149     gbinv1450.se
 266841778     gbinv1451.se
 458869871     gbinv1452.se
 369422706     gbinv1453.se
 153606987     gbinv1454.se
 472914403     gbinv1455.se
 306852781     gbinv1456.se
 291548062     gbinv1457.se
 272671608     gbinv1458.se
 486703218     gbinv1459.se
 483770018     gbinv146.seq
 499913313     gbinv1460.se
 491927835     gbinv1461.se
 158294388     gbinv1462.se
 470404301     gbinv1463.se
 477785110     gbinv1464.se
 401558910     gbinv1465.se
 482108666     gbinv1466.se
  75176389     gbinv1467.se
 466305691     gbinv1468.se
 488346628     gbinv1469.se
 493575936     gbinv147.seq
 427690357     gbinv1470.se
 413354153     gbinv1471.se
 497212607     gbinv1472.se
 400793181     gbinv1473.se
 484524034     gbinv1474.se
 465540714     gbinv1475.se
 498576546     gbinv1476.se
 406206788     gbinv1477.se
 453652425     gbinv1478.se
 457851234     gbinv1479.se
 498159917     gbinv148.seq
 392940138     gbinv1480.se
 484114705     gbinv1481.se
 485175842     gbinv1482.se
 489823569     gbinv1483.se
 493576473     gbinv1484.se
 177016892     gbinv1485.se
 486849466     gbinv1486.se
 480897370     gbinv1487.se
 254718644     gbinv1488.se
 271476686     gbinv1489.se
 461241055     gbinv149.seq
 459218955     gbinv1490.se
 436464597     gbinv1491.se
 424836755     gbinv1492.se
 407409473     gbinv1493.se
 392557971     gbinv1494.se
 374840311     gbinv1495.se
 370687455     gbinv1496.se
 364209018     gbinv1497.se
 356043378     gbinv1498.se
 470407388     gbinv1499.se
 496555027     gbinv15.seq
 429126369     gbinv150.seq
 498144179     gbinv1500.se
 440247259     gbinv1501.se
 432569025     gbinv1502.se
 473074066     gbinv1503.se
 446787735     gbinv1504.se
 490046306     gbinv1505.se
 458546137     gbinv1506.se
 453744056     gbinv1507.se
 485719553     gbinv1508.se
 470688947     gbinv1509.se
 472246082     gbinv151.seq
 499145969     gbinv1510.se
 488679526     gbinv1511.se
 421877052     gbinv1512.se
 403063473     gbinv1513.se
 491935868     gbinv1514.se
 450996388     gbinv1515.se
 494574942     gbinv1516.se
 190754233     gbinv1517.se
 446572734     gbinv1518.se
 349707818     gbinv1519.se
 487388602     gbinv152.seq
 498341839     gbinv1520.se
 475083978     gbinv1521.se
 495586255     gbinv1522.se
 493047765     gbinv1523.se
 424336607     gbinv1524.se
 445635419     gbinv1525.se
 496536598     gbinv1526.se
 421970194     gbinv1527.se
 304852181     gbinv1528.se
 282782605     gbinv1529.se
 488621132     gbinv153.seq
 287459144     gbinv1530.se
 292138330     gbinv1531.se
 278622574     gbinv1532.se
 464187388     gbinv1533.se
 365807256     gbinv1534.se
 473318223     gbinv1535.se
 397532595     gbinv1536.se
 499926253     gbinv1537.se
 489834503     gbinv1538.se
 494009263     gbinv1539.se
 492386538     gbinv154.seq
 227606738     gbinv1540.se
 354335913     gbinv1541.se
 405308849     gbinv1542.se
 373295374     gbinv1543.se
 461408168     gbinv1544.se
 468585870     gbinv1545.se
 465615394     gbinv1546.se
 478206747     gbinv1547.se
 470845488     gbinv1548.se
 434630573     gbinv1549.se
 410012642     gbinv155.seq
 449352694     gbinv1550.se
 475961503     gbinv1551.se
 499526122     gbinv1552.se
 474588030     gbinv1553.se
 497424296     gbinv1554.se
 495011127     gbinv1555.se
 473393654     gbinv1556.se
 492895518     gbinv1557.se
 433798578     gbinv1558.se
 497380186     gbinv1559.se
 489753866     gbinv156.seq
 478698569     gbinv1560.se
 493900539     gbinv1561.se
 448881029     gbinv1562.se
 491287252     gbinv1563.se
 486729373     gbinv1564.se
 490419273     gbinv1565.se
 466942698     gbinv1566.se
 496628250     gbinv1567.se
 415334432     gbinv1568.se
 477729034     gbinv1569.se
 486908019     gbinv157.seq
 389608539     gbinv1570.se
 447782896     gbinv1571.se
 379570416     gbinv1572.se
 168050660     gbinv1573.se
 402140341     gbinv1574.se
 498521166     gbinv1575.se
 487560937     gbinv1576.se
 470237421     gbinv1577.se
 251883025     gbinv1578.se
 450021867     gbinv1579.se
 475277294     gbinv158.seq
 456014148     gbinv1580.se
 424453416     gbinv1581.se
 489077138     gbinv1582.se
 291935973     gbinv1583.se
 447199297     gbinv1584.se
 482287346     gbinv1585.se
 446762057     gbinv1586.se
 478107977     gbinv1587.se
 499941570     gbinv1588.se
 250754094     gbinv1589.se
 499301159     gbinv159.seq
 426775075     gbinv1590.se
 469944018     gbinv1591.se
 421658854     gbinv1592.se
 156531103     gbinv1593.se
 424023494     gbinv1594.se
 458403575     gbinv1595.se
 760558437     gbinv1596.se
 630932111     gbinv1597.se
 269337227     gbinv1598.se
 306383890     gbinv1599.se
 497380616     gbinv16.seq
 356777678     gbinv160.seq
 362982048     gbinv1600.se
 490460088     gbinv1601.se
 490124242     gbinv1602.se
 474114247     gbinv1603.se
 414555840     gbinv1604.se
 367764030     gbinv1605.se
 492318902     gbinv1606.se
 465538889     gbinv1607.se
 440018439     gbinv1608.se
 402923832     gbinv1609.se
 461771503     gbinv161.seq
 293890829     gbinv1610.se
 480424893     gbinv1611.se
 487780990     gbinv1612.se
 497662462     gbinv1613.se
 493315557     gbinv1614.se
 454184050     gbinv1615.se
 453672339     gbinv1616.se
 477783541     gbinv1617.se
 396639389     gbinv1618.se
 258248902     gbinv1619.se
 479426529     gbinv162.seq
 457972032     gbinv1620.se
 493145244     gbinv1621.se
  83808633     gbinv1622.se
 481310336     gbinv1623.se
 484438327     gbinv1624.se
 431604389     gbinv1625.se
 466521191     gbinv1626.se
 479481937     gbinv1627.se
 203515617     gbinv1628.se
 438666095     gbinv1629.se
 494640587     gbinv163.seq
 288710027     gbinv1630.se
 587646776     gbinv1631.se
 521821380     gbinv1632.se
 488633320     gbinv1633.se
 449619178     gbinv1634.se
 490826708     gbinv1635.se
 195165009     gbinv1636.se
 474082897     gbinv1637.se
 328282042     gbinv1638.se
 429294922     gbinv1639.se
 328489973     gbinv164.seq
 376618222     gbinv1640.se
 465450082     gbinv1641.se
 191733239     gbinv1642.se
 413988002     gbinv1643.se
 346233485     gbinv1644.se
 351456130     gbinv1645.se
 332888212     gbinv1646.se
 344512888     gbinv1647.se
 161969290     gbinv1648.se
 466172748     gbinv1649.se
 484117251     gbinv165.seq
 443973599     gbinv1650.se
 439364738     gbinv1651.se
 492660163     gbinv1652.se
 421482701     gbinv1653.se
 494043084     gbinv1654.se
 349286868     gbinv1655.se
 401241900     gbinv1656.se
 478917983     gbinv1657.se
 476837170     gbinv1658.se
 489355798     gbinv1659.se
 499999203     gbinv166.seq
 455471572     gbinv1660.se
 498384166     gbinv1661.se
 319485498     gbinv1662.se
 499130515     gbinv1663.se
 487864427     gbinv1664.se
 493398968     gbinv1665.se
 485556197     gbinv1666.se
 485364037     gbinv1667.se
 484935088     gbinv1668.se
 466357014     gbinv1669.se
 499996940     gbinv167.seq
 457733117     gbinv1670.se
 392915750     gbinv1671.se
 478478032     gbinv1672.se
 393129850     gbinv1673.se
 492543588     gbinv1674.se
 450108923     gbinv1675.se
 351978698     gbinv1676.se
 478292534     gbinv1677.se
 420767553     gbinv1678.se
 481749728     gbinv1679.se
 116549954     gbinv168.seq
 445278271     gbinv1680.se
 412662975     gbinv1681.se
 387090079     gbinv1682.se
 256908256     gbinv1683.se
 469736436     gbinv1684.se
 490540910     gbinv1685.se
 485878260     gbinv1686.se
 465587474     gbinv1687.se
 480998150     gbinv1688.se
 465832905     gbinv1689.se
 499996349     gbinv169.seq
 485326493     gbinv1690.se
 433309101     gbinv1691.se
 440675008     gbinv1692.se
  68735845     gbinv1693.se
 450843126     gbinv1694.se
 313135865     gbinv1695.se
 429536528     gbinv1696.se
 394632639     gbinv1697.se
 476444266     gbinv1698.se
 496585001     gbinv1699.se
 476460093     gbinv17.seq
 500000157     gbinv170.seq
 484815304     gbinv1700.se
 498211104     gbinv1701.se
 490032585     gbinv1702.se
  88986595     gbinv1703.se
 499092910     gbinv1704.se
 471084800     gbinv1705.se
 479084211     gbinv1706.se
 458027456     gbinv1707.se
 183437281     gbinv1708.se
 489133522     gbinv1709.se
 405127906     gbinv171.seq
 480973066     gbinv1710.se
 476620478     gbinv1711.se
 484763605     gbinv1712.se
 172605670     gbinv1713.se
 476872305     gbinv1714.se
 497217757     gbinv1715.se
 454084009     gbinv1716.se
 490687872     gbinv1717.se
 249163765     gbinv1718.se
 446287432     gbinv1719.se
 499998732     gbinv172.seq
 480747279     gbinv1720.se
 477662208     gbinv1721.se
 486024070     gbinv1722.se
 138543432     gbinv1723.se
 363404243     gbinv1724.se
 440303391     gbinv1725.se
 428374310     gbinv1726.se
 485262912     gbinv1727.se
 313605393     gbinv1728.se
 384773620     gbinv1729.se
 499998661     gbinv173.seq
 344575448     gbinv1730.se
 302995972     gbinv1731.se
 489532826     gbinv1732.se
 205630096     gbinv1733.se
 469243590     gbinv1734.se
 491841323     gbinv1735.se
 478814364     gbinv1736.se
 449053948     gbinv1737.se
 480874694     gbinv1738.se
 310630191     gbinv1739.se
 181404335     gbinv174.seq
 499997906     gbinv175.seq
 499997782     gbinv176.seq
 124870548     gbinv177.seq
 499999015     gbinv178.seq
 499996071     gbinv179.seq
 422534063     gbinv18.seq
 151120373     gbinv180.seq
 499998433     gbinv181.seq
 499998677     gbinv182.seq
 154518140     gbinv183.seq
 499998417     gbinv184.seq
 499996655     gbinv185.seq
 188822174     gbinv186.seq
 500000010     gbinv187.seq
 499999442     gbinv188.seq
 245836349     gbinv189.seq
 173964304     gbinv19.seq
 499969653     gbinv190.seq
 500000210     gbinv191.seq
 499999230     gbinv192.seq
 499995276     gbinv193.seq
 141728131     gbinv194.seq
 499999374     gbinv195.seq
 455573372     gbinv196.seq
 289058569     gbinv197.seq
  54983087     gbinv198.seq
  52942591     gbinv199.seq
 457128070     gbinv2.seq
 490451259     gbinv20.seq
 157076018     gbinv200.seq
 499999147     gbinv201.seq
 268190266     gbinv202.seq
 499996088     gbinv203.seq
 499997883     gbinv204.seq
 182060786     gbinv205.seq
 499192390     gbinv206.seq
 499772419     gbinv207.seq
 498733787     gbinv208.seq
 135327866     gbinv209.seq
 491062219     gbinv21.seq
 496659631     gbinv210.seq
  51960557     gbinv211.seq
 466568666     gbinv212.seq
 479577598     gbinv213.seq
 450560355     gbinv214.seq
 482003105     gbinv215.seq
 121049467     gbinv216.seq
 494590358     gbinv217.seq
 499153393     gbinv218.seq
 498729788     gbinv219.seq
 470215242     gbinv22.seq
 491950600     gbinv220.seq
 483597478     gbinv221.seq
 493910409     gbinv222.seq
 305143352     gbinv223.seq
 453012519     gbinv224.seq
 480839077     gbinv225.seq
 375796260     gbinv226.seq
 499933702     gbinv227.seq
 485464339     gbinv228.seq
 485283938     gbinv229.seq
 485523455     gbinv23.seq
 498294953     gbinv230.seq
 414580638     gbinv231.seq
 498679440     gbinv232.seq
 495007238     gbinv233.seq
 486086193     gbinv234.seq
 483986740     gbinv235.seq
 479016567     gbinv236.seq
 377180280     gbinv237.seq
 491313703     gbinv238.seq
 482991950     gbinv239.seq
 174159504     gbinv24.seq
 495169229     gbinv240.seq
 493741890     gbinv241.seq
 495500028     gbinv242.seq
 371035005     gbinv243.seq
 470293000     gbinv244.seq
 496253081     gbinv245.seq
 496289838     gbinv246.seq
 472378022     gbinv247.seq
 493444357     gbinv248.seq
 418569182     gbinv249.seq
 486730694     gbinv25.seq
 493158119     gbinv250.seq
 491119641     gbinv251.seq
 465656312     gbinv252.seq
 490891118     gbinv253.seq
 459581775     gbinv254.seq
 406078142     gbinv255.seq
 476900813     gbinv256.seq
 481848691     gbinv257.seq
 496747706     gbinv258.seq
 492742184     gbinv259.seq
 495353494     gbinv26.seq
 496271174     gbinv260.seq
 392139815     gbinv261.seq
 496951694     gbinv262.seq
 492317100     gbinv263.seq
 475961856     gbinv264.seq
 498252048     gbinv265.seq
 496664764     gbinv266.seq
 351267284     gbinv267.seq
 454438248     gbinv268.seq
 490109816     gbinv269.seq
 471931517     gbinv27.seq
 477836082     gbinv270.seq
 497117087     gbinv271.seq
 273421111     gbinv272.seq
 484550538     gbinv273.seq
 486204454     gbinv274.seq
 489013669     gbinv275.seq
 499892182     gbinv276.seq
 389960712     gbinv277.seq
 230763287     gbinv278.seq
 433765668     gbinv279.seq
 486628934     gbinv28.seq
 341801067     gbinv280.seq
 488714019     gbinv281.seq
 442231562     gbinv282.seq
 498588083     gbinv283.seq
 499229088     gbinv284.seq
 194395336     gbinv285.seq
 499997609     gbinv286.seq
 499996553     gbinv287.seq
 395644747     gbinv288.seq
 499997237     gbinv289.seq
 497114880     gbinv29.seq
 499999958     gbinv290.seq
 233482028     gbinv291.seq
 499998967     gbinv292.seq
 499996813     gbinv293.seq
 288206894     gbinv294.seq
 499997812     gbinv295.seq
 499984168     gbinv296.seq
 385385619     gbinv297.seq
 499999738     gbinv298.seq
 499997168     gbinv299.seq
 499996977     gbinv3.seq
 488719896     gbinv30.seq
 499576100     gbinv300.seq
 499895844     gbinv301.seq
 338213002     gbinv302.seq
 499999353     gbinv303.seq
 499954513     gbinv304.seq
 394312187     gbinv305.seq
 499998973     gbinv306.seq
 499768151     gbinv307.seq
 499935390     gbinv308.seq
 262394318     gbinv309.seq
 319196831     gbinv31.seq
 499489044     gbinv310.seq
 499984461     gbinv311.seq
 499999178     gbinv312.seq
 219010924     gbinv313.seq
 499665286     gbinv314.seq
 499954794     gbinv315.seq
 499986274     gbinv316.seq
 349517342     gbinv317.seq
 500000137     gbinv318.seq
 499979428     gbinv319.seq
 305989097     gbinv32.seq
 499843177     gbinv320.seq
 499948105     gbinv321.seq
 500000223     gbinv322.seq
  67122505     gbinv323.seq
 499999636     gbinv324.seq
 499704487     gbinv325.seq
 499897338     gbinv326.seq
 499999895     gbinv327.seq
  68002970     gbinv328.seq
 499977802     gbinv329.seq
 499447601     gbinv33.seq
 499904157     gbinv330.seq
 499970007     gbinv331.seq
 499999529     gbinv332.seq
 499940074     gbinv333.seq
 122380920     gbinv334.seq
 500000224     gbinv335.seq
 499999552     gbinv336.seq
 468683478     gbinv337.seq
 499670167     gbinv338.seq
 499934229     gbinv339.seq
 331575178     gbinv34.seq
 499999149     gbinv340.seq
  90103424     gbinv341.seq
 499999143     gbinv342.seq
 499998873     gbinv343.seq
 499998441     gbinv344.seq
 480339156     gbinv345.seq
 364987744     gbinv346.seq
 481046566     gbinv347.seq
 450037592     gbinv348.seq
 303709120     gbinv349.seq
 409329256     gbinv35.seq
 293451879     gbinv350.seq
 280090292     gbinv351.seq
 279807655     gbinv352.seq
 274554291     gbinv353.seq
 266890013     gbinv354.seq
 491295680     gbinv355.seq
 418047621     gbinv356.seq
 383074342     gbinv357.seq
 489267408     gbinv358.seq
 393039463     gbinv359.seq
 337324220     gbinv36.seq
 484538449     gbinv360.seq
 482310364     gbinv361.seq
 491415359     gbinv362.seq
 495004950     gbinv363.seq
 484038821     gbinv364.seq
 495670320     gbinv365.seq
  40846857     gbinv366.seq
 492571202     gbinv367.seq
 490206006     gbinv368.seq
 445709424     gbinv369.seq
 416902989     gbinv37.seq
 207302902     gbinv370.seq
 370283947     gbinv371.seq
 207800719     gbinv372.seq
 403111025     gbinv373.seq
 496966573     gbinv374.seq
 495208718     gbinv375.seq
 486338081     gbinv376.seq
 491887863     gbinv377.seq
  62682558     gbinv378.seq
 487684874     gbinv379.seq
 480340526     gbinv38.seq
 495915356     gbinv380.seq
 497117994     gbinv381.seq
 485878834     gbinv382.seq
 336958408     gbinv383.seq
 470338855     gbinv384.seq
 473857916     gbinv385.seq
 488417194     gbinv386.seq
 472996654     gbinv387.seq
 444602917     gbinv388.seq
 489109149     gbinv389.seq
 470719972     gbinv39.seq
 489050714     gbinv390.seq
 492905647     gbinv391.seq
 464574397     gbinv392.seq
 389650543     gbinv393.seq
 499026362     gbinv394.seq
 459755126     gbinv395.seq
 457336321     gbinv396.seq
 468059538     gbinv397.seq
 487547225     gbinv398.seq
 494629437     gbinv399.seq
 499164076     gbinv4.seq
 478012779     gbinv40.seq
 499368968     gbinv400.seq
 425865947     gbinv401.seq
 447703471     gbinv402.seq
 471358720     gbinv403.seq
 106488590     gbinv404.seq
 494438067     gbinv405.seq
 499096313     gbinv406.seq
 174717833     gbinv407.seq
 439432672     gbinv408.seq
 315017082     gbinv409.seq
 372274412     gbinv41.seq
 247279447     gbinv410.seq
 493106968     gbinv411.seq
 482399453     gbinv412.seq
 487563600     gbinv413.seq
 495047837     gbinv414.seq
 345419513     gbinv415.seq
 499133273     gbinv416.seq
 496482189     gbinv417.seq
 369581646     gbinv418.seq
 456145557     gbinv419.seq
 473605830     gbinv42.seq
 200285196     gbinv420.seq
 495154413     gbinv421.seq
 341654330     gbinv422.seq
 336683654     gbinv423.seq
 493060580     gbinv424.seq
 107491235     gbinv425.seq
 487938647     gbinv426.seq
 495763325     gbinv427.seq
 481723089     gbinv428.seq
 326171717     gbinv429.seq
 476844427     gbinv43.seq
 485891711     gbinv430.seq
 492821648     gbinv431.seq
 471307712     gbinv432.seq
 311911756     gbinv433.seq
 499380148     gbinv434.seq
 482084817     gbinv435.seq
 479662419     gbinv436.seq
 363343706     gbinv437.seq
 489746713     gbinv438.seq
 499514774     gbinv439.seq
 486980011     gbinv44.seq
 496438512     gbinv440.seq
 492580334     gbinv441.seq
 486836376     gbinv442.seq
 496615730     gbinv443.seq
 482720635     gbinv444.seq
 134241704     gbinv445.seq
 493089306     gbinv446.seq
 490891004     gbinv447.seq
 498098866     gbinv448.seq
 498391590     gbinv449.seq
 160013874     gbinv45.seq
 493309439     gbinv450.seq
 324291471     gbinv451.seq
 484493924     gbinv452.seq
 491069771     gbinv453.seq
 494055574     gbinv454.seq
 235593723     gbinv455.seq
 319983008     gbinv456.seq
 484241023     gbinv457.seq
 216170369     gbinv458.seq
 218804026     gbinv459.seq
 493935222     gbinv46.seq
 336455655     gbinv460.seq
 297857601     gbinv461.seq
 477593708     gbinv462.seq
 493171167     gbinv463.seq
  96653657     gbinv464.seq
 401450903     gbinv465.seq
 471214414     gbinv466.seq
 478230772     gbinv467.seq
 481554780     gbinv468.seq
 119372855     gbinv469.seq
 422099764     gbinv47.seq
 489114034     gbinv470.seq
 418974457     gbinv471.seq
 492119058     gbinv472.seq
 488068826     gbinv473.seq
  86400276     gbinv474.seq
 475977385     gbinv475.seq
 479094391     gbinv476.seq
  91925882     gbinv477.seq
 498866242     gbinv478.seq
 475446584     gbinv479.seq
 466237117     gbinv48.seq
 492109157     gbinv480.seq
 493644048     gbinv481.seq
 450867996     gbinv482.seq
 491759493     gbinv483.seq
  84745799     gbinv484.seq
 423732674     gbinv485.seq
 344360076     gbinv486.seq
 487664625     gbinv487.seq
 481798553     gbinv488.seq
 419437573     gbinv489.seq
 490207614     gbinv49.seq
 447480354     gbinv490.seq
 458542150     gbinv491.seq
  84187054     gbinv492.seq
 476248749     gbinv493.seq
 482272438     gbinv494.seq
 498234741     gbinv495.seq
 471043224     gbinv496.seq
 136592520     gbinv497.seq
 495120952     gbinv498.seq
 498047113     gbinv499.seq
 499713007     gbinv5.seq
 480431708     gbinv50.seq
 493290837     gbinv500.seq
 467613412     gbinv501.seq
 464868282     gbinv502.seq
 485108715     gbinv503.seq
  70627368     gbinv504.seq
 444909488     gbinv505.seq
 457689916     gbinv506.seq
 485382078     gbinv507.seq
 496105931     gbinv508.seq
 484291167     gbinv509.seq
 268718981     gbinv51.seq
 248438198     gbinv510.seq
 413526177     gbinv511.seq
 438000207     gbinv512.seq
 487748206     gbinv513.seq
 497322827     gbinv514.seq
 171187065     gbinv515.seq
 404122148     gbinv516.seq
 358274008     gbinv517.seq
 352555230     gbinv518.seq
 335719715     gbinv519.seq
 391536350     gbinv52.seq
 334992684     gbinv520.seq
 323934868     gbinv521.seq
 323397124     gbinv522.seq
 292340545     gbinv523.seq
 497373639     gbinv524.seq
 451425634     gbinv525.seq
 352564218     gbinv526.seq
 457737190     gbinv527.seq
 480925976     gbinv528.seq
 482363288     gbinv529.seq
 441369502     gbinv53.seq
 490058774     gbinv530.seq
 457330992     gbinv531.seq
 213313220     gbinv532.seq
 475683221     gbinv533.seq
 475722382     gbinv534.seq
 474818912     gbinv535.seq
 463886713     gbinv536.seq
 174479470     gbinv537.seq
 467301426     gbinv538.seq
 487596983     gbinv539.seq
 395604817     gbinv54.seq
 466523941     gbinv540.seq
 473849332     gbinv541.seq
 271533425     gbinv542.seq
 474315468     gbinv543.seq
 422684936     gbinv544.seq
 403437207     gbinv545.seq
 460401414     gbinv546.seq
 495684114     gbinv547.seq
 496920059     gbinv548.seq
 255707629     gbinv549.seq
 484951437     gbinv55.seq
 488417645     gbinv550.seq
 493391118     gbinv551.seq
 430648868     gbinv552.seq
 483962961     gbinv553.seq
 482614063     gbinv554.seq
 466924368     gbinv555.seq
 153705523     gbinv556.seq
 469807657     gbinv557.seq
 497173372     gbinv558.seq
 486068129     gbinv559.seq
 431159123     gbinv56.seq
 497761269     gbinv560.seq
 483774021     gbinv561.seq
 208975227     gbinv562.seq
 482561048     gbinv563.seq
 489387386     gbinv564.seq
 174750473     gbinv565.seq
 520668510     gbinv566.seq
 439679373     gbinv567.seq
  76608705     gbinv568.seq
 544459581     gbinv569.seq
 449767967     gbinv57.seq
 291577990     gbinv570.seq
 499183813     gbinv571.seq
 449457434     gbinv572.seq
 403099826     gbinv573.seq
 426341523     gbinv574.seq
 452289588     gbinv575.seq
 332054885     gbinv576.seq
 216067261     gbinv577.seq
 363589773     gbinv578.seq
 349108604     gbinv579.seq
 304133076     gbinv58.seq
 466080734     gbinv580.seq
 433540835     gbinv581.seq
 325349387     gbinv582.seq
 414135977     gbinv583.seq
 443362325     gbinv584.seq
 458656169     gbinv585.seq
 469667434     gbinv586.seq
 275644987     gbinv587.seq
 446552014     gbinv588.seq
 480169917     gbinv589.seq
 497557396     gbinv59.seq
 474041236     gbinv590.seq
 439739785     gbinv591.seq
 415879695     gbinv592.seq
 467640439     gbinv593.seq
 312202563     gbinv594.seq
 476756795     gbinv595.seq
 477061626     gbinv596.seq
 483683490     gbinv597.seq
 495487713     gbinv598.seq
  69234679     gbinv599.seq
 371668925     gbinv6.seq
 409223006     gbinv60.seq
 477792636     gbinv600.seq
 492728468     gbinv601.seq
 425135691     gbinv602.seq
 353041445     gbinv603.seq
 470334960     gbinv604.seq
 494601058     gbinv605.seq
 481221711     gbinv606.seq
 396473476     gbinv607.seq
 483642314     gbinv608.seq
 482127664     gbinv609.seq
 432405101     gbinv61.seq
 470874419     gbinv610.seq
 495029689     gbinv611.seq
  99066263     gbinv612.seq
 477955845     gbinv613.seq
 452660426     gbinv614.seq
 467009813     gbinv615.seq
 409211575     gbinv616.seq
 281441527     gbinv617.seq
 321243822     gbinv618.seq
 272762615     gbinv619.seq
 302298162     gbinv62.seq
 459220600     gbinv620.seq
 380210496     gbinv621.seq
 157861358     gbinv622.seq
 496825048     gbinv623.seq
 457058797     gbinv624.seq
 475749694     gbinv625.seq
 458940745     gbinv626.seq
 478290025     gbinv627.seq
 201201186     gbinv628.seq
 476458619     gbinv629.seq
 474204665     gbinv63.seq
 472367844     gbinv630.seq
 491956509     gbinv631.seq
 445112980     gbinv632.seq
 478727516     gbinv633.seq
 213103145     gbinv634.seq
 426002690     gbinv635.seq
 491306551     gbinv636.seq
 485922068     gbinv637.seq
 470775025     gbinv638.seq
 259886474     gbinv639.seq
 499406905     gbinv64.seq
 323358243     gbinv640.seq
 292361181     gbinv641.seq
 472027339     gbinv642.seq
 394618639     gbinv643.seq
 498685113     gbinv644.seq
 252840705     gbinv645.seq
 409818882     gbinv646.seq
 483153574     gbinv647.seq
 356373819     gbinv648.seq
 382117771     gbinv649.seq
 493280432     gbinv65.seq
 414986838     gbinv650.seq
 358562967     gbinv651.seq
 454612949     gbinv652.seq
 397094236     gbinv653.seq
 472022816     gbinv654.seq
 375604154     gbinv655.seq
 260058125     gbinv656.seq
 416870448     gbinv657.seq
 337551656     gbinv658.seq
 323476118     gbinv659.seq
 319188821     gbinv66.seq
 316192878     gbinv660.seq
 483033075     gbinv661.seq
 484553056     gbinv662.seq
 485400895     gbinv663.seq
 444237062     gbinv664.seq
 115137081     gbinv665.seq
 465061268     gbinv666.seq
 450665417     gbinv667.seq
 495339385     gbinv668.seq
 358679242     gbinv669.seq
 491655073     gbinv67.seq
 488909847     gbinv670.seq
 494569731     gbinv671.seq
 446419168     gbinv672.seq
 393089050     gbinv673.seq
 119924885     gbinv674.seq
 475723349     gbinv675.seq
 418498253     gbinv676.seq
 487729463     gbinv677.seq
 442064966     gbinv678.seq
 459399034     gbinv679.seq
 492219703     gbinv68.seq
 476019529     gbinv680.seq
 489445959     gbinv681.seq
 488427181     gbinv682.seq
  39113487     gbinv683.seq
 478318630     gbinv684.seq
 485192704     gbinv685.seq
 487924132     gbinv686.seq
 367187723     gbinv687.seq
 491253033     gbinv688.seq
 492099884     gbinv689.seq
 480268373     gbinv69.seq
 492318782     gbinv690.seq
 490488560     gbinv691.seq
 264709414     gbinv692.seq
 498243322     gbinv693.seq
 461893097     gbinv694.seq
 479536374     gbinv695.seq
 498214872     gbinv696.seq
 358503530     gbinv697.seq
 497880059     gbinv698.seq
 328840422     gbinv699.seq
 462608484     gbinv7.seq
 380543400     gbinv70.seq
 388768319     gbinv700.seq
 497514162     gbinv701.seq
 102760609     gbinv702.seq
 424365480     gbinv703.seq
 415464839     gbinv704.seq
 468645236     gbinv705.seq
 491418312     gbinv706.seq
 422461178     gbinv707.seq
 494059900     gbinv708.seq
 492105201     gbinv709.seq
 498478577     gbinv71.seq
 371680457     gbinv710.seq
 418666111     gbinv711.seq
 385203223     gbinv712.seq
 490161407     gbinv713.seq
 462283913     gbinv714.seq
 497343220     gbinv715.seq
 483358775     gbinv716.seq
 419495810     gbinv717.seq
 495088992     gbinv718.seq
 118039128     gbinv719.seq
 489123698     gbinv72.seq
 460760613     gbinv720.seq
 474795905     gbinv721.seq
 448271770     gbinv722.seq
 447953092     gbinv723.seq
 397698504     gbinv724.seq
 412906977     gbinv725.seq
 414039055     gbinv726.seq
 373499990     gbinv727.seq
 352095009     gbinv728.seq
 171624580     gbinv729.seq
 498905574     gbinv73.seq
 492880950     gbinv730.seq
 496329611     gbinv731.seq
 495293458     gbinv732.seq
 326435281     gbinv733.seq
 478875133     gbinv734.seq
 438224962     gbinv735.seq
 474184048     gbinv736.seq
 357686295     gbinv737.seq
 465465282     gbinv738.seq
 485209832     gbinv739.seq
 234808936     gbinv74.seq
 427730310     gbinv740.seq
 361113223     gbinv741.seq
 482159714     gbinv742.seq
 495382944     gbinv743.seq
 299589099     gbinv744.seq
 321246481     gbinv745.seq
 309309582     gbinv746.seq
 488604754     gbinv747.seq
 410235494     gbinv748.seq
 495922375     gbinv749.seq
 466465897     gbinv75.seq
 434632204     gbinv750.seq
  74348655     gbinv751.seq
 541537247     gbinv752.seq
 355690685     gbinv753.seq
 292909846     gbinv754.seq
 463584322     gbinv755.seq
 387676008     gbinv756.seq
 372674865     gbinv757.seq
 485847387     gbinv758.seq
 484407673     gbinv759.seq
 473206517     gbinv76.seq
 473708314     gbinv760.seq
 352986490     gbinv761.seq
 443627527     gbinv762.seq
 434076487     gbinv763.seq
 478667921     gbinv764.seq
 488478103     gbinv765.seq
 306326401     gbinv766.seq
 385565833     gbinv767.seq
 482190195     gbinv768.seq
 137160705     gbinv769.seq
 478992009     gbinv77.seq
 490300743     gbinv770.seq
 419187067     gbinv771.seq
 398652960     gbinv772.seq
 436288257     gbinv773.seq
 493888501     gbinv774.seq
 447343866     gbinv775.seq
 496950073     gbinv776.seq
  68378185     gbinv777.seq
 484369453     gbinv778.seq
 474926486     gbinv779.seq
 282038790     gbinv78.seq
 480605871     gbinv780.seq
 489403870     gbinv781.seq
 489850852     gbinv782.seq
 483923401     gbinv783.seq
 195051546     gbinv784.seq
 278317571     gbinv785.seq
 405202233     gbinv786.seq
 481613416     gbinv787.seq
 483053144     gbinv788.seq
 140617338     gbinv789.seq
 478991943     gbinv79.seq
 480377160     gbinv790.seq
 499100085     gbinv791.seq
 495490578     gbinv792.seq
 401267230     gbinv793.seq
 334138952     gbinv794.seq
 475047240     gbinv795.seq
 428648405     gbinv796.seq
 378490165     gbinv797.seq
 487837824     gbinv798.seq
 491255029     gbinv799.seq
 446653334     gbinv8.seq
 483677905     gbinv80.seq
 375538343     gbinv800.seq
 353621722     gbinv801.seq
 408852378     gbinv802.seq
 494054422     gbinv803.seq
 437725967     gbinv804.seq
 364183673     gbinv805.seq
 466430597     gbinv806.seq
 418516710     gbinv807.seq
 347070086     gbinv808.seq
 481701036     gbinv809.seq
 483677903     gbinv81.seq
 453274315     gbinv810.seq
 496564297     gbinv811.seq
 467957545     gbinv812.seq
 479873706     gbinv813.seq
 479944057     gbinv814.seq
 154655407     gbinv815.seq
 464570217     gbinv816.seq
 498339612     gbinv817.seq
 474586953     gbinv818.seq
 481881129     gbinv819.seq
 309424683     gbinv82.seq
 132360635     gbinv820.seq
 377651382     gbinv821.seq
 471908759     gbinv822.seq
 346087536     gbinv823.seq
 221434064     gbinv824.seq
 312336498     gbinv825.seq
 482097150     gbinv826.seq
 426274349     gbinv827.seq
 491798282     gbinv828.seq
 456244166     gbinv829.seq
 483677981     gbinv83.seq
 498886557     gbinv830.seq
 413523689     gbinv831.seq
 494612233     gbinv832.seq
 269134738     gbinv833.seq
 458119773     gbinv834.seq
 492920478     gbinv835.seq
 331278911     gbinv836.seq
 237876308     gbinv837.seq
 380568436     gbinv838.seq
 323208797     gbinv839.seq
 483678137     gbinv84.seq
 298483269     gbinv840.seq
 296444100     gbinv841.seq
 461753371     gbinv842.seq
  66028693     gbinv843.seq
 499911575     gbinv844.seq
 471640101     gbinv845.seq
 447745268     gbinv846.seq
 441848406     gbinv847.seq
 180180054     gbinv848.seq
 470673110     gbinv849.seq
 478992326     gbinv85.seq
 492815961     gbinv850.seq
 498278063     gbinv851.seq
 445601713     gbinv852.seq
 469989934     gbinv853.seq
 478205479     gbinv854.seq
 459587666     gbinv855.seq
 272670030     gbinv856.seq
 227990903     gbinv857.seq
 413244998     gbinv858.seq
 498213748     gbinv859.seq
 271721852     gbinv86.seq
 449979801     gbinv860.seq
 461330907     gbinv861.seq
 294874575     gbinv862.seq
 405670616     gbinv863.seq
 474471565     gbinv864.seq
 439625427     gbinv865.seq
 463229555     gbinv866.seq
 464851338     gbinv867.seq
 455511857     gbinv868.seq
 439389009     gbinv869.seq
 473206806     gbinv87.seq
 405283735     gbinv870.seq
 419761690     gbinv871.seq
 406996610     gbinv872.seq
 442305653     gbinv873.seq
 479961209     gbinv874.seq
 282852446     gbinv875.seq
 494971745     gbinv876.seq
 459071349     gbinv877.seq
 457510304     gbinv878.seq
 482562593     gbinv879.seq
 476783192     gbinv88.seq
 413357535     gbinv880.seq
 381806397     gbinv881.seq
 357962786     gbinv882.seq
 482830686     gbinv883.seq
 494826362     gbinv884.seq
 370208813     gbinv885.seq
 428586963     gbinv886.seq
 123105615     gbinv887.seq
 423910707     gbinv888.seq
 460666534     gbinv889.seq
 479030351     gbinv89.seq
 432539703     gbinv890.seq
 384196500     gbinv891.seq
 348330627     gbinv892.seq
 449196792     gbinv893.seq
 388541575     gbinv894.seq
 386427271     gbinv895.seq
 495791066     gbinv896.seq
 479478002     gbinv897.seq
  80923082     gbinv898.seq
 468644389     gbinv899.seq
 485749846     gbinv9.seq
 309386799     gbinv90.seq
 487921921     gbinv900.seq
 470328373     gbinv901.seq
 468642645     gbinv902.seq
 411136544     gbinv903.seq
 462696619     gbinv904.seq
 493415138     gbinv905.seq
 499955696     gbinv906.seq
 484026075     gbinv907.seq
 483632078     gbinv908.seq
 496808153     gbinv909.seq
 477840597     gbinv91.seq
 162547431     gbinv910.seq
 455355382     gbinv911.seq
 452744560     gbinv912.seq
 457356752     gbinv913.seq
 492140801     gbinv914.seq
 477236440     gbinv915.seq
 440746130     gbinv916.seq
 201920044     gbinv917.seq
 351798642     gbinv918.seq
 407318285     gbinv919.seq
 487392428     gbinv92.seq
 497577312     gbinv920.seq
 297816794     gbinv921.seq
 465053752     gbinv922.seq
 477543055     gbinv923.seq
 488522642     gbinv924.seq
 485383082     gbinv925.seq
 494197670     gbinv926.seq
 492976606     gbinv927.seq
 491252062     gbinv928.seq
 485879488     gbinv929.seq
 489703622     gbinv93.seq
 184862936     gbinv930.seq
 490499065     gbinv931.seq
 473434617     gbinv932.seq
 491357576     gbinv933.seq
 482466282     gbinv934.seq
 488062265     gbinv935.seq
 207127102     gbinv936.seq
 483701457     gbinv937.seq
 474847426     gbinv938.seq
 392959411     gbinv939.seq
 276099327     gbinv94.seq
 283167653     gbinv940.seq
 394326806     gbinv941.seq
 386741280     gbinv942.seq
 148537239     gbinv943.seq
 412230439     gbinv944.seq
 434620162     gbinv945.seq
 494101468     gbinv946.seq
 494548234     gbinv947.seq
 436233527     gbinv948.seq
 493245062     gbinv949.seq
 494542524     gbinv95.seq
 474858921     gbinv950.seq
  85346444     gbinv951.seq
 449524998     gbinv952.seq
 387985633     gbinv953.seq
 480105396     gbinv954.seq
 468490309     gbinv955.seq
  33888816     gbinv956.seq
 316525209     gbinv957.seq
 491028997     gbinv958.seq
 492549691     gbinv959.seq
 498462896     gbinv96.seq
 490858334     gbinv960.seq
 480371330     gbinv961.seq
 485115876     gbinv962.seq
 185082058     gbinv963.seq
 468046278     gbinv964.seq
 494868031     gbinv965.seq
 494549890     gbinv966.seq
 464492176     gbinv967.seq
 479062193     gbinv968.seq
 229136178     gbinv969.seq
 461069452     gbinv97.seq
 496620898     gbinv970.seq
 489401016     gbinv971.seq
 473706349     gbinv972.seq
 492517013     gbinv973.seq
 489752524     gbinv974.seq
 424310251     gbinv975.seq
 299174362     gbinv976.seq
 422084647     gbinv977.seq
 482494822     gbinv978.seq
 365475369     gbinv979.seq
 438465800     gbinv98.seq
 455578183     gbinv980.seq
 349492811     gbinv981.seq
 476634583     gbinv982.seq
 468337010     gbinv983.seq
 479253824     gbinv984.seq
 466281231     gbinv985.seq
 169424716     gbinv986.seq
 491880344     gbinv987.seq
 480699421     gbinv988.seq
 466860324     gbinv989.seq
 499997671     gbinv99.seq
 499811191     gbinv990.seq
  91086876     gbinv991.seq
 468973767     gbinv992.seq
 400459425     gbinv993.seq
1256520955     gbinv994.seq
1951209797     gbinv995.seq
1255792905     gbinv996.seq
 898357564     gbinv997.seq
 708100575     gbinv998.seq
 682258937     gbinv999.seq
 499997812     gbmam1.seq
  82797481     gbmam10.seq
 486132453     gbmam100.seq
 483844712     gbmam101.seq
 437064425     gbmam102.seq
 223540742     gbmam103.seq
 451994163     gbmam104.seq
 449442494     gbmam105.seq
 428332203     gbmam106.seq
 499999176     gbmam107.seq
 499994800     gbmam108.seq
 430729395     gbmam109.seq
  71269271     gbmam11.seq
 348089742     gbmam110.seq
 373183698     gbmam111.seq
 467160879     gbmam112.seq
 457054238     gbmam113.seq
 483676806     gbmam114.seq
 409916232     gbmam115.seq
 398303012     gbmam116.seq
 346344396     gbmam117.seq
 274828976     gbmam118.seq
 266926778     gbmam119.seq
  22560541     gbmam12.seq
 442156596     gbmam120.seq
 394957791     gbmam121.seq
 359859404     gbmam122.seq
 441833934     gbmam123.seq
 467877966     gbmam124.seq
 460914208     gbmam125.seq
  77886529     gbmam126.seq
 384330786     gbmam127.seq
 490312196     gbmam128.seq
 385325611     gbmam129.seq
   1268288     gbmam13.seq
 473911567     gbmam130.seq
 413152711     gbmam131.seq
 479361008     gbmam132.seq
 435411678     gbmam133.seq
 197832414     gbmam134.seq
 374823133     gbmam135.seq
 463547765     gbmam136.seq
 439985383     gbmam137.seq
 408172038     gbmam138.seq
 432812311     gbmam139.seq
 378312043     gbmam14.seq
 459597410     gbmam140.seq
 495156885     gbmam141.seq
 327564081     gbmam142.seq
 422791489     gbmam143.seq
 491401632     gbmam144.seq
 449317136     gbmam145.seq
 287465618     gbmam146.seq
 394362643     gbmam147.seq
 439407312     gbmam148.seq
 453590059     gbmam149.seq
 338653928     gbmam15.seq
 469351291     gbmam150.seq
  67268930     gbmam151.seq
 483520870     gbmam152.seq
 480679033     gbmam153.seq
 410124870     gbmam154.seq
 460089444     gbmam155.seq
 273447476     gbmam156.seq
 472899893     gbmam157.seq
 469419756     gbmam158.seq
 290267902     gbmam159.seq
 477859984     gbmam16.seq
 453331085     gbmam160.seq
 187958881     gbmam161.seq
 352138940     gbmam162.seq
 440262201     gbmam163.seq
 401683994     gbmam164.seq
 455777749     gbmam165.seq
 465167960     gbmam166.seq
  44571261     gbmam167.seq
 449684964     gbmam168.seq
 404827590     gbmam169.seq
 445458565     gbmam17.seq
 447228226     gbmam170.seq
 494282742     gbmam171.seq
 425898424     gbmam172.seq
 165392059     gbmam173.seq
 457263620     gbmam174.seq
 324046793     gbmam175.seq
 339102116     gbmam176.seq
 323096334     gbmam177.seq
 358506878     gbmam178.seq
 422099488     gbmam179.seq
 122412952     gbmam18.seq
 440058971     gbmam180.seq
 394948573     gbmam181.seq
 469038481     gbmam182.seq
 465364880     gbmam183.seq
 477461411     gbmam184.seq
 236798673     gbmam185.seq
 269398733     gbmam186.seq
 253603154     gbmam187.seq
 381680709     gbmam188.seq
 259094846     gbmam189.seq
 451114191     gbmam19.seq
 433914327     gbmam190.seq
 473689213     gbmam191.seq
 499762686     gbmam192.seq
 225944987     gbmam193.seq
 402292620     gbmam194.seq
 484267156     gbmam195.seq
 422021843     gbmam196.seq
 490305734     gbmam197.seq
 112546871     gbmam198.seq
 497927921     gbmam199.seq
 399233036     gbmam2.seq
 418062936     gbmam20.seq
 377275105     gbmam200.seq
 468953574     gbmam201.seq
 375382417     gbmam202.seq
 479246766     gbmam203.seq
 432957019     gbmam204.seq
 493590582     gbmam205.seq
 329856862     gbmam206.seq
 320418665     gbmam207.seq
 267180870     gbmam208.seq
 494229345     gbmam209.seq
 499818179     gbmam21.seq
 467852307     gbmam210.seq
 169801131     gbmam211.seq
 484790256     gbmam212.seq
 441563731     gbmam213.seq
 488307435     gbmam214.seq
 465828461     gbmam215.seq
 440072325     gbmam216.seq
 498165280     gbmam217.seq
 417880420     gbmam218.seq
 476061260     gbmam219.seq
 462376348     gbmam22.seq
 168979136     gbmam220.seq
 481542582     gbmam221.seq
 477958221     gbmam222.seq
 356503247     gbmam223.seq
 452219504     gbmam224.seq
 373237938     gbmam225.seq
 474361951     gbmam226.seq
 407382471     gbmam227.seq
 471880001     gbmam228.seq
 499955615     gbmam229.seq
 370510647     gbmam23.seq
 446124674     gbmam230.seq
 428305446     gbmam231.seq
 406513882     gbmam232.seq
 496219854     gbmam233.seq
 493963774     gbmam234.seq
 465230251     gbmam235.seq
 446296416     gbmam24.seq
 431104435     gbmam25.seq
 480602942     gbmam26.seq
 479109855     gbmam27.seq
 483903273     gbmam28.seq
 483307002     gbmam29.seq
 400559326     gbmam3.seq
  48405032     gbmam30.seq
 363174382     gbmam31.seq
 437246747     gbmam32.seq
 470828962     gbmam33.seq
 402408906     gbmam34.seq
 304109928     gbmam35.seq
 452443739     gbmam36.seq
 451303958     gbmam37.seq
 495648598     gbmam38.seq
 405636626     gbmam39.seq
 477148353     gbmam4.seq
 410457734     gbmam40.seq
 441553748     gbmam41.seq
 367146984     gbmam42.seq
 478421809     gbmam43.seq
 316388332     gbmam44.seq
 352226884     gbmam45.seq
 195247700     gbmam46.seq
 474022452     gbmam47.seq
 378020853     gbmam48.seq
 450136561     gbmam49.seq
 374653134     gbmam5.seq
 450750944     gbmam50.seq
 468132660     gbmam51.seq
 492835688     gbmam52.seq
 109335733     gbmam53.seq
   9943400     gbmam54.seq
  43988539     gbmam55.seq
  91321391     gbmam56.seq
  88809391     gbmam57.seq
   6363300     gbmam58.seq
  20997413     gbmam59.seq
 487713568     gbmam6.seq
 449446314     gbmam60.seq
 423547289     gbmam61.seq
 453840584     gbmam62.seq
 491149506     gbmam63.seq
 425479852     gbmam64.seq
 461110029     gbmam65.seq
 385606603     gbmam66.seq
 489901313     gbmam67.seq
 499999771     gbmam68.seq
 499999695     gbmam69.seq
 401181424     gbmam7.seq
  24821845     gbmam70.seq
 907465328     gbmam71.seq
 839494897     gbmam72.seq
 774395849     gbmam73.seq
 588873740     gbmam74.seq
 364960392     gbmam75.seq
 428298067     gbmam76.seq
 283039896     gbmam77.seq
 266822121     gbmam78.seq
 255007049     gbmam79.seq
 435129139     gbmam8.seq
 250435254     gbmam80.seq
 405637142     gbmam81.seq
 372091504     gbmam82.seq
 465555603     gbmam83.seq
 444923782     gbmam84.seq
 341582143     gbmam85.seq
 257946240     gbmam86.seq
 485829704     gbmam87.seq
 486026993     gbmam88.seq
 483298905     gbmam89.seq
 275778738     gbmam9.seq
 494677523     gbmam90.seq
 335874920     gbmam91.seq
 464872853     gbmam92.seq
 468294587     gbmam93.seq
 497569809     gbmam94.seq
 377746247     gbmam95.seq
 460747191     gbmam96.seq
 150130543     gbmam97.seq
 416665240     gbmam98.seq
 456214449     gbmam99.seq
  41193257     gbnew.txt
 499999378     gbpat1.seq
 499999978     gbpat10.seq
 499999036     gbpat100.seq
 499999497     gbpat101.seq
 499997525     gbpat102.seq
 228719622     gbpat103.seq
 500000251     gbpat104.seq
 500000174     gbpat105.seq
 499999692     gbpat106.seq
 335512957     gbpat107.seq
 499999829     gbpat108.seq
 499998762     gbpat109.seq
 499997333     gbpat11.seq
 210519190     gbpat110.seq
 499924108     gbpat111.seq
 499996658     gbpat112.seq
 174127543     gbpat113.seq
 499999918     gbpat114.seq
 499998561     gbpat115.seq
 499989497     gbpat116.seq
   8731691     gbpat117.seq
 499725370     gbpat118.seq
 382812818     gbpat119.seq
 179028539     gbpat12.seq
 499998895     gbpat120.seq
 499997232     gbpat121.seq
 499992686     gbpat122.seq
 499998996     gbpat123.seq
  56638317     gbpat124.seq
 499990147     gbpat125.seq
 499998975     gbpat126.seq
 208443590     gbpat127.seq
 499999685     gbpat128.seq
 499999695     gbpat129.seq
 499952440     gbpat13.seq
  59342739     gbpat130.seq
 499999559     gbpat131.seq
 499998871     gbpat132.seq
 488846606     gbpat133.seq
 499999119     gbpat134.seq
 499997991     gbpat135.seq
  28458779     gbpat136.seq
 499989962     gbpat137.seq
 385133978     gbpat138.seq
 500000109     gbpat139.seq
 499999601     gbpat14.seq
 500000185     gbpat140.seq
 148512030     gbpat141.seq
 500000250     gbpat142.seq
 314544047     gbpat143.seq
 499988381     gbpat144.seq
 499980283     gbpat145.seq
 409538104     gbpat146.seq
 500000154     gbpat147.seq
 499979543     gbpat148.seq
 125987771     gbpat149.seq
  62743871     gbpat15.seq
 499989559     gbpat150.seq
 500000056     gbpat151.seq
 499998857     gbpat152.seq
 499997730     gbpat153.seq
 169874593     gbpat154.seq
 500000030     gbpat155.seq
 426347836     gbpat156.seq
 500000000     gbpat157.seq
 500000126     gbpat158.seq
 499925666     gbpat159.seq
 499998571     gbpat16.seq
 353561488     gbpat160.seq
 500000068     gbpat161.seq
 499999656     gbpat162.seq
 291228009     gbpat163.seq
 499999878     gbpat164.seq
 499998552     gbpat165.seq
 500000136     gbpat166.seq
 102914300     gbpat167.seq
 499988270     gbpat168.seq
 499993882     gbpat169.seq
 499998754     gbpat17.seq
 499993951     gbpat170.seq
 499999217     gbpat171.seq
 301725661     gbpat172.seq
 499998840     gbpat173.seq
 499999048     gbpat174.seq
 499999583     gbpat175.seq
 319826941     gbpat176.seq
 499603168     gbpat177.seq
 499999554     gbpat178.seq
 499999721     gbpat179.seq
 422091553     gbpat18.seq
  13390185     gbpat180.seq
 497266519     gbpat181.seq
 499998694     gbpat182.seq
 499999975     gbpat183.seq
  86836463     gbpat184.seq
 499931836     gbpat185.seq
 499999973     gbpat186.seq
 499998094     gbpat187.seq
  39745949     gbpat188.seq
 499282890     gbpat189.seq
 499900441     gbpat19.seq
 499999947     gbpat190.seq
 499999685     gbpat191.seq
 499999339     gbpat192.seq
  96581488     gbpat193.seq
 499883376     gbpat194.seq
 499997498     gbpat195.seq
 499999338     gbpat196.seq
 499999006     gbpat197.seq
  90169329     gbpat198.seq
 499992935     gbpat199.seq
 499997915     gbpat2.seq
 499999227     gbpat20.seq
 499994277     gbpat200.seq
 499998512     gbpat201.seq
 499999293     gbpat202.seq
   4092526     gbpat203.seq
 499999756     gbpat204.seq
 499999459     gbpat205.seq
 500000244     gbpat206.seq
 478202129     gbpat207.seq
 500000054     gbpat208.seq
 499999577     gbpat209.seq
 499997918     gbpat21.seq
 321705067     gbpat210.seq
 499991396     gbpat211.seq
 499963719     gbpat212.seq
 350635988     gbpat213.seq
 497506292     gbpat214.seq
 499869540     gbpat215.seq
 421452571     gbpat216.seq
 499425936     gbpat217.seq
 499999361     gbpat218.seq
 336263474     gbpat219.seq
 347865365     gbpat22.seq
 499998549     gbpat220.seq
 499999040     gbpat221.seq
 499999617     gbpat222.seq
 361435050     gbpat223.seq
 499999662     gbpat224.seq
 494515367     gbpat225.seq
 341868206     gbpat226.seq
 499999744     gbpat227.seq
 500000159     gbpat228.seq
 366896749     gbpat229.seq
 499993280     gbpat23.seq
 499999946     gbpat230.seq
 499335751     gbpat231.seq
 389256092     gbpat232.seq
 499996721     gbpat233.seq
 500000056     gbpat234.seq
 498671374     gbpat235.seq
 499998420     gbpat236.seq
 500000264     gbpat237.seq
  21954671     gbpat238.seq
 499999949     gbpat239.seq
 499999339     gbpat24.seq
 500000107     gbpat240.seq
 499998899     gbpat241.seq
 499999346     gbpat242.seq
 488163097     gbpat243.seq
 499999639     gbpat244.seq
 499997091     gbpat245.seq
 499999375     gbpat246.seq
 187729792     gbpat247.seq
 500000259     gbpat248.seq
 499999167     gbpat249.seq
 499526466     gbpat25.seq
 481540759     gbpat250.seq
 495284053     gbpat251.seq
 500000161     gbpat252.seq
 389872169     gbpat253.seq
 499735576     gbpat254.seq
 499999196     gbpat255.seq
 499999984     gbpat256.seq
  90403216     gbpat257.seq
 499999452     gbpat258.seq
 500000091     gbpat259.seq
 499999496     gbpat26.seq
 353723582     gbpat260.seq
 166814538     gbpat27.seq
 499998142     gbpat28.seq
 500000116     gbpat29.seq
  61246183     gbpat3.seq
 213213665     gbpat30.seq
 499999775     gbpat31.seq
 406040030     gbpat32.seq
 499996095     gbpat33.seq
 500000174     gbpat34.seq
 126593683     gbpat35.seq
 499998040     gbpat36.seq
 499998229     gbpat37.seq
 499999552     gbpat38.seq
 140161176     gbpat39.seq
 499999948     gbpat4.seq
 499999717     gbpat40.seq
 493990713     gbpat41.seq
 494767586     gbpat42.seq
 499999907     gbpat43.seq
 149227782     gbpat44.seq
 499999126     gbpat45.seq
 499999712     gbpat46.seq
 499999032     gbpat47.seq
  87880943     gbpat48.seq
 499998824     gbpat49.seq
 499999652     gbpat5.seq
 499999856     gbpat50.seq
 499998939     gbpat51.seq
 130970228     gbpat52.seq
 499999687     gbpat53.seq
 499999084     gbpat54.seq
 185010162     gbpat55.seq
 499999726     gbpat56.seq
 499999154     gbpat57.seq
 137265710     gbpat58.seq
 499998902     gbpat59.seq
 419097863     gbpat6.seq
 499638184     gbpat60.seq
 429858568     gbpat61.seq
 499999504     gbpat62.seq
 321362270     gbpat63.seq
 499999431     gbpat64.seq
 500000186     gbpat65.seq
 306445054     gbpat66.seq
 499999595     gbpat67.seq
 499997159     gbpat68.seq
 144919043     gbpat69.seq
 499997742     gbpat7.seq
 499999495     gbpat70.seq
 226235202     gbpat71.seq
 499942763     gbpat72.seq
 500000257     gbpat73.seq
 309555677     gbpat74.seq
 499990988     gbpat75.seq
 499996904     gbpat76.seq
 259606120     gbpat77.seq
 499998418     gbpat78.seq
 499997914     gbpat79.seq
 499999759     gbpat8.seq
  36785301     gbpat80.seq
 500000256     gbpat81.seq
 474766116     gbpat82.seq
 500000188     gbpat83.seq
 331724995     gbpat84.seq
 499996925     gbpat85.seq
 312524826     gbpat86.seq
 499996683     gbpat87.seq
 499999699     gbpat88.seq
 499999219     gbpat89.seq
 317295937     gbpat9.seq
 205560847     gbpat90.seq
 499999444     gbpat91.seq
 455869832     gbpat92.seq
 499983563     gbpat93.seq
 252313647     gbpat94.seq
 499998721     gbpat95.seq
 499998225     gbpat96.seq
  83002461     gbpat97.seq
 499999689     gbpat98.seq
 498236426     gbpat99.seq
 499995952     gbphg1.seq
 499602147     gbphg2.seq
 499952159     gbphg3.seq
 499998091     gbphg4.seq
 499932688     gbphg5.seq
 439910924     gbphg6.seq
 499993624     gbpln1.seq
 269118160     gbpln10.seq
 320571253     gbpln100.seq
 909002041     gbpln1000.se
 625532226     gbpln1001.se
 945667285     gbpln1002.se
 953425673     gbpln1003.se
 821771932     gbpln1004.se
  49698387     gbpln1005.se
 685150900     gbpln1006.se
 568933028     gbpln1007.se
 539200627     gbpln1008.se
 586715338     gbpln1009.se
 286199717     gbpln101.seq
 614749900     gbpln1010.se
 568071235     gbpln1011.se
 625152379     gbpln1012.se
 586214093     gbpln1013.se
 746226297     gbpln1014.se
 808684289     gbpln1015.se
 907082738     gbpln1016.se
 776688084     gbpln1017.se
 793241146     gbpln1018.se
 698856855     gbpln1019.se
 277716232     gbpln102.seq
 613367841     gbpln1020.se
 674018925     gbpln1021.se
 609236554     gbpln1022.se
 576790824     gbpln1023.se
 632369035     gbpln1024.se
 377507388     gbpln1025.se
 669127647     gbpln1026.se
 466230786     gbpln1027.se
 475319448     gbpln1028.se
 488174615     gbpln1029.se
 499733064     gbpln103.seq
 318504234     gbpln1030.se
 198080616     gbpln1031.se
 752395252     gbpln1032.se
 890282442     gbpln1033.se
 626588938     gbpln1034.se
1004358314     gbpln1035.se
1028945403     gbpln1036.se
 838465031     gbpln1037.se
 950517848     gbpln1038.se
1082441571     gbpln1039.se
  79413547     gbpln104.seq
 789583362     gbpln1040.se
 950035126     gbpln1041.se
 853507174     gbpln1042.se
 659807143     gbpln1043.se
 902654822     gbpln1044.se
 890952840     gbpln1045.se
 721824595     gbpln1046.se
 785634143     gbpln1047.se
 909002041     gbpln1048.se
 625532226     gbpln1049.se
 391026516     gbpln105.seq
 945667285     gbpln1050.se
 953425673     gbpln1051.se
 821771932     gbpln1052.se
 459030822     gbpln1053.se
 304564503     gbpln1054.se
 571276484     gbpln1055.se
 841140963     gbpln1056.se
 813242081     gbpln1057.se
 666749684     gbpln1058.se
 786164670     gbpln1059.se
 362500947     gbpln106.seq
 685610369     gbpln1060.se
 780661607     gbpln1061.se
  20764769     gbpln1062.se
 494104735     gbpln1063.se
 487719162     gbpln1064.se
 475203143     gbpln1065.se
 481053138     gbpln1066.se
 491971790     gbpln1067.se
 174964113     gbpln1068.se
 489989534     gbpln1069.se
 390024685     gbpln107.seq
 498671512     gbpln1070.se
 498654651     gbpln1071.se
 472130628     gbpln1072.se
 484783481     gbpln1073.se
 174534000     gbpln1074.se
 458581762     gbpln1075.se
 487249767     gbpln1076.se
 488104602     gbpln1077.se
 490993470     gbpln1078.se
 458758162     gbpln1079.se
 341773035     gbpln108.seq
 243752045     gbpln1080.se
 496284751     gbpln1081.se
 470894249     gbpln1082.se
 456702113     gbpln1083.se
 468851576     gbpln1084.se
 498668450     gbpln1085.se
 246543998     gbpln1086.se
 403648092     gbpln1087.se
 420333785     gbpln1088.se
 486138903     gbpln1089.se
 199854531     gbpln109.seq
 461617634     gbpln1090.se
 214014145     gbpln1091.se
 461722879     gbpln1092.se
 470401116     gbpln1093.se
 494676807     gbpln1094.se
 492353397     gbpln1095.se
 492252090     gbpln1096.se
 345527633     gbpln1097.se
 463862211     gbpln1098.se
 494081914     gbpln1099.se
 499921575     gbpln11.seq
 483137958     gbpln110.seq
 498159633     gbpln1100.se
 430115650     gbpln1101.se
 489276790     gbpln1102.se
 408967072     gbpln1103.se
 100679825     gbpln1104.se
 437115790     gbpln1105.se
 441097064     gbpln1106.se
 442410423     gbpln1107.se
 451274488     gbpln1108.se
 251536188     gbpln1109.se
 493810296     gbpln111.seq
 422420084     gbpln1110.se
 498624032     gbpln1111.se
 493874495     gbpln1112.se
 461365034     gbpln1113.se
 368984003     gbpln1114.se
 327296104     gbpln1115.se
 393553638     gbpln1116.se
 494499660     gbpln1117.se
 339690898     gbpln1118.se
 442962794     gbpln1119.se
 497201313     gbpln112.seq
 443202510     gbpln1120.se
 473793657     gbpln1121.se
 487062259     gbpln1122.se
 402248903     gbpln1123.se
 441515110     gbpln1124.se
 497650728     gbpln1125.se
 425883871     gbpln1126.se
 363732401     gbpln1127.se
 454836169     gbpln1128.se
 473634452     gbpln1129.se
 262329677     gbpln113.seq
 202150508     gbpln1130.se
 470919442     gbpln1131.se
 485212352     gbpln1132.se
 473559497     gbpln1133.se
 436659501     gbpln1134.se
 334662145     gbpln1135.se
1096228946     gbpln1136.se
1065747702     gbpln1137.se
 978382754     gbpln1138.se
 970377846     gbpln1139.se
 410692589     gbpln114.seq
 932157798     gbpln1140.se
 878151181     gbpln1141.se
 874085482     gbpln1142.se
 829265283     gbpln1143.se
 863296713     gbpln1144.se
 823515697     gbpln1145.se
 815413879     gbpln1146.se
 693494316     gbpln1147.se
 690790562     gbpln1148.se
 669344399     gbpln1149.se
 485439355     gbpln115.seq
 682118426     gbpln1150.se
 617460029     gbpln1151.se
 613278884     gbpln1152.se
 540591172     gbpln1153.se
   1122504     gbpln1154.se
2012725365     gbpln1155.se
2313576157     gbpln1156.se
2199353951     gbpln1157.se
2096617949     gbpln1158.se
2106642321     gbpln1159.se
 339967820     gbpln116.seq
1745413840     gbpln1160.se
1943630374     gbpln1161.se
 482844875     gbpln1162.se
 172025956     gbpln1163.se
 477983665     gbpln1164.se
 479133534     gbpln1165.se
 489619458     gbpln1166.se
 483060400     gbpln1167.se
 446936322     gbpln1168.se
 207970098     gbpln1169.se
 410604091     gbpln117.seq
 460655312     gbpln1170.se
 364708423     gbpln1171.se
 339216276     gbpln1172.se
 386345512     gbpln1173.se
 311846069     gbpln1174.se
 213922978     gbpln1175.se
 547084404     gbpln1176.se
    299808     gbpln1177.se
 575997766     gbpln1178.se
 565057145     gbpln1179.se
 459875355     gbpln118.seq
 546636235     gbpln1180.se
 480735429     gbpln1181.se
 428611956     gbpln1182.se
 399987344     gbpln1183.se
 452012654     gbpln1184.se
 407833644     gbpln1185.se
  98616602     gbpln1186.se
 487406408     gbpln1187.se
 497106695     gbpln1188.se
 448383755     gbpln1189.se
 499126764     gbpln119.seq
 303860709     gbpln1190.se
  79771756     gbpln1191.se
 610632167     gbpln1192.se
 761027417     gbpln1193.se
 474894144     gbpln1194.se
 820639220     gbpln1195.se
 834487583     gbpln1196.se
 646503636     gbpln1197.se
 791663935     gbpln1198.se
 942730875     gbpln1199.se
 498718656     gbpln12.seq
 182005254     gbpln120.seq
 611720944     gbpln1200.se
 801353716     gbpln1201.se
 755984392     gbpln1202.se
 515950587     gbpln1203.se
 730612021     gbpln1204.se
 754956047     gbpln1205.se
 552345645     gbpln1206.se
 632515095     gbpln1207.se
 756169196     gbpln1208.se
 470848206     gbpln1209.se
 498973295     gbpln121.seq
 774219381     gbpln1210.se
 818888469     gbpln1211.se
 623527102     gbpln1212.se
 482321806     gbpln1213.se
 457141996     gbpln1214.se
 469346005     gbpln1215.se
 323635207     gbpln1216.se
 498969871     gbpln1217.se
 499320075     gbpln1218.se
 491583750     gbpln1219.se
 472540038     gbpln122.seq
 487185903     gbpln1220.se
 182220271     gbpln1221.se
 470298512     gbpln1222.se
 445986852     gbpln1223.se
 478230211     gbpln1224.se
 498502825     gbpln1225.se
 350464728     gbpln1226.se
 477385948     gbpln1227.se
 471883612     gbpln1228.se
 478940659     gbpln1229.se
 453105795     gbpln123.seq
 333989198     gbpln1230.se
 253005912     gbpln1231.se
 436323528     gbpln1232.se
 474062172     gbpln1233.se
 483649355     gbpln1234.se
 403534786     gbpln1235.se
 498881963     gbpln1236.se
 201620526     gbpln1237.se
 492206431     gbpln1238.se
 431247284     gbpln1239.se
 445429529     gbpln124.seq
 485331477     gbpln1240.se
 499128952     gbpln1241.se
 446943656     gbpln1242.se
 445678707     gbpln1243.se
 492931817     gbpln1244.se
 488728965     gbpln1245.se
 442513917     gbpln1246.se
 489986240     gbpln1247.se
 485052602     gbpln1248.se
 402707116     gbpln1249.se
 387853287     gbpln125.seq
 484676594     gbpln1250.se
 457870134     gbpln1251.se
 485317363     gbpln1252.se
 412333094     gbpln1253.se
 414213485     gbpln1254.se
 392278204     gbpln1255.se
 252441040     gbpln1256.se
 483659967     gbpln1257.se
 467301410     gbpln1258.se
 405580660     gbpln1259.se
 496158186     gbpln126.seq
 457115946     gbpln1260.se
  70190485     gbpln1261.se
 484439011     gbpln1262.se
 462114796     gbpln1263.se
 463366807     gbpln1264.se
 498031062     gbpln1265.se
 499810789     gbpln127.seq
 498685873     gbpln128.seq
 312787398     gbpln129.seq
 469955827     gbpln13.seq
 489314534     gbpln130.seq
 486163903     gbpln131.seq
 495247318     gbpln132.seq
 466228706     gbpln133.seq
 493826666     gbpln134.seq
 495604408     gbpln135.seq
 496499973     gbpln136.seq
 496138774     gbpln137.seq
 445715463     gbpln138.seq
 468986126     gbpln139.seq
 170594869     gbpln14.seq
 474996855     gbpln140.seq
 477161896     gbpln141.seq
 340348392     gbpln142.seq
 484314104     gbpln143.seq
 490914318     gbpln144.seq
 499456730     gbpln145.seq
 296665318     gbpln146.seq
 496742537     gbpln147.seq
 421717858     gbpln148.seq
 460820205     gbpln149.seq
 496172925     gbpln15.seq
 485737542     gbpln150.seq
 498612562     gbpln151.seq
 485304962     gbpln152.seq
 499875093     gbpln153.seq
 473509905     gbpln154.seq
 336937021     gbpln155.seq
 481782456     gbpln156.seq
 432553122     gbpln157.seq
 462278275     gbpln158.seq
 338514050     gbpln159.seq
 478637900     gbpln16.seq
 478622058     gbpln160.seq
 276524733     gbpln161.seq
 445190576     gbpln162.seq
 357274162     gbpln163.seq
 375890576     gbpln164.seq
 349832882     gbpln165.seq
 336189913     gbpln166.seq
 463740200     gbpln167.seq
 393476964     gbpln168.seq
 114312500     gbpln169.seq
 335223965     gbpln17.seq
 430007058     gbpln170.seq
 485882010     gbpln171.seq
 403795990     gbpln172.seq
 451516767     gbpln173.seq
 382592005     gbpln174.seq
 457726110     gbpln175.seq
 493420618     gbpln176.seq
 497715243     gbpln177.seq
 494847899     gbpln178.seq
 147147531     gbpln179.seq
 418823303     gbpln18.seq
 490696994     gbpln180.seq
 492045809     gbpln181.seq
 483427051     gbpln182.seq
 375787291     gbpln183.seq
 459748362     gbpln184.seq
 221425534     gbpln185.seq
 389473095     gbpln186.seq
 304823814     gbpln187.seq
 301383681     gbpln188.seq
 318452230     gbpln189.seq
 496016838     gbpln19.seq
 281218213     gbpln190.seq
 447505205     gbpln191.seq
 228460638     gbpln192.seq
 497423162     gbpln193.seq
 497849932     gbpln194.seq
 464951254     gbpln195.seq
 433570581     gbpln196.seq
  95385892     gbpln197.seq
 413234155     gbpln198.seq
 425115149     gbpln199.seq
 499978172     gbpln2.seq
 441181335     gbpln20.seq
 425560692     gbpln200.seq
 753151986     gbpln201.seq
 744282264     gbpln202.seq
 743804521     gbpln203.seq
 739735479     gbpln204.seq
 667988546     gbpln205.seq
 650329544     gbpln206.seq
 574703572     gbpln207.seq
 490264012     gbpln208.seq
 430773005     gbpln209.seq
 426926678     gbpln21.seq
 494631260     gbpln210.seq
 473019796     gbpln211.seq
 459249338     gbpln212.seq
 499044298     gbpln213.seq
 485436500     gbpln214.seq
 486548789     gbpln215.seq
 376622189     gbpln216.seq
 495017956     gbpln217.seq
 441622996     gbpln218.seq
 499758825     gbpln219.seq
 224879017     gbpln22.seq
 480460294     gbpln220.seq
 357789591     gbpln221.seq
 486574076     gbpln222.seq
 491804529     gbpln223.seq
 497949801     gbpln224.seq
 462309163     gbpln225.seq
 471986836     gbpln226.seq
 432694857     gbpln227.seq
     86418     gbpln228.seq
    361751     gbpln229.seq
 369920299     gbpln23.seq
 164981107     gbpln230.seq
  40089516     gbpln231.seq
  74918158     gbpln232.seq
 499999144     gbpln233.seq
 358009298     gbpln234.seq
 499999271     gbpln235.seq
 499998511     gbpln236.seq
 143990596     gbpln237.seq
 499999238     gbpln238.seq
 499585395     gbpln239.seq
 320631792     gbpln24.seq
 499958533     gbpln240.seq
 291024975     gbpln241.seq
 298756377     gbpln242.seq
 211415139     gbpln243.seq
 248588301     gbpln244.seq
 185671535     gbpln245.seq
 997331398     gbpln246.seq
  56517130     gbpln247.seq
 487357652     gbpln248.seq
 473525596     gbpln249.seq
 318185493     gbpln25.seq
 473209473     gbpln250.seq
 467870653     gbpln251.seq
 168324953     gbpln252.seq
 442170645     gbpln253.seq
 460425795     gbpln254.seq
 479222672     gbpln255.seq
  92564056     gbpln256.seq
 609356119     gbpln257.seq
 786074578     gbpln258.seq
 733167229     gbpln259.seq
 320810750     gbpln26.seq
 736239733     gbpln260.seq
 691575746     gbpln261.seq
 660133963     gbpln262.seq
 739031764     gbpln263.seq
 457972471     gbpln264.seq
 425775401     gbpln265.seq
 500000248     gbpln266.seq
  66360127     gbpln267.seq
 499999793     gbpln268.seq
 499998151     gbpln269.seq
 339200181     gbpln27.seq
 272089713     gbpln270.seq
 499999714     gbpln271.seq
 499998354     gbpln272.seq
  93853980     gbpln273.seq
 499997039     gbpln274.seq
 484569666     gbpln275.seq
 499998148     gbpln276.seq
 421018359     gbpln277.seq
 499992496     gbpln278.seq
 389627804     gbpln279.seq
 222826757     gbpln28.seq
 499999426     gbpln280.seq
 499998211     gbpln281.seq
 499996445     gbpln282.seq
  71886329     gbpln283.seq
 499998312     gbpln284.seq
 499860748     gbpln285.seq
 423263924     gbpln286.seq
 499999147     gbpln287.seq
 499999139     gbpln288.seq
 495860759     gbpln289.seq
 336947956     gbpln29.seq
 489179915     gbpln290.seq
 499831536     gbpln291.seq
 491589045     gbpln292.seq
 402785639     gbpln293.seq
 445924319     gbpln294.seq
 499811004     gbpln295.seq
   5650012     gbpln296.seq
 492254275     gbpln297.seq
 226945063     gbpln298.seq
 315805316     gbpln299.seq
 499877647     gbpln3.seq
 309835203     gbpln30.seq
 665291577     gbpln300.seq
 860028189     gbpln301.seq
 800605872     gbpln302.seq
 794469115     gbpln303.seq
 762933697     gbpln304.seq
 729969959     gbpln305.seq
 808217924     gbpln306.seq
 209360495     gbpln307.seq
 924325157     gbpln308.seq
1201978654     gbpln309.seq
 351268105     gbpln31.seq
1227268207     gbpln310.seq
1152253241     gbpln311.seq
1115248374     gbpln312.seq
1125506105     gbpln313.seq
1145303472     gbpln314.seq
 695608615     gbpln315.seq
 494749359     gbpln316.seq
 460644363     gbpln317.seq
 152680390     gbpln318.seq
 462987114     gbpln319.seq
 494721732     gbpln32.seq
 480457420     gbpln320.seq
 494737040     gbpln321.seq
 446441302     gbpln322.seq
 117077133     gbpln323.seq
 485280656     gbpln324.seq
 153318246     gbpln325.seq
 689933987     gbpln326.seq
 887561680     gbpln327.seq
 834970472     gbpln328.seq
 826391913     gbpln329.seq
 131032730     gbpln33.seq
 792513917     gbpln330.seq
 743209872     gbpln331.seq
 833073712     gbpln332.seq
    562407     gbpln333.seq
 665291577     gbpln334.seq
 860028189     gbpln335.seq
 800605872     gbpln336.seq
 794469115     gbpln337.seq
 762933697     gbpln338.seq
 729969959     gbpln339.seq
 346110597     gbpln34.seq
 808217924     gbpln340.seq
 189171058     gbpln341.seq
 663098252     gbpln342.seq
 855592604     gbpln343.seq
 807031053     gbpln344.seq
 793905039     gbpln345.seq
 773303164     gbpln346.seq
 718153248     gbpln347.seq
 804870210     gbpln348.seq
 661762125     gbpln349.seq
 384906966     gbpln35.seq
 840180304     gbpln350.seq
 796430245     gbpln351.seq
 779180715     gbpln352.seq
 761224530     gbpln353.seq
 725380245     gbpln354.seq
 792983451     gbpln355.seq
 652402241     gbpln356.seq
 831209396     gbpln357.seq
 783682955     gbpln358.seq
 775938782     gbpln359.seq
 205693142     gbpln36.seq
 741958804     gbpln360.seq
 700440901     gbpln361.seq
 788705159     gbpln362.seq
 683172483     gbpln363.seq
 872662143     gbpln364.seq
 815663229     gbpln365.seq
 813528167     gbpln366.seq
 780491844     gbpln367.seq
 734904793     gbpln368.seq
 816941948     gbpln369.seq
  85942873     gbpln37.seq
 635039454     gbpln370.seq
 824184474     gbpln371.seq
 768070182     gbpln372.seq
 758956882     gbpln373.seq
 732189331     gbpln374.seq
 706311232     gbpln375.seq
 766293442     gbpln376.seq
 651415133     gbpln377.seq
 830082304     gbpln378.seq
 783385752     gbpln379.seq
 477916829     gbpln38.seq
 770520351     gbpln380.seq
 753421970     gbpln381.seq
 699441547     gbpln382.seq
 784443196     gbpln383.seq
      4698     gbpln384.seq
 702337808     gbpln385.seq
 906907390     gbpln386.seq
 844110716     gbpln387.seq
 841780855     gbpln388.seq
 805270043     gbpln389.seq
 499904224     gbpln39.seq
 764396863     gbpln390.seq
 841492595     gbpln391.seq
 714482811     gbpln392.seq
 916127997     gbpln393.seq
 858459407     gbpln394.seq
 848936990     gbpln395.seq
 813129213     gbpln396.seq
 765593150     gbpln397.seq
 862731158     gbpln398.seq
 665885634     gbpln399.seq
 499974924     gbpln4.seq
 498817817     gbpln40.seq
 854365265     gbpln400.seq
 802776346     gbpln401.seq
 793295912     gbpln402.seq
 769246240     gbpln403.seq
 710912919     gbpln404.seq
 799876815     gbpln405.seq
 629668050     gbpln406.seq
 814320946     gbpln407.seq
 759349720     gbpln408.seq
 762512207     gbpln409.seq
 323729344     gbpln41.seq
 724647884     gbpln410.seq
 679679449     gbpln411.seq
 784312844     gbpln412.seq
 684180819     gbpln413.seq
 873292213     gbpln414.seq
 827422505     gbpln415.seq
 815925825     gbpln416.seq
 779009585     gbpln417.seq
 739747654     gbpln418.seq
 834950434     gbpln419.seq
 499081471     gbpln42.seq
 663096073     gbpln420.seq
 849628701     gbpln421.seq
 803882830     gbpln422.seq
 794420470     gbpln423.seq
 760127459     gbpln424.seq
 714663802     gbpln425.seq
 801095950     gbpln426.seq
 668869887     gbpln427.seq
 854770002     gbpln428.seq
 805931576     gbpln429.seq
 497391852     gbpln43.seq
 798923954     gbpln430.seq
 766411223     gbpln431.seq
 723133936     gbpln432.seq
 803351408     gbpln433.seq
 664176987     gbpln434.seq
 854339916     gbpln435.seq
 803900400     gbpln436.seq
 791449620     gbpln437.seq
 761145205     gbpln438.seq
 715062603     gbpln439.seq
 499428080     gbpln44.seq
 806379176     gbpln440.seq
 668964953     gbpln441.seq
 870939392     gbpln442.seq
 809408813     gbpln443.seq
 801514137     gbpln444.seq
 768794024     gbpln445.seq
 723644689     gbpln446.seq
 815153418     gbpln447.seq
 661177159     gbpln448.seq
 846934671     gbpln449.seq
 103294636     gbpln45.seq
 794708793     gbpln450.seq
 789781753     gbpln451.seq
 764576068     gbpln452.seq
 711115451     gbpln453.seq
 797517245     gbpln454.seq
 691953899     gbpln455.seq
 888406351     gbpln456.seq
 835271741     gbpln457.seq
 823533989     gbpln458.seq
 787819193     gbpln459.seq
 496566630     gbpln46.seq
 748786657     gbpln460.seq
 838184652     gbpln461.seq
 488802687     gbpln462.seq
 439661491     gbpln463.seq
 155752105     gbpln464.seq
 758806100     gbpln465.seq
 898446949     gbpln466.seq
 628489896     gbpln467.seq
1024113089     gbpln468.seq
1032878661     gbpln469.seq
 478891333     gbpln47.seq
 858694781     gbpln470.seq
 960391204     gbpln471.seq
1090094606     gbpln472.seq
 781959143     gbpln473.seq
 946995961     gbpln474.seq
 857542781     gbpln475.seq
 656405285     gbpln476.seq
 907889097     gbpln477.seq
 896386890     gbpln478.seq
 726432335     gbpln479.seq
 383840485     gbpln48.seq
 798296822     gbpln480.seq
 918393750     gbpln481.seq
 584961784     gbpln482.seq
 948865971     gbpln483.seq
 954536271     gbpln484.seq
 819735731     gbpln485.seq
 756588093     gbpln486.seq
 876067119     gbpln487.seq
 625446321     gbpln488.seq
 977801494     gbpln489.seq
 454048451     gbpln49.seq
 854357980     gbpln490.seq
 807732556     gbpln491.seq
 947696453     gbpln492.seq
1067629605     gbpln493.seq
 822222048     gbpln494.seq
 950272996     gbpln495.seq
 845138843     gbpln496.seq
 643846993     gbpln497.seq
 894745096     gbpln498.seq
 893352134     gbpln499.seq
 479833165     gbpln5.seq
 495221947     gbpln50.seq
 722578984     gbpln500.seq
 776227316     gbpln501.seq
 899750467     gbpln502.seq
 592059964     gbpln503.seq
 933986451     gbpln504.seq
 939527664     gbpln505.seq
 810117922     gbpln506.seq
 765938558     gbpln507.seq
 886537018     gbpln508.seq
 623519964     gbpln509.seq
 486126470     gbpln51.seq
 996940649     gbpln510.seq
1030190034     gbpln511.seq
 832828033     gbpln512.seq
 956342979     gbpln513.seq
1134286144     gbpln514.seq
 790513299     gbpln515.seq
 944161893     gbpln516.seq
 860035788     gbpln517.seq
 647268685     gbpln518.seq
 902239623     gbpln519.seq
 498663354     gbpln52.seq
 611029440     gbpln520.seq
 734907577     gbpln521.seq
 787834228     gbpln522.seq
 910724363     gbpln523.seq
 606016896     gbpln524.seq
 961485234     gbpln525.seq
1242775191     gbpln526.seq
 816670128     gbpln527.seq
 636658925     gbpln528.seq
 818591771     gbpln529.seq
 471931520     gbpln53.seq
 766580884     gbpln530.seq
 752100829     gbpln531.seq
 724519993     gbpln532.seq
 690955648     gbpln533.seq
 769738288     gbpln534.seq
 750738544     gbpln535.seq
 872184389     gbpln536.seq
 624480879     gbpln537.seq
 995069022     gbpln538.seq
1012956234     gbpln539.seq
 497321530     gbpln54.seq
 827074347     gbpln540.seq
 940621783     gbpln541.seq
1079418810     gbpln542.seq
 776922106     gbpln543.seq
 938380968     gbpln544.seq
 848757671     gbpln545.seq
 643572913     gbpln546.seq
 891714442     gbpln547.seq
 878638403     gbpln548.seq
 721632671     gbpln549.seq
 472649872     gbpln55.seq
 779156122     gbpln550.seq
 895553446     gbpln551.seq
 604678568     gbpln552.seq
 931006295     gbpln553.seq
 933660027     gbpln554.seq
 810459540     gbpln555.seq
 761872100     gbpln556.seq
 878702815     gbpln557.seq
 627081460     gbpln558.seq
 994320235     gbpln559.seq
 478648821     gbpln56.seq
 999434327     gbpln560.seq
 823789349     gbpln561.seq
 945629782     gbpln562.seq
1062113821     gbpln563.seq
 792298939     gbpln564.seq
 941851700     gbpln565.seq
 850142413     gbpln566.seq
 656955691     gbpln567.seq
 904094753     gbpln568.seq
 900193903     gbpln569.seq
  83738365     gbpln57.seq
 728906821     gbpln570.seq
 741172650     gbpln571.seq
 898719079     gbpln572.seq
 599002526     gbpln573.seq
 937117048     gbpln574.seq
 936021119     gbpln575.seq
 812696702     gbpln576.seq
 746628212     gbpln577.seq
 897168807     gbpln578.seq
 626698501     gbpln579.seq
 494333293     gbpln58.seq
1007072101     gbpln580.seq
1000831797     gbpln581.seq
 841918855     gbpln582.seq
 963426816     gbpln583.seq
1093654114     gbpln584.seq
 791118382     gbpln585.seq
 959940756     gbpln586.seq
 853263842     gbpln587.seq
 648051398     gbpln588.seq
 901282075     gbpln589.seq
 475215142     gbpln59.seq
 923491092     gbpln590.seq
 732477869     gbpln591.seq
 789987733     gbpln592.seq
 926022053     gbpln593.seq
 610840579     gbpln594.seq
 949759032     gbpln595.seq
 955444559     gbpln596.seq
 818480442     gbpln597.seq
 752251380     gbpln598.seq
 897893149     gbpln599.seq
 499997612     gbpln6.seq
 468208544     gbpln60.seq
 631111272     gbpln600.seq
1022032953     gbpln601.seq
1006306956     gbpln602.seq
 837035085     gbpln603.seq
 966140819     gbpln604.seq
1090560006     gbpln605.seq
 800164754     gbpln606.seq
 959884028     gbpln607.seq
 886916735     gbpln608.seq
 641540050     gbpln609.seq
 486858437     gbpln61.seq
 910168783     gbpln610.seq
 908785549     gbpln611.seq
 729527181     gbpln612.seq
 797552105     gbpln613.seq
 910975470     gbpln614.seq
 616026199     gbpln615.seq
 945685366     gbpln616.seq
 953145956     gbpln617.seq
 820081609     gbpln618.seq
 763165947     gbpln619.seq
 272302955     gbpln62.seq
 870898266     gbpln620.seq
 618200825     gbpln621.seq
1009123187     gbpln622.seq
1016689515     gbpln623.seq
 832912303     gbpln624.seq
 952656374     gbpln625.seq
1065835283     gbpln626.seq
 776075044     gbpln627.seq
 935940025     gbpln628.seq
 846831932     gbpln629.seq
 172902191     gbpln63.seq
 641399988     gbpln630.seq
 892709705     gbpln631.seq
 594848385     gbpln632.seq
 720169483     gbpln633.seq
 780564861     gbpln634.seq
 888344689     gbpln635.seq
 610800072     gbpln636.seq
 934713391     gbpln637.seq
1233388213     gbpln638.seq
 807523234     gbpln639.seq
 471233536     gbpln64.seq
     19542     gbpln640.seq
 757881986     gbpln641.seq
 889760627     gbpln642.seq
 635890046     gbpln643.seq
1007873898     gbpln644.seq
1015524558     gbpln645.seq
 836625022     gbpln646.seq
 959076059     gbpln647.seq
1077416379     gbpln648.seq
 789416089     gbpln649.seq
 455042321     gbpln65.seq
 958430056     gbpln650.seq
 877922843     gbpln651.seq
 648665455     gbpln652.seq
 907513209     gbpln653.seq
 904978028     gbpln654.seq
 727024880     gbpln655.seq
 789120540     gbpln656.seq
 898507915     gbpln657.seq
 617229811     gbpln658.seq
 942711764     gbpln659.seq
 488809223     gbpln66.seq
 964780021     gbpln660.seq
 818917331     gbpln661.seq
 755294557     gbpln662.seq
 882064051     gbpln663.seq
 627203691     gbpln664.seq
 993595919     gbpln665.seq
1021497440     gbpln666.seq
 827286497     gbpln667.seq
 962451301     gbpln668.seq
1082256067     gbpln669.seq
 355272263     gbpln67.seq
 781463827     gbpln670.seq
 919665368     gbpln671.seq
 852133929     gbpln672.seq
 645388382     gbpln673.seq
 905574854     gbpln674.seq
 906714977     gbpln675.seq
 718743537     gbpln676.seq
 787529633     gbpln677.seq
 910251919     gbpln678.seq
 608518276     gbpln679.seq
 200538454     gbpln68.seq
 934541265     gbpln680.seq
 954054955     gbpln681.seq
 806443717     gbpln682.seq
1009766480     gbpln683.seq
1318260463     gbpln684.seq
1253136609     gbpln685.seq
1066198175     gbpln686.seq
1119572655     gbpln687.seq
1040217505     gbpln688.seq
1310077288     gbpln689.seq
 377219536     gbpln69.seq
 955690374     gbpln690.seq
1230684440     gbpln691.seq
1179787958     gbpln692.seq
1125383520     gbpln693.seq
1051194518     gbpln694.seq
 965656648     gbpln695.seq
1110281977     gbpln696.seq
     32675     gbpln697.seq
 253174573     gbpln698.seq
 654245898     gbpln699.seq
 499932096     gbpln7.seq
 375192640     gbpln70.seq
 843080362     gbpln700.seq
 787261705     gbpln701.seq
 773098599     gbpln702.seq
 745082094     gbpln703.seq
 711612756     gbpln704.seq
 801222610     gbpln705.seq
    271156     gbpln706.seq
 398651709     gbpln707.seq
 315170317     gbpln708.seq
 306732013     gbpln709.seq
 386441749     gbpln71.seq
 319872292     gbpln710.seq
 286450423     gbpln711.seq
 220883441     gbpln712.seq
 470283415     gbpln713.seq
 475876375     gbpln714.seq
 499130345     gbpln715.seq
 460644363     gbpln716.seq
 359155255     gbpln717.seq
 399402445     gbpln718.seq
 501115666     gbpln719.seq
 475313842     gbpln72.seq
 413826113     gbpln720.seq
 367000227     gbpln721.seq
 238050627     gbpln722.seq
 352241749     gbpln723.seq
 298781185     gbpln724.seq
 490716477     gbpln725.seq
  86108082     gbpln726.seq
   9838016     gbpln727.seq
  10168205     gbpln728.seq
 766528189     gbpln729.seq
 452882572     gbpln73.seq
 422668510     gbpln730.seq
 133601641     gbpln731.seq
 756143249     gbpln732.seq
 878426054     gbpln733.seq
 631056251     gbpln734.seq
 993852367     gbpln735.seq
1020132695     gbpln736.seq
 830166807     gbpln737.seq
 955723315     gbpln738.seq
1057964328     gbpln739.seq
 125944249     gbpln74.seq
 784007552     gbpln740.seq
 947940191     gbpln741.seq
 857511193     gbpln742.seq
 649137171     gbpln743.seq
 903393879     gbpln744.seq
 908180396     gbpln745.seq
 721135945     gbpln746.seq
 786739709     gbpln747.seq
 918070756     gbpln748.seq
 603192844     gbpln749.seq
 476593700     gbpln75.seq
 938102555     gbpln750.seq
 955978436     gbpln751.seq
 813787878     gbpln752.seq
 639701128     gbpln753.seq
 468552552     gbpln754.seq
 499475628     gbpln755.seq
 498586674     gbpln756.seq
  20795443     gbpln757.seq
 768129678     gbpln758.seq
 891209633     gbpln759.seq
 434249982     gbpln76.seq
1017177961     gbpln760.seq
1036708108     gbpln761.seq
 980496603     gbpln762.seq
1096870510     gbpln763.seq
 964601805     gbpln764.seq
 883690282     gbpln765.seq
 879367269     gbpln766.seq
 922136688     gbpln767.seq
 805432021     gbpln768.seq
 912345991     gbpln769.seq
 440487400     gbpln77.seq
 954500353     gbpln770.seq
 944560088     gbpln771.seq
  29543025     gbpln772.seq
 404676307     gbpln773.seq
 499999890     gbpln774.seq
 499999850     gbpln775.seq
 488904614     gbpln776.seq
 499999978     gbpln777.seq
 499891015     gbpln778.seq
 499740648     gbpln779.seq
 444203819     gbpln78.seq
  87918239     gbpln780.seq
 499934093     gbpln781.seq
 499854409     gbpln782.seq
 499997250     gbpln783.seq
 318551009     gbpln784.seq
 499826435     gbpln785.seq
 500000245     gbpln786.seq
 499844103     gbpln787.seq
  24393075     gbpln788.seq
 499999605     gbpln789.seq
 189178941     gbpln79.seq
 499825411     gbpln790.seq
 499999567     gbpln791.seq
 162103019     gbpln792.seq
 499894627     gbpln793.seq
 499953800     gbpln794.seq
 499996210     gbpln795.seq
 500000163     gbpln796.seq
 499818754     gbpln797.seq
  85254278     gbpln798.seq
 499999609     gbpln799.seq
 226151851     gbpln8.seq
 460469415     gbpln80.seq
 499918622     gbpln800.seq
 499791013     gbpln801.seq
 324395413     gbpln802.seq
 499998457     gbpln803.seq
 499713076     gbpln804.seq
 499949138     gbpln805.seq
 252542858     gbpln806.seq
 499998246     gbpln807.seq
 499752611     gbpln808.seq
 499920287     gbpln809.seq
 440542307     gbpln81.seq
 475798836     gbpln810.seq
 477033429     gbpln811.seq
 674055631     gbpln812.seq
 865045961     gbpln813.seq
 815791689     gbpln814.seq
 802718902     gbpln815.seq
 776304595     gbpln816.seq
 721531499     gbpln817.seq
 809857060     gbpln818.seq
 679344023     gbpln819.seq
 452992006     gbpln82.seq
 873797632     gbpln820.seq
 820367220     gbpln821.seq
 806296382     gbpln822.seq
 775209384     gbpln823.seq
 744231520     gbpln824.seq
 817156402     gbpln825.seq
 771380170     gbpln826.seq
 913253142     gbpln827.seq
 634934982     gbpln828.seq
1019175188     gbpln829.seq
 497916786     gbpln83.seq
1023638564     gbpln830.seq
 822225605     gbpln831.seq
 961290952     gbpln832.seq
1090804562     gbpln833.seq
 813694518     gbpln834.seq
 962545328     gbpln835.seq
 873725319     gbpln836.seq
 673190932     gbpln837.seq
 905064826     gbpln838.seq
 908590682     gbpln839.seq
 437323942     gbpln84.seq
 742712720     gbpln840.seq
 793279946     gbpln841.seq
 934932909     gbpln842.seq
 640700840     gbpln843.seq
 961568346     gbpln844.seq
 952066709     gbpln845.seq
 827214105     gbpln846.seq
 455119462     gbpln847.seq
 225763299     gbpln848.seq
 606043562     gbpln849.seq
 158619558     gbpln85.seq
 672463179     gbpln850.seq
 670817639     gbpln851.seq
 780744112     gbpln852.seq
 709786566     gbpln853.seq
 699981616     gbpln854.seq
 605149309     gbpln855.seq
 587850601     gbpln856.seq
 521338174     gbpln857.seq
 584041491     gbpln858.seq
 586940642     gbpln859.seq
 495372469     gbpln86.seq
 609718059     gbpln860.seq
 520752754     gbpln861.seq
 615367059     gbpln862.seq
 678802710     gbpln863.seq
 605705354     gbpln864.seq
 527901083     gbpln865.seq
 594666478     gbpln866.seq
 615720930     gbpln867.seq
 576353841     gbpln868.seq
 633125967     gbpln869.seq
 472129613     gbpln87.seq
 548771038     gbpln870.seq
 692441980     gbpln871.seq
 738372777     gbpln872.seq
 858786663     gbpln873.seq
 737516179     gbpln874.seq
 745059844     gbpln875.seq
 651602930     gbpln876.seq
 604402506     gbpln877.seq
 664905906     gbpln878.seq
 584308833     gbpln879.seq
 477884160     gbpln88.seq
 534160881     gbpln880.seq
 630362065     gbpln881.seq
 371796208     gbpln882.seq
 630301723     gbpln883.seq
 687847932     gbpln884.seq
 613107925     gbpln885.seq
 667786022     gbpln886.seq
 650171877     gbpln887.seq
 580307352     gbpln888.seq
 567733852     gbpln889.seq
 460004048     gbpln89.seq
 731990320     gbpln890.seq
 671427710     gbpln891.seq
 677581065     gbpln892.seq
 698173275     gbpln893.seq
 745221978     gbpln894.seq
 582651724     gbpln895.seq
 703621804     gbpln896.seq
 577456793     gbpln897.seq
 645348755     gbpln898.seq
 738102834     gbpln899.seq
 500000209     gbpln9.seq
 430418757     gbpln90.seq
 718402114     gbpln900.seq
 581705855     gbpln901.seq
 731196778     gbpln902.seq
 559541977     gbpln903.seq
 676833493     gbpln904.seq
   5774756     gbpln905.seq
 777312364     gbpln906.seq
1006352199     gbpln907.seq
 962815279     gbpln908.seq
 975138624     gbpln909.seq
 457901320     gbpln91.seq
 906550423     gbpln910.seq
 790269619     gbpln911.seq
 956926034     gbpln912.seq
 908369814     gbpln913.seq
1035806383     gbpln914.seq
1095241384     gbpln915.seq
 889046375     gbpln916.seq
 920177986     gbpln917.seq
 934896187     gbpln918.seq
 972756494     gbpln919.seq
 433637010     gbpln92.seq
 639243888     gbpln920.seq
 839211114     gbpln921.seq
 802168717     gbpln922.seq
 677231763     gbpln923.seq
 740101369     gbpln924.seq
 642539818     gbpln925.seq
 835613563     gbpln926.seq
 284703679     gbpln927.seq
 252385105     gbpln928.seq
 408962039     gbpln929.seq
 498225038     gbpln93.seq
 329779393     gbpln930.seq
 332794404     gbpln931.seq
 418495189     gbpln932.seq
 443558619     gbpln933.seq
 449429603     gbpln934.seq
 403262216     gbpln935.seq
 477398793     gbpln936.seq
 434382503     gbpln937.seq
 443534393     gbpln938.seq
 444327807     gbpln939.seq
 107502928     gbpln94.seq
 486802329     gbpln940.seq
 482266994     gbpln941.seq
 434633991     gbpln942.seq
 412605137     gbpln943.seq
 487251002     gbpln944.seq
 475655683     gbpln945.seq
 480193090     gbpln946.seq
 445118180     gbpln947.seq
  94040671     gbpln948.seq
 598056431     gbpln949.seq
 449964742     gbpln95.seq
 774899230     gbpln950.seq
 723495076     gbpln951.seq
 714415062     gbpln952.seq
 677999217     gbpln953.seq
 629027473     gbpln954.seq
 732833308     gbpln955.seq
 468601370     gbpln956.seq
 493398867     gbpln957.seq
 474782478     gbpln958.seq
 380660145     gbpln959.seq
 422837725     gbpln96.seq
 467902932     gbpln960.seq
 216458898     gbpln961.seq
 767568440     gbpln962.seq
 890586335     gbpln963.seq
 628166165     gbpln964.seq
1008494769     gbpln965.seq
 987228439     gbpln966.seq
 843057145     gbpln967.seq
 959088226     gbpln968.seq
1080118899     gbpln969.seq
 383453843     gbpln97.seq
 790032688     gbpln970.seq
 943744807     gbpln971.seq
 858758922     gbpln972.seq
 664109823     gbpln973.seq
 920678547     gbpln974.seq
 888501596     gbpln975.seq
 739915903     gbpln976.seq
 788736235     gbpln977.seq
 944601114     gbpln978.seq
 621465898     gbpln979.seq
 376172115     gbpln98.seq
 948555730     gbpln980.seq
 954911742     gbpln981.seq
 815610130     gbpln982.seq
  39280848     gbpln983.seq
 752395251     gbpln984.seq
 890282441     gbpln985.seq
 626588937     gbpln986.seq
1004358313     gbpln987.seq
1028945402     gbpln988.seq
 838465030     gbpln989.seq
 326317072     gbpln99.seq
 950517847     gbpln990.seq
1082441570     gbpln991.seq
 789583361     gbpln992.seq
 950035125     gbpln993.seq
 853507173     gbpln994.seq
 659807142     gbpln995.seq
 902654821     gbpln996.seq
 890952839     gbpln997.seq
 721824594     gbpln998.seq
 785634142     gbpln999.seq
 148373644     gbpri1.seq
 499825465     gbpri10.seq
 499966274     gbpri11.seq
 248882813     gbpri12.seq
 499849548     gbpri13.seq
 352976263     gbpri14.seq
 162643079     gbpri15.seq
 494712989     gbpri16.seq
 499956353     gbpri17.seq
 499952905     gbpri18.seq
 499962231     gbpri19.seq
 499849640     gbpri2.seq
 254317986     gbpri20.seq
 317623611     gbpri21.seq
 301999314     gbpri22.seq
 491210460     gbpri23.seq
 445784960     gbpri24.seq
 381564599     gbpri25.seq
 343180411     gbpri26.seq
 476587789     gbpri27.seq
 474072403     gbpri28.seq
 368094098     gbpri29.seq
 499891275     gbpri3.seq
 499998059     gbpri30.seq
  73923753     gbpri31.seq
 499936200     gbpri32.seq
 445709575     gbpri33.seq
 427947001     gbpri34.seq
 376529642     gbpri35.seq
 483909975     gbpri36.seq
 361488390     gbpri37.seq
 388660134     gbpri38.seq
 448630862     gbpri39.seq
 499855408     gbpri4.seq
 499942041     gbpri40.seq
 307422469     gbpri41.seq
 314630532     gbpri42.seq
 499799975     gbpri43.seq
 499997851     gbpri44.seq
 213880827     gbpri45.seq
 499999780     gbpri46.seq
 499997086     gbpri47.seq
 316411730     gbpri48.seq
 499990113     gbpri49.seq
 499729176     gbpri5.seq
 499984580     gbpri50.seq
 327649314     gbpri51.seq
 258775295     gbpri52.seq
 499996624     gbpri53.seq
 499998722     gbpri54.seq
 499998633     gbpri55.seq
 499997340     gbpri56.seq
 499542469     gbpri57.seq
 169157710     gbpri58.seq
 393528728     gbpri6.seq
 499802910     gbpri7.seq
 499984899     gbpri8.seq
 499967070     gbpri9.seq
   1077401     gbrel.txt
 499840331     gbrod1.seq
 499998469     gbrod10.seq
 419878182     gbrod100.seq
 403492494     gbrod101.seq
 439526332     gbrod102.seq
 248164111     gbrod103.seq
 405939473     gbrod104.seq
 384447340     gbrod105.seq
 355679333     gbrod106.seq
 497729616     gbrod107.seq
 445498035     gbrod108.seq
 466416387     gbrod109.seq
   6033902     gbrod11.seq
 384594494     gbrod110.seq
 370764567     gbrod111.seq
 352341932     gbrod112.seq
 472534897     gbrod113.seq
 442899850     gbrod114.seq
 391247240     gbrod115.seq
 302308728     gbrod116.seq
 480858122     gbrod117.seq
 424097302     gbrod118.seq
 389168953     gbrod119.seq
 499806089     gbrod12.seq
 364557408     gbrod120.seq
 496236266     gbrod121.seq
 457035537     gbrod122.seq
 397907216     gbrod123.seq
 303919253     gbrod124.seq
 472719372     gbrod125.seq
 199611566     gbrod126.seq
 379735208     gbrod127.seq
 373874236     gbrod128.seq
 492612107     gbrod129.seq
 203924668     gbrod13.seq
 455685049     gbrod130.seq
 424015225     gbrod131.seq
 422109961     gbrod132.seq
 402489078     gbrod133.seq
 150585215     gbrod134.seq
 432875924     gbrod135.seq
 473809988     gbrod136.seq
 493341944     gbrod137.seq
 369899434     gbrod138.seq
 352286248     gbrod139.seq
 499995274     gbrod14.seq
 495134062     gbrod140.seq
 469349893     gbrod141.seq
 385134441     gbrod142.seq
 370752989     gbrod143.seq
 350782953     gbrod144.seq
 472215298     gbrod145.seq
 440418647     gbrod146.seq
 390673256     gbrod147.seq
 299732413     gbrod148.seq
 469102685     gbrod149.seq
 499997002     gbrod15.seq
 389834819     gbrod150.seq
 372942018     gbrod151.seq
 357041751     gbrod152.seq
 471802981     gbrod153.seq
 442335356     gbrod154.seq
 272062219     gbrod155.seq
 421368094     gbrod156.seq
 465159875     gbrod157.seq
 385490257     gbrod158.seq
 365814425     gbrod159.seq
 499999135     gbrod16.seq
 349038378     gbrod160.seq
 318450016     gbrod161.seq
 448518533     gbrod162.seq
 413714740     gbrod163.seq
 419290195     gbrod164.seq
 466211866     gbrod165.seq
 387893635     gbrod166.seq
 186742583     gbrod167.seq
 369103842     gbrod168.seq
 487915723     gbrod169.seq
 296366961     gbrod17.seq
 450102561     gbrod170.seq
 413892753     gbrod171.seq
 419378521     gbrod172.seq
 249506719     gbrod173.seq
 431031986     gbrod174.seq
 392811039     gbrod175.seq
 374963024     gbrod176.seq
 339853098     gbrod177.seq
 465902366     gbrod178.seq
 448509046     gbrod179.seq
 414584240     gbrod18.seq
 478088985     gbrod180.seq
  74225189     gbrod181.seq
 401026287     gbrod182.seq
 438450513     gbrod183.seq
 392223411     gbrod184.seq
 298791488     gbrod185.seq
 421037306     gbrod186.seq
 377024222     gbrod187.seq
 358182039     gbrod188.seq
 498127194     gbrod189.seq
 485622431     gbrod19.seq
 395007403     gbrod190.seq
 420940299     gbrod191.seq
 420418108     gbrod192.seq
 416033149     gbrod193.seq
 371638158     gbrod194.seq
 168940443     gbrod195.seq
 344507393     gbrod196.seq
 318954535     gbrod197.seq
 344554082     gbrod198.seq
 342695770     gbrod199.seq
 499801667     gbrod2.seq
 447177606     gbrod20.seq
 464792186     gbrod200.seq
 401018426     gbrod201.seq
 244981400     gbrod202.seq
 424020455     gbrod203.seq
 445077763     gbrod204.seq
 471066620     gbrod205.seq
 463756029     gbrod206.seq
 477523791     gbrod207.seq
 429214893     gbrod208.seq
 482809898     gbrod209.seq
 401874104     gbrod21.seq
 409881666     gbrod210.seq
 499005744     gbrod211.seq
 445425390     gbrod212.seq
 453009972     gbrod213.seq
 238222178     gbrod214.seq
 433121687     gbrod215.seq
 401444461     gbrod216.seq
 355166120     gbrod217.seq
 439733945     gbrod218.seq
 399262915     gbrod219.seq
 366906621     gbrod22.seq
 343303814     gbrod220.seq
 449604401     gbrod221.seq
 373291356     gbrod222.seq
 491021867     gbrod223.seq
 411878942     gbrod224.seq
 394783112     gbrod225.seq
 354215147     gbrod226.seq
 478827549     gbrod227.seq
 464689320     gbrod228.seq
 496457781     gbrod229.seq
 178573599     gbrod23.seq
 328639335     gbrod230.seq
 429295912     gbrod231.seq
 201904361     gbrod232.seq
 381229576     gbrod233.seq
 352252100     gbrod234.seq
 483911001     gbrod235.seq
 439271128     gbrod236.seq
 432391884     gbrod237.seq
 379422136     gbrod238.seq
 487314628     gbrod239.seq
 488460696     gbrod24.seq
 424101431     gbrod240.seq
 402251656     gbrod241.seq
 377306384     gbrod242.seq
 496030481     gbrod243.seq
 476084602     gbrod244.seq
 404173831     gbrod245.seq
 121703297     gbrod246.seq
 471718554     gbrod247.seq
 429849644     gbrod248.seq
 369205357     gbrod249.seq
 424418862     gbrod25.seq
 458471717     gbrod250.seq
 410175604     gbrod251.seq
 423146610     gbrod252.seq
 172228268     gbrod253.seq
 492401067     gbrod254.seq
 487467397     gbrod255.seq
 412574887     gbrod256.seq
 371643290     gbrod257.seq
 458445658     gbrod258.seq
 395932157     gbrod259.seq
 451727059     gbrod26.seq
 429793810     gbrod260.seq
 490297286     gbrod261.seq
 410121996     gbrod262.seq
 409184503     gbrod263.seq
 367837774     gbrod264.seq
 447381136     gbrod265.seq
 223327565     gbrod266.seq
 402425622     gbrod267.seq
 448449857     gbrod268.seq
 461815006     gbrod269.seq
 499112036     gbrod27.seq
 478700924     gbrod270.seq
 408314221     gbrod271.seq
 349093340     gbrod272.seq
 455227074     gbrod273.seq
 454883295     gbrod274.seq
 483614724     gbrod275.seq
 369373092     gbrod276.seq
 442583968     gbrod277.seq
 421061266     gbrod278.seq
 196273488     gbrod279.seq
 467946548     gbrod28.seq
 350815101     gbrod280.seq
 431195894     gbrod281.seq
 436876327     gbrod282.seq
 495700637     gbrod283.seq
 383320388     gbrod284.seq
 457101351     gbrod285.seq
 410386577     gbrod286.seq
 373894312     gbrod287.seq
 447245565     gbrod288.seq
 442554857     gbrod289.seq
 425428799     gbrod29.seq
 496529716     gbrod290.seq
 438732151     gbrod291.seq
 404017310     gbrod292.seq
 417018539     gbrod293.seq
 194574877     gbrod294.seq
 493375331     gbrod295.seq
 407058545     gbrod296.seq
 420360712     gbrod297.seq
 497137694     gbrod298.seq
 376315111     gbrod299.seq
 499860799     gbrod3.seq
 380509124     gbrod30.seq
 435156107     gbrod300.seq
 487765053     gbrod301.seq
 406428098     gbrod302.seq
 448028858     gbrod303.seq
 469164401     gbrod304.seq
 471219154     gbrod305.seq
 328217532     gbrod306.seq
 359291146     gbrod31.seq
 441031541     gbrod32.seq
 489661762     gbrod33.seq
 301541840     gbrod34.seq
 245696968     gbrod35.seq
 444533522     gbrod36.seq
 404901396     gbrod37.seq
 350079181     gbrod38.seq
 484303888     gbrod39.seq
 499965631     gbrod4.seq
 464197213     gbrod40.seq
 475600609     gbrod41.seq
 417011576     gbrod42.seq
 368092577     gbrod43.seq
 459234406     gbrod44.seq
 385583012     gbrod45.seq
 488265022     gbrod46.seq
 434197329     gbrod47.seq
 412800312     gbrod48.seq
 454365663     gbrod49.seq
 499960342     gbrod5.seq
 382748472     gbrod50.seq
 428038719     gbrod51.seq
 487918369     gbrod52.seq
 440586747     gbrod53.seq
 359290553     gbrod54.seq
 499997762     gbrod55.seq
 283716482     gbrod56.seq
 390007635     gbrod57.seq
 346418766     gbrod58.seq
 345548222     gbrod59.seq
  80291490     gbrod6.seq
 465925928     gbrod60.seq
 403537722     gbrod61.seq
 386823577     gbrod62.seq
 403462511     gbrod63.seq
 391812927     gbrod64.seq
 346719868     gbrod65.seq
 491742089     gbrod66.seq
 445010312     gbrod67.seq
 493387550     gbrod68.seq
 300864949     gbrod69.seq
 499846851     gbrod7.seq
 466768965     gbrod70.seq
 374387663     gbrod71.seq
 350248940     gbrod72.seq
 470230178     gbrod73.seq
 465917437     gbrod74.seq
 493546372     gbrod75.seq
 164945760     gbrod76.seq
 403745653     gbrod77.seq
 436915885     gbrod78.seq
 473498938     gbrod79.seq
 499742719     gbrod8.seq
 494867130     gbrod80.seq
 353125249     gbrod81.seq
 339090141     gbrod82.seq
 372648418     gbrod83.seq
 304437664     gbrod84.seq
 466850317     gbrod85.seq
 387285794     gbrod86.seq
 374061084     gbrod87.seq
 353646449     gbrod88.seq
 160857005     gbrod89.seq
 499945822     gbrod9.seq
 461956462     gbrod90.seq
 433837684     gbrod91.seq
 474478559     gbrod92.seq
 316311284     gbrod93.seq
 418985554     gbrod94.seq
 371050540     gbrod95.seq
 363244189     gbrod96.seq
 482685615     gbrod97.seq
 448001147     gbrod98.seq
 413360145     gbrod99.seq
 499999542     gbsts1.seq
 499998997     gbsts10.seq
 433593071     gbsts11.seq
 499995933     gbsts2.seq
  38302306     gbsts3.seq
 499998792     gbsts4.seq
 499998127     gbsts5.seq
 456725186     gbsts6.seq
 499997583     gbsts7.seq
 499998390     gbsts8.seq
  21009609     gbsts9.seq
 300842093     gbsyn1.seq
 484840372     gbsyn10.seq
 420813753     gbsyn11.seq
 490139440     gbsyn12.seq
 343340422     gbsyn13.seq
 372527348     gbsyn14.seq
 417861289     gbsyn15.seq
 448312981     gbsyn16.seq
 416378132     gbsyn17.seq
 453065790     gbsyn18.seq
 263307032     gbsyn19.seq
 343340424     gbsyn2.seq
 484840366     gbsyn20.seq
 420813747     gbsyn21.seq
 498979310     gbsyn22.seq
 499998971     gbsyn23.seq
 431545584     gbsyn24.seq
 499993129     gbsyn25.seq
 499997677     gbsyn26.seq
 499999488     gbsyn27.seq
 248643446     gbsyn28.seq
 423642793     gbsyn29.seq
 372527353     gbsyn3.seq
 417861297     gbsyn4.seq
 448312992     gbsyn5.seq
  81377357     gbsyn6.seq
 470781602     gbsyn7.seq
 317285242     gbsyn8.seq
 263307034     gbsyn9.seq
 499999170     gbtsa1.seq
 499997170     gbtsa10.seq
 499997439     gbtsa100.seq
 499999811     gbtsa101.seq
 499996108     gbtsa102.seq
 404671505     gbtsa103.seq
 499996434     gbtsa104.seq
 499998444     gbtsa105.seq
 499998535     gbtsa106.seq
 473627173     gbtsa107.seq
 499999949     gbtsa108.seq
 499998832     gbtsa109.seq
 499999169     gbtsa11.seq
 236669988     gbtsa110.seq
 499991596     gbtsa111.seq
 499999834     gbtsa112.seq
 499999770     gbtsa113.seq
 499998939     gbtsa114.seq
  34150369     gbtsa115.seq
 499995781     gbtsa116.seq
 499999069     gbtsa117.seq
 499994937     gbtsa118.seq
 470659755     gbtsa119.seq
 280571641     gbtsa12.seq
 499998218     gbtsa120.seq
 499998672     gbtsa121.seq
 499999924     gbtsa122.seq
 280313902     gbtsa123.seq
 499999116     gbtsa124.seq
 499998111     gbtsa125.seq
 499999818     gbtsa126.seq
 423256101     gbtsa127.seq
 499996305     gbtsa13.seq
 499999062     gbtsa14.seq
 161780319     gbtsa15.seq
 500000121     gbtsa16.seq
 499994772     gbtsa17.seq
 260516544     gbtsa18.seq
 499998904     gbtsa19.seq
 499999528     gbtsa2.seq
 500000036     gbtsa20.seq
 499995141     gbtsa21.seq
  72460486     gbtsa22.seq
 500000102     gbtsa23.seq
 499998850     gbtsa24.seq
 499998338     gbtsa25.seq
 284712908     gbtsa26.seq
 499999143     gbtsa27.seq
 499999640     gbtsa28.seq
  77188803     gbtsa29.seq
 147857334     gbtsa3.seq
 499999538     gbtsa30.seq
 499998402     gbtsa31.seq
 160181305     gbtsa32.seq
 499997331     gbtsa33.seq
 499993465     gbtsa34.seq
 499998837     gbtsa35.seq
 491487273     gbtsa36.seq
 499999905     gbtsa37.seq
 499998822     gbtsa38.seq
 499996375     gbtsa39.seq
 499998486     gbtsa4.seq
 229182509     gbtsa40.seq
 499998690     gbtsa41.seq
 499998905     gbtsa42.seq
 500000201     gbtsa43.seq
 177161025     gbtsa44.seq
 499998570     gbtsa45.seq
 499998681     gbtsa46.seq
 356101733     gbtsa47.seq
 499999382     gbtsa48.seq
 499999056     gbtsa49.seq
 499998583     gbtsa5.seq
 298479435     gbtsa50.seq
 499997916     gbtsa51.seq
 499995944     gbtsa52.seq
 402535227     gbtsa53.seq
 499999696     gbtsa54.seq
 499997992     gbtsa55.seq
 499998333     gbtsa56.seq
 343934196     gbtsa57.seq
 499999894     gbtsa58.seq
 499999312     gbtsa59.seq
  58524370     gbtsa6.seq
 499996663     gbtsa60.seq
 226713372     gbtsa61.seq
 499999722     gbtsa62.seq
 499999282     gbtsa63.seq
 260001225     gbtsa64.seq
 499999567     gbtsa65.seq
 464262990     gbtsa66.seq
 499998462     gbtsa67.seq
 499999620     gbtsa68.seq
 499998268     gbtsa69.seq
 499998361     gbtsa7.seq
 168770314     gbtsa70.seq
 499997567     gbtsa71.seq
 500000162     gbtsa72.seq
 499998185     gbtsa73.seq
   2512297     gbtsa74.seq
 499998125     gbtsa75.seq
 499999999     gbtsa76.seq
 131338866     gbtsa77.seq
 500000012     gbtsa78.seq
 499999875     gbtsa79.seq
 499999426     gbtsa8.seq
  34997856     gbtsa80.seq
 499999375     gbtsa81.seq
 499997355     gbtsa82.seq
 499996990     gbtsa83.seq
 499997400     gbtsa84.seq
  48843479     gbtsa85.seq
 499997725     gbtsa86.seq
 499999047     gbtsa87.seq
 499998830     gbtsa88.seq
  83128617     gbtsa89.seq
 274552792     gbtsa9.seq
 499998662     gbtsa90.seq
 390370134     gbtsa91.seq
 499998191     gbtsa92.seq
 499994249     gbtsa93.seq
 499998640     gbtsa94.seq
 208350764     gbtsa95.seq
 499999734     gbtsa96.seq
 499998253     gbtsa97.seq
 499996332     gbtsa98.seq
 230879944     gbtsa99.seq
   7264903     gbuna1.seq
 500000233     gbvrl1.seq
 499998151     gbvrl10.seq
 499965597     gbvrl100.seq
 499978466     gbvrl1000.se
 499992623     gbvrl1001.se
 499987150     gbvrl1002.se
 499997607     gbvrl1003.se
 103015898     gbvrl1004.se
 499989437     gbvrl1005.se
 499968564     gbvrl1006.se
 499991994     gbvrl1007.se
 499962014     gbvrl1008.se
 306684820     gbvrl1009.se
 199305267     gbvrl101.seq
 499983609     gbvrl1010.se
 499978495     gbvrl1011.se
 499996585     gbvrl1012.se
 323796102     gbvrl1013.se
 499996097     gbvrl1014.se
 499995867     gbvrl1015.se
 499996073     gbvrl1016.se
 390877592     gbvrl1017.se
 499956764     gbvrl1018.se
 499985980     gbvrl1019.se
 499953609     gbvrl102.seq
 499990425     gbvrl1020.se
 499995632     gbvrl1021.se
 109742592     gbvrl1022.se
 499986020     gbvrl103.seq
 499959314     gbvrl104.seq
 249090943     gbvrl105.seq
 499939981     gbvrl106.seq
 499966852     gbvrl107.seq
 499940198     gbvrl108.seq
 446769899     gbvrl109.seq
 499997476     gbvrl11.seq
 499974441     gbvrl110.seq
 499948725     gbvrl111.seq
 499934107     gbvrl112.seq
 147258184     gbvrl113.seq
 499943461     gbvrl114.seq
 499976537     gbvrl115.seq
 499974148     gbvrl116.seq
 499994437     gbvrl117.seq
  11476286     gbvrl118.seq
 499983278     gbvrl119.seq
 499999442     gbvrl12.seq
 499996166     gbvrl120.seq
 499936488     gbvrl121.seq
 261077215     gbvrl122.seq
 499988968     gbvrl123.seq
 499940262     gbvrl124.seq
 499965592     gbvrl125.seq
 499938126     gbvrl126.seq
  10734996     gbvrl127.seq
 499941734     gbvrl128.seq
 499974151     gbvrl129.seq
 167641599     gbvrl13.seq
 499998785     gbvrl130.seq
 499990414     gbvrl131.seq
 317225716     gbvrl132.seq
 499983028     gbvrl133.seq
 500000248     gbvrl134.seq
 499973059     gbvrl135.seq
 499982774     gbvrl136.seq
 499974584     gbvrl137.seq
 230219843     gbvrl138.seq
 499996809     gbvrl139.seq
 499998547     gbvrl14.seq
 499999895     gbvrl140.seq
 499991400     gbvrl141.seq
 325521675     gbvrl142.seq
 499966066     gbvrl143.seq
 499968818     gbvrl144.seq
 499980029     gbvrl145.seq
 301217579     gbvrl146.seq
 499979028     gbvrl147.seq
 499951747     gbvrl148.seq
 499978787     gbvrl149.seq
 499994457     gbvrl15.seq
 185957706     gbvrl150.seq
 499941783     gbvrl151.seq
 499966162     gbvrl152.seq
 499992597     gbvrl153.seq
 499935000     gbvrl154.seq
 263691398     gbvrl155.seq
 499994928     gbvrl156.seq
 499954320     gbvrl157.seq
 499996427     gbvrl158.seq
 240076943     gbvrl159.seq
 136584311     gbvrl16.seq
 499961956     gbvrl160.seq
 499981491     gbvrl161.seq
 499963988     gbvrl162.seq
 499971632     gbvrl163.seq
 268358607     gbvrl164.seq
 499934805     gbvrl165.seq
 499949514     gbvrl166.seq
 499960936     gbvrl167.seq
 499963528     gbvrl168.seq
 230151285     gbvrl169.seq
 499999955     gbvrl17.seq
 499994101     gbvrl170.seq
 499988195     gbvrl171.seq
 499987676     gbvrl172.seq
 338461002     gbvrl173.seq
 499943659     gbvrl174.seq
 499975406     gbvrl175.seq
 499981807     gbvrl176.seq
 135661324     gbvrl177.seq
 499984458     gbvrl178.seq
 499934410     gbvrl179.seq
 499999407     gbvrl18.seq
 499997472     gbvrl180.seq
 154420332     gbvrl181.seq
 499977508     gbvrl182.seq
 499960236     gbvrl183.seq
 499971863     gbvrl184.seq
 493177703     gbvrl185.seq
 499959914     gbvrl186.seq
 499941434     gbvrl187.seq
 499993381     gbvrl188.seq
 499983781     gbvrl189.seq
 321357845     gbvrl19.seq
   7164881     gbvrl190.seq
 499951054     gbvrl191.seq
 499995525     gbvrl192.seq
 499989838     gbvrl193.seq
 177077111     gbvrl194.seq
 499974440     gbvrl195.seq
 499955314     gbvrl196.seq
 499941593     gbvrl197.seq
 499938033     gbvrl198.seq
 268313859     gbvrl199.seq
 499998540     gbvrl2.seq
 499994055     gbvrl20.seq
 499967279     gbvrl200.seq
 499940413     gbvrl201.seq
 499968739     gbvrl202.seq
 499988730     gbvrl203.seq
 281417921     gbvrl204.seq
 499936963     gbvrl205.seq
 499936843     gbvrl206.seq
 499981582     gbvrl207.seq
 499939449     gbvrl208.seq
 313069220     gbvrl209.seq
 499997247     gbvrl21.seq
 499990924     gbvrl210.seq
 499969757     gbvrl211.seq
 499981840     gbvrl212.seq
 499978639     gbvrl213.seq
 286863642     gbvrl214.seq
 499955463     gbvrl215.seq
 499962575     gbvrl216.seq
 499934441     gbvrl217.seq
 499959609     gbvrl218.seq
 269696828     gbvrl219.seq
 348775947     gbvrl22.seq
 499937146     gbvrl220.seq
 499964321     gbvrl221.seq
 499946761     gbvrl222.seq
 499948348     gbvrl223.seq
 284413649     gbvrl224.seq
 499976691     gbvrl225.seq
 499995582     gbvrl226.seq
 499988912     gbvrl227.seq
 499983848     gbvrl228.seq
 284053962     gbvrl229.seq
 499450142     gbvrl23.seq
 499969618     gbvrl230.seq
 499977843     gbvrl231.seq
 499942680     gbvrl232.seq
 499962083     gbvrl233.seq
 274762187     gbvrl234.seq
 499944245     gbvrl235.seq
 499954875     gbvrl236.seq
 499950768     gbvrl237.seq
 499956874     gbvrl238.seq
 238633012     gbvrl239.seq
 500000252     gbvrl24.seq
 499995448     gbvrl240.seq
 499989641     gbvrl241.seq
 499943809     gbvrl242.seq
 499988572     gbvrl243.seq
 263144370     gbvrl244.seq
 499995908     gbvrl245.seq
 499977030     gbvrl246.seq
 499958714     gbvrl247.seq
 499989449     gbvrl248.seq
 264216698     gbvrl249.seq
 373295368     gbvrl25.seq
 499955591     gbvrl250.seq
 499964451     gbvrl251.seq
 499999998     gbvrl252.seq
 499950444     gbvrl253.seq
 263901940     gbvrl254.seq
 499948078     gbvrl255.seq
 499987219     gbvrl256.seq
 499936970     gbvrl257.seq
 137571832     gbvrl258.seq
 499982831     gbvrl259.seq
 499999371     gbvrl26.seq
 499939080     gbvrl260.seq
 499969896     gbvrl261.seq
 145373541     gbvrl262.seq
 499944789     gbvrl263.seq
 499944834     gbvrl264.seq
 499943615     gbvrl265.seq
 499940887     gbvrl266.seq
 499995153     gbvrl267.seq
 499956512     gbvrl268.seq
 245792518     gbvrl269.seq
 499995053     gbvrl27.seq
 499953049     gbvrl270.seq
 499944174     gbvrl271.seq
 499973163     gbvrl272.seq
 499964471     gbvrl273.seq
 254737531     gbvrl274.seq
 499945548     gbvrl275.seq
 499989034     gbvrl276.seq
 499953736     gbvrl277.seq
 499977438     gbvrl278.seq
 262019349     gbvrl279.seq
 317602416     gbvrl28.seq
 499933463     gbvrl280.seq
 499990210     gbvrl281.seq
 499937855     gbvrl282.seq
 499975100     gbvrl283.seq
 421440261     gbvrl284.seq
 499966811     gbvrl285.seq
 499951871     gbvrl286.seq
 499978471     gbvrl287.seq
 166973409     gbvrl288.seq
 499998669     gbvrl289.seq
 499964810     gbvrl29.seq
 499963504     gbvrl290.seq
 499995661     gbvrl291.seq
 228199220     gbvrl292.seq
 499958490     gbvrl293.seq
 499944718     gbvrl294.seq
 499971991     gbvrl295.seq
 309527775     gbvrl296.seq
 499990369     gbvrl297.seq
 499955562     gbvrl298.seq
 499941981     gbvrl299.seq
 499955093     gbvrl3.seq
 499997052     gbvrl30.seq
 269129889     gbvrl300.seq
 499977762     gbvrl301.seq
 499997321     gbvrl302.seq
 499937572     gbvrl303.seq
 372922730     gbvrl304.seq
 499974887     gbvrl305.seq
 499982000     gbvrl306.seq
 499995917     gbvrl307.seq
 386286627     gbvrl308.seq
 499936525     gbvrl309.seq
 497076198     gbvrl31.seq
 499958233     gbvrl310.seq
 499998969     gbvrl311.seq
 499997585     gbvrl312.seq
  25305568     gbvrl313.seq
 499981164     gbvrl314.seq
 499955514     gbvrl315.seq
 499946943     gbvrl316.seq
 270338422     gbvrl317.seq
 499980034     gbvrl318.seq
 499944255     gbvrl319.seq
 366812446     gbvrl32.seq
 499972587     gbvrl320.seq
 248926802     gbvrl321.seq
 499978680     gbvrl322.seq
 499960038     gbvrl323.seq
 499966634     gbvrl324.seq
 165140865     gbvrl325.seq
 499996983     gbvrl326.seq
 499987490     gbvrl327.seq
 499932435     gbvrl328.seq
 499983043     gbvrl329.seq
 499998875     gbvrl33.seq
  70478356     gbvrl330.seq
 499985482     gbvrl331.seq
 499982271     gbvrl332.seq
 499993251     gbvrl333.seq
 464589569     gbvrl334.seq
 499976134     gbvrl335.seq
 499990369     gbvrl336.seq
 499982067     gbvrl337.seq
 499946260     gbvrl338.seq
   2258854     gbvrl339.seq
 499964637     gbvrl34.seq
 499979084     gbvrl340.seq
 499962681     gbvrl341.seq
 499940572     gbvrl342.seq
 499979962     gbvrl343.seq
 147998614     gbvrl344.seq
 499943107     gbvrl345.seq
 499944766     gbvrl346.seq
 499942420     gbvrl347.seq
 191148406     gbvrl348.seq
 499952125     gbvrl349.seq
 435486164     gbvrl35.seq
 499976773     gbvrl350.seq
 499979837     gbvrl351.seq
 451551092     gbvrl352.seq
 499991371     gbvrl353.seq
 499955764     gbvrl354.seq
 499971764     gbvrl355.seq
 223023690     gbvrl356.seq
 499949824     gbvrl357.seq
 499971955     gbvrl358.seq
 499949989     gbvrl359.seq
 499998057     gbvrl36.seq
 361414694     gbvrl360.seq
 499935496     gbvrl361.seq
 499984221     gbvrl362.seq
 499968880     gbvrl363.seq
 499978636     gbvrl364.seq
 155017273     gbvrl365.seq
 499951093     gbvrl366.seq
 499962843     gbvrl367.seq
 499999212     gbvrl368.seq
 495803550     gbvrl369.seq
 499997620     gbvrl37.seq
 499942082     gbvrl370.seq
 499939299     gbvrl371.seq
 499991158     gbvrl372.seq
 497945656     gbvrl373.seq
 499939715     gbvrl374.seq
 499966433     gbvrl375.seq
 499972030     gbvrl376.seq
 278819116     gbvrl377.seq
 499996377     gbvrl378.seq
 499999639     gbvrl379.seq
 433961014     gbvrl38.seq
 499979741     gbvrl380.seq
 261049982     gbvrl381.seq
 499978082     gbvrl382.seq
 499949404     gbvrl383.seq
 499952080     gbvrl384.seq
 239418008     gbvrl385.seq
 499955375     gbvrl386.seq
 499966153     gbvrl387.seq
 499998887     gbvrl388.seq
 299833304     gbvrl389.seq
 499998080     gbvrl39.seq
 499939501     gbvrl390.seq
 499952427     gbvrl391.seq
 499954429     gbvrl392.seq
 223525698     gbvrl393.seq
 499982772     gbvrl394.seq
 499942227     gbvrl395.seq
 499991234     gbvrl396.seq
 163991040     gbvrl397.seq
 499974386     gbvrl398.seq
 499957448     gbvrl399.seq
 321247787     gbvrl4.seq
 500000122     gbvrl40.seq
 499961377     gbvrl400.seq
 233193920     gbvrl401.seq
 499993682     gbvrl402.seq
 499969645     gbvrl403.seq
 499981108     gbvrl404.seq
 459635509     gbvrl405.seq
 499973199     gbvrl406.seq
 499962209     gbvrl407.seq
 499952126     gbvrl408.seq
 417409995     gbvrl409.seq
 499995558     gbvrl41.seq
 499962203     gbvrl410.seq
 499947723     gbvrl411.seq
 499976941     gbvrl412.seq
 189711852     gbvrl413.seq
 499938266     gbvrl414.seq
 499958380     gbvrl415.seq
 499962146     gbvrl416.seq
 243596277     gbvrl417.seq
 499964428     gbvrl418.seq
 499964037     gbvrl419.seq
 329475168     gbvrl42.seq
 499948836     gbvrl420.seq
 210802204     gbvrl421.seq
 499960127     gbvrl422.seq
 499999289     gbvrl423.seq
 499948110     gbvrl424.seq
 403535967     gbvrl425.seq
 499939991     gbvrl426.seq
 499953362     gbvrl427.seq
 499989873     gbvrl428.seq
 298657701     gbvrl429.seq
 499936237     gbvrl43.seq
 499978636     gbvrl430.seq
 499937180     gbvrl431.seq
 499954499     gbvrl432.seq
 381587925     gbvrl433.seq
 499954373     gbvrl434.seq
 499967463     gbvrl435.seq
 499994960     gbvrl436.seq
 499997998     gbvrl437.seq
 121934588     gbvrl438.seq
 499969116     gbvrl439.seq
 499939118     gbvrl44.seq
 499934613     gbvrl440.seq
 499970979     gbvrl441.seq
 214653695     gbvrl442.seq
 499960755     gbvrl443.seq
 499990220     gbvrl444.seq
 499957630     gbvrl445.seq
 499994373     gbvrl446.seq
 499938676     gbvrl447.seq
 403781381     gbvrl448.seq
 499999483     gbvrl449.seq
 499999917     gbvrl45.seq
 499983330     gbvrl450.seq
 499968766     gbvrl451.seq
 283549802     gbvrl452.seq
 499810713     gbvrl453.seq
 499993823     gbvrl454.seq
 499977627     gbvrl455.seq
 161330000     gbvrl456.seq
 499955790     gbvrl457.seq
 499934992     gbvrl458.seq
 499996936     gbvrl459.seq
 300815668     gbvrl46.seq
 382528944     gbvrl460.seq
 499966318     gbvrl461.seq
 499970705     gbvrl462.seq
 499955085     gbvrl463.seq
 499994967     gbvrl464.seq
 276983359     gbvrl465.seq
 499944509     gbvrl466.seq
 500000051     gbvrl467.seq
 499989296     gbvrl468.seq
 277643308     gbvrl469.seq
 499940567     gbvrl47.seq
 499964665     gbvrl470.seq
 499940664     gbvrl471.seq
 499951144     gbvrl472.seq
 341374636     gbvrl473.seq
 499968700     gbvrl474.seq
 499999075     gbvrl475.seq
 499996805     gbvrl476.seq
 278899577     gbvrl477.seq
 499984534     gbvrl478.seq
 499965807     gbvrl479.seq
 499998051     gbvrl48.seq
 499963998     gbvrl480.seq
 288773413     gbvrl481.seq
 499947283     gbvrl482.seq
 499968170     gbvrl483.seq
 499941372     gbvrl484.seq
 456306599     gbvrl485.seq
 499985597     gbvrl486.seq
 499966716     gbvrl487.seq
 499992264     gbvrl488.seq
 465836575     gbvrl489.seq
 499935812     gbvrl49.seq
 499934844     gbvrl490.seq
 499955125     gbvrl491.seq
 499941641     gbvrl492.seq
 499955765     gbvrl493.seq
 499943487     gbvrl494.seq
 499946762     gbvrl495.seq
 236069058     gbvrl496.seq
 499970323     gbvrl497.seq
 499966789     gbvrl498.seq
 499998767     gbvrl499.seq
 499998593     gbvrl5.seq
 355752476     gbvrl50.seq
 499985203     gbvrl500.seq
 246470952     gbvrl501.seq
 499959912     gbvrl502.seq
 499942640     gbvrl503.seq
 499938256     gbvrl504.seq
 275365627     gbvrl505.seq
 499990311     gbvrl506.seq
 499942379     gbvrl507.seq
 499973191     gbvrl508.seq
 190447942     gbvrl509.seq
 499950759     gbvrl51.seq
 499961064     gbvrl510.seq
 499951209     gbvrl511.seq
 499999040     gbvrl512.seq
 222804234     gbvrl513.seq
 499998248     gbvrl514.seq
 499978671     gbvrl515.seq
 499962648     gbvrl516.seq
 235535776     gbvrl517.seq
 499991170     gbvrl518.seq
 499942925     gbvrl519.seq
 499966589     gbvrl52.seq
 499962777     gbvrl520.seq
 499936493     gbvrl521.seq
 330583028     gbvrl522.seq
 499983561     gbvrl523.seq
 499997891     gbvrl524.seq
 499968964     gbvrl525.seq
 499968270     gbvrl526.seq
 336235502     gbvrl527.seq
 499983179     gbvrl528.seq
 499977408     gbvrl529.seq
 499971655     gbvrl53.seq
 499957251     gbvrl530.seq
 499971290     gbvrl531.seq
 421514891     gbvrl532.seq
 499967311     gbvrl533.seq
 499991612     gbvrl534.seq
 499972498     gbvrl535.seq
 308739993     gbvrl536.seq
 499939381     gbvrl537.seq
 499857243     gbvrl538.seq
 499942851     gbvrl539.seq
 286186615     gbvrl54.seq
 346060834     gbvrl540.seq
 499977479     gbvrl541.seq
 499933320     gbvrl542.seq
 499947621     gbvrl543.seq
 499959965     gbvrl544.seq
 177482375     gbvrl545.seq
 499937968     gbvrl546.seq
 499966039     gbvrl547.seq
 499967302     gbvrl548.seq
 225797109     gbvrl549.seq
 499974989     gbvrl55.seq
 499951354     gbvrl550.seq
 499989725     gbvrl551.seq
 499953534     gbvrl552.seq
 304813953     gbvrl553.seq
 499972009     gbvrl554.seq
 499947583     gbvrl555.seq
 499970511     gbvrl556.seq
 201458818     gbvrl557.seq
 499935728     gbvrl558.seq
 499940715     gbvrl559.seq
 499971908     gbvrl56.seq
 499996979     gbvrl560.seq
 203044514     gbvrl561.seq
 499957524     gbvrl562.seq
 499957862     gbvrl563.seq
 499935649     gbvrl564.seq
 167843459     gbvrl565.seq
 499943953     gbvrl566.seq
 499994695     gbvrl567.seq
 499982436     gbvrl568.seq
 202644333     gbvrl569.seq
 499979218     gbvrl57.seq
 499962279     gbvrl570.seq
 499984458     gbvrl571.seq
 499849288     gbvrl572.seq
 289385659     gbvrl573.seq
 499955433     gbvrl574.seq
 499972776     gbvrl575.seq
 499960729     gbvrl576.seq
 323884385     gbvrl577.seq
 499971052     gbvrl578.seq
 499999671     gbvrl579.seq
 499979363     gbvrl58.seq
 499935106     gbvrl580.seq
 195039440     gbvrl581.seq
 499996075     gbvrl582.seq
 499963783     gbvrl583.seq
 499979828     gbvrl584.seq
 370387742     gbvrl585.seq
 499946369     gbvrl586.seq
 499963786     gbvrl587.seq
 499974348     gbvrl588.seq
 470969655     gbvrl589.seq
 197971901     gbvrl59.seq
 499973662     gbvrl590.seq
 499945709     gbvrl591.seq
 499990860     gbvrl592.seq
 172785517     gbvrl593.seq
 499983823     gbvrl594.seq
 499951573     gbvrl595.seq
 499972523     gbvrl596.seq
 338278878     gbvrl597.seq
 499988767     gbvrl598.seq
 499953466     gbvrl599.seq
 499999106     gbvrl6.seq
 499962811     gbvrl60.seq
 499948455     gbvrl600.seq
 420871612     gbvrl601.seq
 499979608     gbvrl602.seq
 499947423     gbvrl603.seq
 499996342     gbvrl604.seq
 489846013     gbvrl605.seq
 499975462     gbvrl606.seq
 499978048     gbvrl607.seq
 499980248     gbvrl608.seq
 499935134     gbvrl609.seq
 499945319     gbvrl61.seq
 499979864     gbvrl610.seq
  61806670     gbvrl611.seq
 492738081     gbvrl612.seq
 499973021     gbvrl613.seq
 253869488     gbvrl614.seq
  76815845     gbvrl615.seq
 499979979     gbvrl616.seq
 499965262     gbvrl617.seq
 499992805     gbvrl618.seq
 252210177     gbvrl619.seq
 499953384     gbvrl62.seq
 499979104     gbvrl620.seq
 499999809     gbvrl621.seq
 499964201     gbvrl622.seq
 280382976     gbvrl623.seq
 499973547     gbvrl624.seq
 499964780     gbvrl625.seq
 499974018     gbvrl626.seq
 175135386     gbvrl627.seq
 499973309     gbvrl628.seq
 499989608     gbvrl629.seq
 499986279     gbvrl63.seq
 499960757     gbvrl630.seq
 147804991     gbvrl631.seq
 499996522     gbvrl632.seq
 499971122     gbvrl633.seq
 499973686     gbvrl634.seq
 259661349     gbvrl635.seq
 499963274     gbvrl636.seq
 499968852     gbvrl637.seq
 499994020     gbvrl638.seq
 141758832     gbvrl639.seq
 185894447     gbvrl64.seq
 499987428     gbvrl640.seq
 499986183     gbvrl641.seq
 499969984     gbvrl642.seq
 119837707     gbvrl643.seq
 146296175     gbvrl644.seq
 499967013     gbvrl645.seq
 499996633     gbvrl646.seq
 499970769     gbvrl647.seq
 126388424     gbvrl648.seq
 499995120     gbvrl649.seq
 499959229     gbvrl65.seq
 499972873     gbvrl650.seq
 499969488     gbvrl651.seq
 471353671     gbvrl652.seq
 499970592     gbvrl653.seq
 499981063     gbvrl654.seq
 499965713     gbvrl655.seq
 148126103     gbvrl656.seq
 499995662     gbvrl657.seq
 499985048     gbvrl658.seq
 499985400     gbvrl659.seq
 499986278     gbvrl66.seq
 363308908     gbvrl660.seq
 499975349     gbvrl661.seq
 499995044     gbvrl662.seq
 499982421     gbvrl663.seq
 499984336     gbvrl664.seq
 281596337     gbvrl665.seq
 499978306     gbvrl666.seq
 499974465     gbvrl667.seq
 499971452     gbvrl668.seq
 499960503     gbvrl669.seq
 499993745     gbvrl67.seq
  56386242     gbvrl670.seq
 499993829     gbvrl671.seq
 499998290     gbvrl672.seq
 499998944     gbvrl673.seq
 404134109     gbvrl674.seq
 499976158     gbvrl675.seq
 499992691     gbvrl676.seq
 499970768     gbvrl677.seq
 358552958     gbvrl678.seq
 499994976     gbvrl679.seq
 499995086     gbvrl68.seq
 499995631     gbvrl680.seq
 499993106     gbvrl681.seq
 247357210     gbvrl682.seq
 499986293     gbvrl683.seq
 499984816     gbvrl684.seq
 499967239     gbvrl685.seq
 314635508     gbvrl686.seq
 499961383     gbvrl687.seq
 499984158     gbvrl688.seq
 499986788     gbvrl689.seq
 154635633     gbvrl69.seq
 288025255     gbvrl690.seq
 499970230     gbvrl691.seq
 499981579     gbvrl692.seq
 499998615     gbvrl693.seq
 285158648     gbvrl694.seq
 499967026     gbvrl695.seq
 499980568     gbvrl696.seq
 499961738     gbvrl697.seq
 291559508     gbvrl698.seq
 499973581     gbvrl699.seq
 499999157     gbvrl7.seq
 499949097     gbvrl70.seq
 499977906     gbvrl700.seq
 499972170     gbvrl701.seq
 289138070     gbvrl702.seq
 499966396     gbvrl703.seq
 499987226     gbvrl704.seq
 499974314     gbvrl705.seq
 280112559     gbvrl706.seq
 499989154     gbvrl707.seq
 499975570     gbvrl708.seq
 499962745     gbvrl709.seq
 499970481     gbvrl71.seq
 499988688     gbvrl710.seq
 137977402     gbvrl711.seq
 499991812     gbvrl712.seq
 499998884     gbvrl713.seq
 499998440     gbvrl714.seq
 499965827     gbvrl715.seq
  78679008     gbvrl716.seq
 499970339     gbvrl717.seq
 499996499     gbvrl718.seq
 499984600     gbvrl719.seq
 499936156     gbvrl72.seq
 499965087     gbvrl720.seq
  98844236     gbvrl721.seq
 499992259     gbvrl722.seq
 499990217     gbvrl723.seq
 499966023     gbvrl724.seq
 118505686     gbvrl725.seq
 499988359     gbvrl726.seq
 499970326     gbvrl727.seq
 499999323     gbvrl728.seq
 128891738     gbvrl729.seq
 411246280     gbvrl73.seq
 499961344     gbvrl730.seq
 499965246     gbvrl731.seq
 499963743     gbvrl732.seq
 129520828     gbvrl733.seq
 499989649     gbvrl734.seq
 499990091     gbvrl735.seq
 499993045     gbvrl736.seq
 499997622     gbvrl737.seq
 154992715     gbvrl738.seq
 499990389     gbvrl739.seq
 499939700     gbvrl74.seq
 499997500     gbvrl740.seq
 499978686     gbvrl741.seq
 259989341     gbvrl742.seq
 499978661     gbvrl743.seq
 499961935     gbvrl744.seq
 499976715     gbvrl745.seq
 499974967     gbvrl746.seq
 315477211     gbvrl747.seq
 499978445     gbvrl748.seq
 499985683     gbvrl749.seq
 499986004     gbvrl75.seq
 499975835     gbvrl750.seq
 400008726     gbvrl751.seq
 499960836     gbvrl752.seq
 499971777     gbvrl753.seq
 499983297     gbvrl754.seq
 499998600     gbvrl755.seq
 499963451     gbvrl756.seq
 499965104     gbvrl757.seq
 128009138     gbvrl758.seq
 499998201     gbvrl759.seq
 499990444     gbvrl76.seq
 499994429     gbvrl760.seq
 499974041     gbvrl761.seq
 499966031     gbvrl762.seq
 499992532     gbvrl763.seq
 478191694     gbvrl764.seq
 499977958     gbvrl765.seq
 499968023     gbvrl766.seq
 500000199     gbvrl767.seq
 499961570     gbvrl768.seq
 392138866     gbvrl769.seq
 362638413     gbvrl77.seq
 499987579     gbvrl770.seq
 499987807     gbvrl771.seq
 499979629     gbvrl772.seq
 499962956     gbvrl773.seq
  81093847     gbvrl774.seq
 499961952     gbvrl775.seq
 499966425     gbvrl776.seq
 499991821     gbvrl777.seq
 499987134     gbvrl778.seq
 499973524     gbvrl779.seq
 499934737     gbvrl78.seq
 326640176     gbvrl780.seq
 499967744     gbvrl781.seq
 499988602     gbvrl782.seq
 499970539     gbvrl783.seq
 499992754     gbvrl784.seq
 368120436     gbvrl785.seq
 499961814     gbvrl786.seq
 499975293     gbvrl787.seq
 499964890     gbvrl788.seq
 499986361     gbvrl789.seq
 499942184     gbvrl79.seq
  24043791     gbvrl790.seq
 499969458     gbvrl791.seq
 499992114     gbvrl792.seq
 499979236     gbvrl793.seq
 499988026     gbvrl794.seq
  22590184     gbvrl795.seq
 499988892     gbvrl796.seq
 499958582     gbvrl797.seq
 499998891     gbvrl798.seq
 499984766     gbvrl799.seq
 499995346     gbvrl8.seq
 499984164     gbvrl80.seq
  46828118     gbvrl800.seq
 499995703     gbvrl801.seq
 499968334     gbvrl802.seq
 499993852     gbvrl803.seq
 499996602     gbvrl804.seq
  10933612     gbvrl805.seq
 499984317     gbvrl806.seq
 499959785     gbvrl807.seq
 499997386     gbvrl808.seq
 242993684     gbvrl809.seq
 326677188     gbvrl81.seq
 499985905     gbvrl810.seq
 499960615     gbvrl811.seq
 499973456     gbvrl812.seq
 499990857     gbvrl813.seq
  52232764     gbvrl814.seq
 499964490     gbvrl815.seq
 499964464     gbvrl816.seq
 500000082     gbvrl817.seq
 499999836     gbvrl818.seq
  59983696     gbvrl819.seq
 499999804     gbvrl82.seq
 499995720     gbvrl820.seq
 499998218     gbvrl821.seq
 499975379     gbvrl822.seq
 191184922     gbvrl823.seq
 499990027     gbvrl824.seq
 499998072     gbvrl825.seq
 499964642     gbvrl826.seq
 187063445     gbvrl827.seq
 499994300     gbvrl828.seq
 499976615     gbvrl829.seq
 499939926     gbvrl83.seq
 499991093     gbvrl830.seq
 194078795     gbvrl831.seq
 499980969     gbvrl832.seq
 499976110     gbvrl833.seq
 499981568     gbvrl834.seq
 223831052     gbvrl835.seq
 499983048     gbvrl836.seq
 499967469     gbvrl837.seq
 499961975     gbvrl838.seq
 224403955     gbvrl839.seq
 499971457     gbvrl84.seq
 499994169     gbvrl840.seq
 499964420     gbvrl841.seq
 499989233     gbvrl842.seq
 191992835     gbvrl843.seq
 499979086     gbvrl844.seq
 499980339     gbvrl845.seq
 499975396     gbvrl846.seq
 197260979     gbvrl847.seq
 499967952     gbvrl848.seq
 499999616     gbvrl849.seq
  44987478     gbvrl85.seq
 499989909     gbvrl850.seq
 499994460     gbvrl851.seq
 499971439     gbvrl852.seq
 210537192     gbvrl853.seq
 499994396     gbvrl854.seq
 499960629     gbvrl855.seq
 499988409     gbvrl856.seq
 373194307     gbvrl857.seq
 499970312     gbvrl858.seq
 499995829     gbvrl859.seq
 499969553     gbvrl86.seq
 499993275     gbvrl860.seq
 117607066     gbvrl861.seq
 499986598     gbvrl862.seq
 499999959     gbvrl863.seq
 499997940     gbvrl864.seq
 307125894     gbvrl865.seq
 499969220     gbvrl866.seq
 499999878     gbvrl867.seq
 499997691     gbvrl868.seq
 499999155     gbvrl869.seq
 499960619     gbvrl87.seq
 499967714     gbvrl870.seq
 499971607     gbvrl871.seq
  78929583     gbvrl872.seq
 499973526     gbvrl873.seq
 499969721     gbvrl874.seq
 499967615     gbvrl875.seq
 286698002     gbvrl876.seq
 499965605     gbvrl877.seq
 499984803     gbvrl878.seq
 499981918     gbvrl879.seq
 499981955     gbvrl88.seq
 499964944     gbvrl880.seq
 190811873     gbvrl881.seq
 499983057     gbvrl882.seq
 499961583     gbvrl883.seq
 499995798     gbvrl884.seq
 499984248     gbvrl885.seq
 148129947     gbvrl886.seq
 499962549     gbvrl887.seq
 499994082     gbvrl888.seq
 499988751     gbvrl889.seq
 185029139     gbvrl89.seq
 499972397     gbvrl890.seq
 499984666     gbvrl891.seq
   1810975     gbvrl892.seq
 499959094     gbvrl893.seq
 499983038     gbvrl894.seq
 499992901     gbvrl895.seq
 422170540     gbvrl896.seq
 499975132     gbvrl897.seq
 499995567     gbvrl898.seq
 499995290     gbvrl899.seq
 315016584     gbvrl9.seq
 499995904     gbvrl90.seq
 199372111     gbvrl900.seq
 499993381     gbvrl901.seq
 499985259     gbvrl902.seq
 499997469     gbvrl903.seq
 156460575     gbvrl904.seq
 499977500     gbvrl905.seq
 499967878     gbvrl906.seq
 499993605     gbvrl907.seq
 499966067     gbvrl908.seq
 400314761     gbvrl909.seq
 499959795     gbvrl91.seq
 499959612     gbvrl910.seq
 499980583     gbvrl911.seq
 499990051     gbvrl912.seq
 499973318     gbvrl913.seq
 344871922     gbvrl914.seq
 499974503     gbvrl915.seq
 499967581     gbvrl916.seq
 499994492     gbvrl917.seq
 266771288     gbvrl918.seq
 499966648     gbvrl919.seq
 499969371     gbvrl92.seq
 499976744     gbvrl920.seq
 499979775     gbvrl921.seq
 154951226     gbvrl922.seq
 499974294     gbvrl923.seq
 499970766     gbvrl924.seq
 499960407     gbvrl925.seq
 499987392     gbvrl926.seq
 499964738     gbvrl927.seq
 499979298     gbvrl928.seq
 111555976     gbvrl929.seq
 191652362     gbvrl93.seq
 499971139     gbvrl930.seq
 499975855     gbvrl931.seq
 499993356     gbvrl932.seq
 499982807     gbvrl933.seq
 499962023     gbvrl934.seq
 499993395     gbvrl935.seq
 110227887     gbvrl936.seq
 499977836     gbvrl937.seq
 499988322     gbvrl938.seq
 499990720     gbvrl939.seq
 499956628     gbvrl94.seq
 499994223     gbvrl940.seq
 499964864     gbvrl941.seq
 499972100     gbvrl942.seq
 166666564     gbvrl943.seq
 499972943     gbvrl944.seq
 499976667     gbvrl945.seq
 499975726     gbvrl946.seq
 499994485     gbvrl947.seq
 333937173     gbvrl948.seq
 499993761     gbvrl949.seq
 499992542     gbvrl95.seq
 499995284     gbvrl950.seq
 499974046     gbvrl951.seq
 499988724     gbvrl952.seq
 318630268     gbvrl953.seq
 499993718     gbvrl954.seq
 499972215     gbvrl955.seq
 499993217     gbvrl956.seq
 499973746     gbvrl957.seq
 481012328     gbvrl958.seq
 499983152     gbvrl959.seq
 499953943     gbvrl96.seq
 499987856     gbvrl960.seq
 499965600     gbvrl961.seq
 499967457     gbvrl962.seq
  47481425     gbvrl963.seq
 499978086     gbvrl964.seq
 499994691     gbvrl965.seq
 499980317     gbvrl966.seq
 153396414     gbvrl967.seq
 499999069     gbvrl968.seq
 499964690     gbvrl969.seq
 230057979     gbvrl97.seq
 499965028     gbvrl970.seq
 338398249     gbvrl971.seq
 499980462     gbvrl972.seq
 499972328     gbvrl973.seq
 499987546     gbvrl974.seq
 274062097     gbvrl975.seq
 499997888     gbvrl976.seq
 499988638     gbvrl977.seq
 499964466     gbvrl978.seq
 432396980     gbvrl979.seq
 499994600     gbvrl98.seq
 499984574     gbvrl980.seq
 499981994     gbvrl981.seq
 499985942     gbvrl982.seq
 499967822     gbvrl983.seq
  82585257     gbvrl984.seq
 499976043     gbvrl985.seq
 499976392     gbvrl986.seq
 499993036     gbvrl987.seq
 499971672     gbvrl988.seq
 101246347     gbvrl989.seq
 499993822     gbvrl99.seq
 499966839     gbvrl990.seq
 499978869     gbvrl991.seq
 499988920     gbvrl992.seq
 368728388     gbvrl993.seq
 499990137     gbvrl994.seq
 499981278     gbvrl995.seq
 499981927     gbvrl996.seq
 499973176     gbvrl997.seq
 159389611     gbvrl998.seq
 499975968     gbvrl999.seq
 499898463     gbvrt1.seq
 290137512     gbvrt10.seq
 480710663     gbvrt100.seq
  89576281     gbvrt101.seq
 435880707     gbvrt102.seq
 487966706     gbvrt103.seq
 497561524     gbvrt104.seq
 468911725     gbvrt105.seq
1063697373     gbvrt106.seq
1045817456     gbvrt107.seq
 754876698     gbvrt108.seq
 616753988     gbvrt109.seq
  87351606     gbvrt11.seq
 490283916     gbvrt110.seq
 470651151     gbvrt111.seq
 397152890     gbvrt112.seq
 351566814     gbvrt113.seq
 339881554     gbvrt114.seq
 404716166     gbvrt115.seq
 489465929     gbvrt116.seq
 499108511     gbvrt117.seq
 486719349     gbvrt118.seq
  58362562     gbvrt119.seq
 499806081     gbvrt12.seq
 436489699     gbvrt120.seq
 486735687     gbvrt121.seq
 492786702     gbvrt122.seq
 424170309     gbvrt123.seq
 281367593     gbvrt124.seq
 478264522     gbvrt125.seq
 485840122     gbvrt126.seq
 493662272     gbvrt127.seq
  75046811     gbvrt128.seq
 979125221     gbvrt129.seq
 284674796     gbvrt13.seq
 838606764     gbvrt130.seq
 678362247     gbvrt131.seq
 476490051     gbvrt132.seq
 461393141     gbvrt133.seq
 438814149     gbvrt134.seq
 394334276     gbvrt135.seq
 313818221     gbvrt136.seq
 288999697     gbvrt137.seq
 280186115     gbvrt138.seq
 407765043     gbvrt139.seq
  15637437     gbvrt14.seq
 421853258     gbvrt140.seq
 478932645     gbvrt141.seq
 480028007     gbvrt142.seq
 438022009     gbvrt143.seq
 174441466     gbvrt144.seq
 487902327     gbvrt145.seq
 456814552     gbvrt146.seq
 462308829     gbvrt147.seq
 168813991     gbvrt148.seq
 455915969     gbvrt149.seq
  36035214     gbvrt15.seq
 469542169     gbvrt150.seq
 479148432     gbvrt151.seq
 211438035     gbvrt152.seq
 481255007     gbvrt153.seq
 475910680     gbvrt154.seq
 366785231     gbvrt155.seq
 464881586     gbvrt156.seq
 474452025     gbvrt157.seq
 234874130     gbvrt158.seq
 697335450     gbvrt159.seq
  18509260     gbvrt16.seq
 670835803     gbvrt160.seq
 524090553     gbvrt161.seq
 413420126     gbvrt162.seq
 345317144     gbvrt163.seq
 329841089     gbvrt164.seq
 250750417     gbvrt165.seq
 486600390     gbvrt166.seq
 364885711     gbvrt167.seq
 448395879     gbvrt168.seq
 471877569     gbvrt169.seq
 497676963     gbvrt17.seq
 393642536     gbvrt170.seq
 355134416     gbvrt171.seq
 470602746     gbvrt172.seq
 448657488     gbvrt173.seq
 384724558     gbvrt174.seq
 432320923     gbvrt175.seq
 471132362     gbvrt176.seq
 497676594     gbvrt177.seq
 207882210     gbvrt178.seq
 397267013     gbvrt179.seq
 497173924     gbvrt18.seq
 366771863     gbvrt180.seq
 351249970     gbvrt181.seq
 309532358     gbvrt182.seq
 296271444     gbvrt183.seq
 286321426     gbvrt184.seq
 268164730     gbvrt185.seq
 253329800     gbvrt186.seq
 494939336     gbvrt187.seq
 424426418     gbvrt188.seq
 410896883     gbvrt189.seq
 481350583     gbvrt19.seq
 369957025     gbvrt190.seq
 169574120     gbvrt191.seq
 426847158     gbvrt192.seq
 496824472     gbvrt193.seq
 434394575     gbvrt194.seq
 494362940     gbvrt195.seq
  61896390     gbvrt196.seq
 431425030     gbvrt197.seq
 474666078     gbvrt198.seq
 479195533     gbvrt199.seq
 499838101     gbvrt2.seq
 400795564     gbvrt20.seq
 352877912     gbvrt200.seq
 479777961     gbvrt201.seq
 497464627     gbvrt202.seq
 432868094     gbvrt203.seq
 439843808     gbvrt204.seq
 469531790     gbvrt205.seq
 496015817     gbvrt206.seq
 488626307     gbvrt207.seq
 432135676     gbvrt208.seq
  70119528     gbvrt209.seq
 488197715     gbvrt21.seq
 491056051     gbvrt210.seq
 328508705     gbvrt211.seq
 497328806     gbvrt212.seq
 499238966     gbvrt213.seq
 187508760     gbvrt214.seq
 490842556     gbvrt215.seq
 463385772     gbvrt216.seq
 446788975     gbvrt217.seq
 438416202     gbvrt218.seq
 170595769     gbvrt219.seq
 479291185     gbvrt22.seq
 451342688     gbvrt220.seq
 474563355     gbvrt221.seq
 461335548     gbvrt222.seq
 436658187     gbvrt223.seq
 154682616     gbvrt224.seq
 456837606     gbvrt225.seq
 488930196     gbvrt226.seq
 466502331     gbvrt227.seq
 455725140     gbvrt228.seq
 453475816     gbvrt229.seq
 480798341     gbvrt23.seq
 462276007     gbvrt230.seq
 497473221     gbvrt231.seq
 499283767     gbvrt232.seq
 481742871     gbvrt233.seq
  54779872     gbvrt234.seq
 477445338     gbvrt235.seq
 495314530     gbvrt236.seq
 486008997     gbvrt237.seq
 489201368     gbvrt238.seq
 499536480     gbvrt239.seq
 499274582     gbvrt24.seq
 347470388     gbvrt240.seq
1068402516     gbvrt241.seq
1067356333     gbvrt242.seq
 896844819     gbvrt243.seq
 805318347     gbvrt244.seq
 718662677     gbvrt245.seq
 556944666     gbvrt246.seq
 299728838     gbvrt247.seq
 293507186     gbvrt248.seq
 484357811     gbvrt249.seq
 483255310     gbvrt25.seq
 130768604     gbvrt250.seq
 874873715     gbvrt251.seq
 685858825     gbvrt252.seq
 627564227     gbvrt253.seq
 610271897     gbvrt254.seq
 543871783     gbvrt255.seq
 284797667     gbvrt256.seq
 269299175     gbvrt257.seq
 474717664     gbvrt258.seq
 402979396     gbvrt259.seq
 484154141     gbvrt26.seq
 343325815     gbvrt260.seq
 450550965     gbvrt261.seq
 494368803     gbvrt262.seq
 470723064     gbvrt263.seq
 470514883     gbvrt264.seq
 229726891     gbvrt265.seq
 499998347     gbvrt266.seq
 499996831     gbvrt267.seq
 499995815     gbvrt268.seq
  17926385     gbvrt269.seq
  65325644     gbvrt27.seq
 499999696     gbvrt270.seq
 499998935     gbvrt271.seq
 497405294     gbvrt272.seq
  11208822     gbvrt273.seq
 445682876     gbvrt274.seq
 474231618     gbvrt275.seq
 490948606     gbvrt276.seq
 332589082     gbvrt277.seq
 477156039     gbvrt278.seq
 499226352     gbvrt279.seq
 437233554     gbvrt28.seq
 477696169     gbvrt280.seq
 353039605     gbvrt281.seq
 438196164     gbvrt282.seq
 489809255     gbvrt283.seq
 460938782     gbvrt284.seq
 425935508     gbvrt285.seq
 463055690     gbvrt286.seq
 486381290     gbvrt287.seq
 437842391     gbvrt288.seq
 440417012     gbvrt289.seq
 488520688     gbvrt29.seq
 475637321     gbvrt290.seq
 477247535     gbvrt291.seq
 464765084     gbvrt292.seq
 442158629     gbvrt293.seq
 490038950     gbvrt294.seq
 437760826     gbvrt295.seq
 442760644     gbvrt296.seq
 386023782     gbvrt297.seq
 474714280     gbvrt298.seq
 485233797     gbvrt299.seq
 467954927     gbvrt3.seq
 456456384     gbvrt30.seq
 481701496     gbvrt300.seq
 437638720     gbvrt301.seq
 484571077     gbvrt302.seq
 497401344     gbvrt303.seq
 473482376     gbvrt304.seq
 467112365     gbvrt305.seq
 171814162     gbvrt306.seq
  85205330     gbvrt307.seq
 671198197     gbvrt308.seq
 590897252     gbvrt309.seq
 337132552     gbvrt31.seq
 569239246     gbvrt310.seq
 521483379     gbvrt311.seq
 518191557     gbvrt312.seq
 413907798     gbvrt313.seq
 491950349     gbvrt314.seq
 443427082     gbvrt315.seq
 399672190     gbvrt316.seq
 288063541     gbvrt317.seq
 447682143     gbvrt318.seq
 458968414     gbvrt319.seq
 446089299     gbvrt32.seq
 489671978     gbvrt320.seq
 498333218     gbvrt321.seq
 249806054     gbvrt322.seq
 449206571     gbvrt323.seq
 492547884     gbvrt324.seq
 481880513     gbvrt325.seq
 498774154     gbvrt326.seq
 111733219     gbvrt327.seq
 436873334     gbvrt328.seq
 440148969     gbvrt329.seq
 379213975     gbvrt33.seq
 482571941     gbvrt330.seq
 484107234     gbvrt331.seq
  52095057     gbvrt332.seq
 470800028     gbvrt333.seq
 472090268     gbvrt334.seq
 484740940     gbvrt335.seq
 476579517     gbvrt336.seq
 487431970     gbvrt337.seq
 391563647     gbvrt338.seq
 455738434     gbvrt339.seq
 458139031     gbvrt34.seq
 373020280     gbvrt340.seq
 430677277     gbvrt341.seq
 493479067     gbvrt342.seq
 489511330     gbvrt343.seq
 496625891     gbvrt344.seq
 496023577     gbvrt345.seq
 483316423     gbvrt346.seq
 455697611     gbvrt347.seq
 463738379     gbvrt348.seq
 476553580     gbvrt349.seq
 111157660     gbvrt35.seq
 382729569     gbvrt350.seq
 388762659     gbvrt351.seq
 162516535     gbvrt352.seq
 364042246     gbvrt353.seq
 406118404     gbvrt354.seq
 490080005     gbvrt355.seq
 499117150     gbvrt356.seq
 496745927     gbvrt357.seq
 114457470     gbvrt358.seq
 483642213     gbvrt359.seq
 402140937     gbvrt36.seq
 486499113     gbvrt360.seq
 480199921     gbvrt361.seq
 449130925     gbvrt362.seq
 493582352     gbvrt363.seq
 455855740     gbvrt364.seq
 496938106     gbvrt365.seq
 445299021     gbvrt366.seq
 488289465     gbvrt367.seq
 456295928     gbvrt368.seq
 491344127     gbvrt369.seq
 345094744     gbvrt37.seq
 433632055     gbvrt370.seq
 461359229     gbvrt371.seq
 352990890     gbvrt372.seq
 486129256     gbvrt373.seq
 433069569     gbvrt374.seq
 468000104     gbvrt375.seq
 213511432     gbvrt376.seq
 464521445     gbvrt377.seq
 484103216     gbvrt378.seq
 469113604     gbvrt379.seq
 499274310     gbvrt38.seq
 441506917     gbvrt380.seq
 388757745     gbvrt381.seq
 491752782     gbvrt382.seq
 465458984     gbvrt383.seq
 463577414     gbvrt384.seq
 475333006     gbvrt385.seq
  32860891     gbvrt386.seq
 448180683     gbvrt387.seq
 468563387     gbvrt388.seq
 487321652     gbvrt389.seq
 359197842     gbvrt39.seq
 466578054     gbvrt390.seq
 479179652     gbvrt391.seq
 463026596     gbvrt392.seq
 420071062     gbvrt393.seq
 457719226     gbvrt394.seq
 490464485     gbvrt395.seq
 443384835     gbvrt396.seq
 462824598     gbvrt397.seq
 334830757     gbvrt398.seq
 476386342     gbvrt399.seq
 179100370     gbvrt4.seq
 438069960     gbvrt40.seq
 491788802     gbvrt400.seq
 450398569     gbvrt401.seq
 454795466     gbvrt402.seq
 469602269     gbvrt403.seq
 452609759     gbvrt404.seq
 497531511     gbvrt405.seq
 437442433     gbvrt406.seq
 342108062     gbvrt407.seq
 427821552     gbvrt408.seq
 472175035     gbvrt409.seq
  14152653     gbvrt41.seq
 474308742     gbvrt410.seq
 115706604     gbvrt411.seq
 462970947     gbvrt412.seq
 483824917     gbvrt413.seq
 480993826     gbvrt414.seq
 425541655     gbvrt415.seq
 479907790     gbvrt416.seq
 352572847     gbvrt417.seq
 495727890     gbvrt418.seq
 499457203     gbvrt419.seq
  21384662     gbvrt42.seq
 496827401     gbvrt420.seq
 495182596     gbvrt421.seq
 495031018     gbvrt422.seq
 302735744     gbvrt423.seq
  90973101     gbvrt43.seq
 499951059     gbvrt44.seq
 499999127     gbvrt45.seq
 499998520     gbvrt46.seq
  55941908     gbvrt47.seq
 499999622     gbvrt48.seq
 270406577     gbvrt49.seq
 448778544     gbvrt5.seq
 499999299     gbvrt50.seq
 121287896     gbvrt51.seq
 499998297     gbvrt52.seq
 448467638     gbvrt53.seq
 499996519     gbvrt54.seq
  29067115     gbvrt55.seq
 444265899     gbvrt56.seq
 499999006     gbvrt57.seq
 388879976     gbvrt58.seq
 500000054     gbvrt59.seq
 490703641     gbvrt6.seq
 280113453     gbvrt60.seq
 499998081     gbvrt61.seq
 499998789     gbvrt62.seq
 488793716     gbvrt63.seq
 499630950     gbvrt64.seq
 499990415     gbvrt65.seq
 462471618     gbvrt66.seq
 202128841     gbvrt67.seq
 123737443     gbvrt68.seq
 483315318     gbvrt69.seq
 499120716     gbvrt7.seq
 481925744     gbvrt70.seq
 499146212     gbvrt71.seq
 499983703     gbvrt72.seq
 297372571     gbvrt73.seq
 492211550     gbvrt74.seq
 492375887     gbvrt75.seq
 479677491     gbvrt76.seq
 480814553     gbvrt77.seq
 362168611     gbvrt78.seq
 487931186     gbvrt79.seq
 483704779     gbvrt8.seq
 465950606     gbvrt80.seq
 489430322     gbvrt81.seq
 352376871     gbvrt82.seq
 465372186     gbvrt83.seq
 488788789     gbvrt84.seq
 189348250     gbvrt85.seq
 451948482     gbvrt86.seq
 443703248     gbvrt87.seq
 400719178     gbvrt88.seq
 427517644     gbvrt89.seq
 263807528     gbvrt9.seq
 319264824     gbvrt90.seq
 275756309     gbvrt91.seq
 252640763     gbvrt92.seq
 251496345     gbvrt93.seq
 466369516     gbvrt94.seq
 418722220     gbvrt95.seq
 186091498     gbvrt96.seq
 404212770     gbvrt97.seq
 481131817     gbvrt98.seq
 474827267     gbvrt99.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         102014     184376388
BCT10        102        246510870
BCT100       45         212727898
BCT100       179        205883676
BCT100       202        206537177
BCT100       226        205678653
BCT100       173        206520918
BCT100       37         50683886
BCT100       237        205937725
BCT100       326        220433021
BCT100       258        227572011
BCT100       201        298190132
BCT100       191        273929069
BCT101       76         222861078
BCT101       24421      155821529
BCT102       40         115080869
BCT103       112        227959956
BCT104       129        231316827
BCT105       99         245428056
BCT106       87         223381451
BCT107       59         181990919
BCT108       93         237302287
BCT109       103        223843089
BCT11        143        242657671
BCT110       62         225168570
BCT111       64         140507059
BCT112       89         229551845
BCT113       90         230404163
BCT114       99         240991650
BCT115       27         42382325
BCT116       94         226656782
BCT117       118        229172914
BCT118       127        232212861
BCT119       90         178403076
BCT12        168        262541373
BCT120       114        212138354
BCT121       76         223040870
BCT122       111        225956545
BCT123       125        221492878
BCT124       4          6013748
BCT125       246        222256023
BCT126       104        221252195
BCT127       100        224644129
BCT128       83         222703364
BCT129       21         86233168
BCT13        8          14890521
BCT130       68         221578114
BCT131       87         219795809
BCT132       87         223588406
BCT133       80         226303150
BCT134       20         45564131
BCT135       124        217933644
BCT136       53         217706139
BCT137       90         227492926
BCT138       57         149506400
BCT139       94         223837173
BCT14        165        232257568
BCT140       73         221711999
BCT141       122        215811464
BCT142       80         227727095
BCT143       8          8657925
BCT144       159        220206896
BCT145       84         220629983
BCT146       79         216070642
BCT147       141        227102717
BCT148       107        224394264
BCT149       80         221199213
BCT15        150        236302365
BCT150       92         196245950
BCT151       115        225967887
BCT152       92         220409897
BCT153       158        214217907
BCT154       88         207032597
BCT155       140        220978157
BCT156       63         217844098
BCT157       90         215013764
BCT158       125        217101319
BCT159       88         223616604
BCT16        187        250598312
BCT160       21         65066945
BCT161       174        220602866
BCT162       128        221993348
BCT163       118        216449560
BCT164       170        220678969
BCT165       54         177570665
BCT166       104        218683705
BCT167       113        217389079
BCT168       151        218678288
BCT169       108        219330740
BCT17        219        231641963
BCT170       112        226939239
BCT171       130        201487093
BCT172       94         225669105
BCT173       104        221739191
BCT174       94         225200657
BCT175       125        221012882
BCT176       94         220173020
BCT177       135        221682180
BCT178       48         89786798
BCT179       168        220876797
BCT18        31         58194184
BCT180       100        223727909
BCT181       96         223995439
BCT182       95         219439398
BCT183       71         223304376
BCT184       129        228001663
BCT185       150        229208112
BCT186       77         216466477
BCT187       11         10188678
BCT188       100        233591727
BCT189       96         224680213
BCT19        135        235079883
BCT190       133        222280876
BCT191       85         221811199
BCT192       26         92438538
BCT193       119        222185746
BCT194       151        231715107
BCT195       72         216080650
BCT196       81         120955479
BCT197       111        216184725
BCT198       156        227708035
BCT199       111        220250972
BCT2         106        226805638
BCT20        131        231843219
BCT200       89         136614524
BCT201       133        229717687
BCT202       109        213797140
BCT203       111        220064957
BCT204       77         222877345
BCT205       19         34014599
BCT206       98         220152536
BCT207       132        227699493
BCT208       126        229823053
BCT209       115        247492878
BCT21        109        220733955
BCT210       116        229072476
BCT211       35         100612124
BCT212       131        216438017
BCT213       93         226438829
BCT214       108        224089005
BCT215       116        221458112
BCT216       65         122261042
BCT217       127        225144984
BCT218       137        258852104
BCT219       100        226684234
BCT22        212        222430645
BCT220       159        219265722
BCT221       71         116660995
BCT222       123        222422665
BCT223       115        218469346
BCT224       89         219209021
BCT225       103        229936404
BCT226       104        209481600
BCT227       104        234499310
BCT228       94         222201735
BCT229       95         222593575
BCT23        50         66104168
BCT230       105        225137188
BCT231       98         229933616
BCT232       106        224550172
BCT233       90         192942285
BCT234       104        221826114
BCT235       108        221051727
BCT236       98         226007841
BCT237       76         270744187
BCT238       75         254647899
BCT239       101        225874656
BCT24        174        220036188
BCT240       178        218571314
BCT241       132        228118798
BCT242       58         111799670
BCT243       303        275292038
BCT244       119        219435892
BCT245       114        219246925
BCT246       53         88783408
BCT247       89         220099828
BCT248       87         228427298
BCT249       82         236651858
BCT25        157        217996559
BCT250       106        224032415
BCT251       39         81227217
BCT252       60         216868170
BCT253       120        221119124
BCT254       86         223426276
BCT255       85         217663772
BCT256       31         72411893
BCT257       157        275025230
BCT258       82         232627723
BCT259       84         220566907
BCT26        52         221902715
BCT260       144        212385076
BCT261       20         28670539
BCT262       109        262921422
BCT263       72         217635148
BCT264       100        214909619
BCT265       79         210171996
BCT266       143        306547296
BCT267       72         239204396
BCT268       88         216728836
BCT269       131        224161084
BCT27        110        224934926
BCT270       140        264048514
BCT271       50         101444202
BCT272       146        273570514
BCT273       114        257004034
BCT274       35         229012536
BCT275       60         215899496
BCT276       112        219135997
BCT277       126        219604182
BCT278       95         249332001
BCT279       78         222741730
BCT28        204        233470802
BCT280       14         34821419
BCT281       124        215159011
BCT282       98         220607386
BCT283       65         210721442
BCT284       137        230450043
BCT285       114        227067240
BCT286       109        229190301
BCT287       88         225088899
BCT288       80         141524915
BCT289       106        218843831
BCT29        3          27676824
BCT290       82         215186387
BCT291       95         234056453
BCT292       98         187209491
BCT293       93         235647841
BCT294       104        235928514
BCT295       69         223063860
BCT296       105        213470710
BCT297       119        216777827
BCT298       166        226651969
BCT299       161        212763762
BCT3         37542      125814925
BCT30        83         236556551
BCT300       157        238023030
BCT301       8          17431560
BCT302       101        230275411
BCT303       119        225277295
BCT304       156        250483403
BCT305       117        235914627
BCT306       10         46450140
BCT307       123        226718502
BCT308       112        212578426
BCT309       91         227407856
BCT31        96         221838262
BCT310       111        218543332
BCT311       158        225974223
BCT312       153        213957809
BCT313       116        177319993
BCT314       127        225491526
BCT315       106        222744013
BCT316       83         218273834
BCT317       70         215964942
BCT318       123        196813336
BCT319       87         241506031
BCT32        96         219800168
BCT320       110        227851319
BCT321       82         219259803
BCT322       52         214399303
BCT323       90         197873444
BCT324       113        220728285
BCT325       129        231228144
BCT326       125        212458214
BCT327       94         219289732
BCT328       148        223216642
BCT329       3          10254404
BCT33        117        236937870
BCT330       124        248813935
BCT331       110        222498371
BCT332       82         228432498
BCT333       61         221300332
BCT334       89         186019346
BCT335       128        238885544
BCT336       201        232731845
BCT337       144        217080977
BCT338       134        215029591
BCT339       118        217111970
BCT34        50         70336694
BCT340       41         76975466
BCT341       139        245503240
BCT342       169        279754521
BCT343       165        215010867
BCT344       135        218768734
BCT345       19         125140083
BCT346       72         229560250
BCT347       126        238154065
BCT348       742        221695520
BCT349       398        217882477
BCT35        83         218320760
BCT350       95         232152237
BCT351       6          15239951
BCT352       115        224523179
BCT353       120        214271004
BCT354       102        211428284
BCT355       127        217681230
BCT356       188        233278336
BCT357       230        225229102
BCT358       129        223160743
BCT359       75         164588533
BCT36        114        237396740
BCT360       136        222929134
BCT361       146        220643724
BCT362       142        217749525
BCT363       131        229168171
BCT364       145        233120869
BCT365       97         238465297
BCT366       59         129171418
BCT367       113        227348795
BCT368       143        228415697
BCT369       133        230301712
BCT37        78         219603863
BCT370       143        217809476
BCT371       84         228448881
BCT372       13         27883457
BCT373       130        230534195
BCT374       120        226303849
BCT375       77         223089727
BCT376       90         220325038
BCT377       58         219031718
BCT378       50         220953317
BCT379       132        225967417
BCT38        157        232380718
BCT380       48         19128392
BCT381       195        229604129
BCT382       127        252087880
BCT383       114        227136753
BCT384       215        225277178
BCT385       74         105630813
BCT386       90         239192530
BCT387       114        247991308
BCT388       46         214210162
BCT389       53         216377196
BCT39        128        200633641
BCT390       19         73275105
BCT391       128        213375994
BCT392       113        228373833
BCT393       101        225013414
BCT394       172        251586241
BCT395       168        226107434
BCT396       82         220568473
BCT397       120        217140457
BCT398       21         44959376
BCT399       184        265248059
BCT4         41290      139250707
BCT40        162        235716785
BCT400       183        233381025
BCT401       469        227648052
BCT402       123        230691656
BCT403       160        240032463
BCT404       104        233630145
BCT405       110        215297540
BCT406       109        230735808
BCT407       84         216238233
BCT408       94         218004732
BCT409       102        226314622
BCT41        138        289063159
BCT410       155        220876767
BCT411       68         123957640
BCT412       89         221294643
BCT413       108        228032164
BCT414       120        225520882
BCT415       153        335842367
BCT416       110        218250059
BCT417       101        285163697
BCT418       55         131018393
BCT419       116        223524149
BCT42        111        224384148
BCT420       153        221386449
BCT421       99         215448259
BCT422       94         224434864
BCT423       157        223587766
BCT424       118        230273588
BCT425       119        221798255
BCT426       82         94432839
BCT427       122        226585208
BCT428       153        219365274
BCT429       149        229541054
BCT43        113        228662035
BCT430       159        230173281
BCT431       131        218220461
BCT432       21         41744019
BCT433       129        231508633
BCT434       141        220573282
BCT435       141        220438911
BCT436       101        217783001
BCT437       94         221873764
BCT438       108        231480669
BCT439       119        234050616
BCT44        14         25829472
BCT440       100        313072351
BCT441       88         215834731
BCT442       101        137773450
BCT443       123        217943213
BCT444       125        223387893
BCT445       93         216431058
BCT446       101        256544346
BCT447       67         188984278
BCT448       118        212264610
BCT449       113        224096535
BCT45        164        221117526
BCT450       111        221803154
BCT451       115        211305566
BCT452       43         81514768
BCT453       144        219919128
BCT454       104        251665529
BCT455       156        212575427
BCT456       159        212139624
BCT457       12         11443917
BCT458       238        214458452
BCT459       129        214250986
BCT46        182        226510942
BCT460       99         218510804
BCT461       117        230291203
BCT462       123        262063092
BCT463       78         178549235
BCT464       103        236047200
BCT465       127        236790346
BCT466       131        219550029
BCT467       104        228221181
BCT468       91         216460991
BCT469       53         217868736
BCT47        249        222464459
BCT470       81         148217592
BCT471       165        216872086
BCT472       114        221935107
BCT473       114        226586398
BCT474       132        213116796
BCT475       11         41867039
BCT476       78         220992704
BCT477       139        212603090
BCT478       157        216271864
BCT479       317        213898340
BCT48        138        188825985
BCT480       364        210657095
BCT481       117        212804246
BCT482       134        211491923
BCT483       150        212215499
BCT484       174        222080619
BCT485       168        211415286
BCT486       49         74787780
BCT487       161        208257957
BCT488       162        212193463
BCT489       114        210605338
BCT49        120        223338701
BCT490       157        213126972
BCT491       132        209356669
BCT492       131        195243107
BCT493       183        210687290
BCT494       116        210811583
BCT495       136        211510245
BCT496       167        220748430
BCT497       55         112883059
BCT498       156        239663577
BCT499       132        228642948
BCT5         20642      162919204
BCT50        146        230078631
BCT500       209        229973849
BCT501       112        223269760
BCT502       6          12814141
BCT503       112        230828773
BCT504       119        221323829
BCT505       132        234778895
BCT506       104        237587098
BCT507       110        66092449
BCT508       107        232838404
BCT509       96         224202359
BCT51        127        228156769
BCT510       110        224180420
BCT511       69         230451487
BCT512       119        247887479
BCT513       111        267612902
BCT514       71         144393115
BCT515       184        216765022
BCT516       123        232248162
BCT517       132        222732283
BCT518       118        215196560
BCT519       193        220065332
BCT52        160        217539144
BCT520       123        225435430
BCT521       141        225643357
BCT522       2          9711339
BCT523       90         256897498
BCT524       142        214248519
BCT525       98         214768017
BCT526       157        213710019
BCT527       24         53836540
BCT528       140        218732960
BCT529       109        225107446
BCT53        76         221307635
BCT530       89         216531385
BCT531       169        225245387
BCT532       83         69720141
BCT533       157        237479776
BCT534       137        340179435
BCT535       129        246757216
BCT536       188        271554474
BCT537       127        219640401
BCT538       70         232305542
BCT539       111        223011314
BCT54        463        168389149
BCT540       25         82301720
BCT541       101        223784323
BCT542       75         214070601
BCT543       103        234423539
BCT544       128        219745538
BCT545       113        217095390
BCT546       104        130376171
BCT547       125        216431578
BCT548       139        217127904
BCT549       127        231713695
BCT55        5200       7533877
BCT550       120        216867760
BCT551       285        221512732
BCT552       63         80282166
BCT553       139        228155956
BCT554       96         240199682
BCT555       86         218203266
BCT556       170        210933694
BCT557       134        217729188
BCT558       175        209625406
BCT559       79         96733079
BCT56        10402      13141863
BCT560       156        208447709
BCT561       127        240984651
BCT562       128        222248609
BCT563       160        221935754
BCT564       95         150336580
BCT565       160        225500184
BCT566       50         213452168
BCT567       230        254160025
BCT568       132        234547809
BCT569       90         221019009
BCT57        53921      202024657
BCT570       128        191258602
BCT571       153        215988330
BCT572       126        276622167
BCT573       205        209499795
BCT574       142        249238352
BCT575       98         257053887
BCT576       10         28305238
BCT577       126        229584098
BCT578       140        225797801
BCT579       146        228175936
BCT58        185        208765651
BCT580       98         220515926
BCT581       96         219200729
BCT582       14         36127315
BCT583       123        221651394
BCT584       130        226062430
BCT585       103        221052628
BCT586       100        222269888
BCT587       94         218107147
BCT588       125        230964292
BCT589       48         128546625
BCT59        101        231004346
BCT590       128        228496151
BCT591       146        223925807
BCT592       166        215804467
BCT593       151        224697554
BCT594       117        221724909
BCT595       112        194039034
BCT596       206        242745918
BCT597       115        230743055
BCT598       183        208573489
BCT599       96         221504128
BCT6         2600       37759883
BCT60        122        221744163
BCT600       73         229935992
BCT601       163        214524829
BCT602       156        178907953
BCT603       116        219456772
BCT604       62         209197316
BCT605       60         209524722
BCT606       88         226875805
BCT607       171        213858993
BCT608       59         185158308
BCT609       82         216188031
BCT61        103        222777517
BCT610       94         211985724
BCT611       152        235421790
BCT612       197        288802995
BCT613       80         151038460
BCT614       134        222118709
BCT615       42         214577135
BCT616       37         214639852
BCT617       169        234699017
BCT618       64         148941997
BCT619       93         213934681
BCT62        131        222293417
BCT620       94         215092310
BCT621       110        221932983
BCT622       144        220354082
BCT623       96         215824553
BCT624       116        214575844
BCT625       92         213611278
BCT626       96         111301995
BCT627       125        221173811
BCT628       105        243553672
BCT629       112        219526221
BCT63        121        218256338
BCT630       116        225795801
BCT631       126        230802156
BCT632       98         351154002
BCT633       136        383849965
BCT634       91         317300604
BCT635       170        225029563
BCT636       149        219841110
BCT637       145        235286079
BCT638       124        270222682
BCT639       77         75818779
BCT64        146        224934131
BCT640       117        217993852
BCT641       103        225717431
BCT642       88         221579607
BCT643       173        270671638
BCT644       9          31558414
BCT645       166        225544876
BCT646       148        232388729
BCT647       268        211727450
BCT648       146        220264108
BCT649       30         75845483
BCT65        142        227150714
BCT650       158        255536508
BCT651       110        226529559
BCT652       115        212597637
BCT653       147        216105979
BCT654       130        209963367
BCT655       43         65651458
BCT656       112        211778878
BCT657       115        219644798
BCT658       187        214896897
BCT659       130        221800533
BCT66        130        136849190
BCT660       62         26129241
BCT661       137        242501423
BCT662       146        212177855
BCT663       99         226813904
BCT664       186        222915689
BCT665       78         191581491
BCT666       190        243552580
BCT667       134        226438869
BCT668       117        224143649
BCT669       96         215078464
BCT67        255        227294457
BCT670       94         111389420
BCT671       125        218988791
BCT672       143        245814903
BCT673       192        225512710
BCT674       48         211639657
BCT675       57         213979570
BCT676       93         187672950
BCT677       85         213343638
BCT678       121        216390365
BCT679       84         218626001
BCT68        86         220119558
BCT680       84         234501343
BCT681       86         194623312
BCT682       170        215443584
BCT683       145        219530550
BCT684       327        213392641
BCT685       58         214355238
BCT686       83         230013920
BCT687       175        247617354
BCT688       155        225734536
BCT689       19         53083384
BCT69        113        224688543
BCT690       73         212371616
BCT691       92         217821699
BCT692       106        223435480
BCT693       140        207591800
BCT694       138        210023829
BCT695       34         63064456
BCT696       142        206612759
BCT697       117        213883354
BCT698       136        219396034
BCT699       80         217057439
BCT7         1310       133308362
BCT70        128        222273877
BCT700       97         179738098
BCT701       122        220472990
BCT702       85         241011219
BCT703       106        226130274
BCT704       147        218319286
BCT705       104        214002931
BCT706       126        230105335
BCT707       62         108825039
BCT708       104        223025233
BCT709       106        217782989
BCT71        135        219988879
BCT710       122        225096704
BCT711       138        233625066
BCT712       47         77970477
BCT713       107        217566484
BCT714       74         218950444
BCT715       116        221737252
BCT716       143        212049084
BCT717       88         111987983
BCT718       86         213573894
BCT719       130        217540925
BCT72        111        162805198
BCT720       117        209727280
BCT721       171        239325822
BCT722       118        223254380
BCT723       118        212792592
BCT724       59         98012374
BCT725       88         208008157
BCT726       72         217592870
BCT727       75         215572501
BCT728       170        208410267
BCT729       88         214362512
BCT73        136        223054995
BCT730       85         183148077
BCT731       150        220495306
BCT732       74         209792743
BCT733       67         208772721
BCT734       168        211156605
BCT735       56         116045619
BCT736       127        218573367
BCT737       152        218178207
BCT738       124        208139762
BCT739       147        218716826
BCT74        112        217399067
BCT740       57         107102767
BCT741       143        232831805
BCT742       167        218748651
BCT743       262        219114964
BCT744       93         238194838
BCT745       132        210738823
BCT746       86         158084866
BCT747       99         206684971
BCT748       98         213767096
BCT749       80         209385723
BCT75        131        223635367
BCT750       154        212184366
BCT751       110        219844524
BCT752       101        208956622
BCT753       105        206264157
BCT754       7          25961553
BCT755       129        231269887
BCT756       117        222249965
BCT757       115        209747889
BCT758       123        202361082
BCT759       131        206989704
BCT76        121        221481204
BCT760       102        185817850
BCT761       123        211751375
BCT762       137        208091599
BCT763       122        200068823
BCT764       113        202782528
BCT765       100        199956709
BCT766       43         55110602
BCT767       96         210680253
BCT768       100        214700164
BCT769       124        211384024
BCT77        138        232661918
BCT770       109        209545600
BCT771       246        293548929
BCT772       42         56639151
BCT773       118        229057290
BCT774       124        207735414
BCT775       113        229021756
BCT776       192        233211831
BCT777       114        218240956
BCT778       102        209555639
BCT779       53         74743847
BCT78        108        225781339
BCT780       127        205319007
BCT781       123        220841114
BCT782       68         213478854
BCT783       86         217034900
BCT784       4          20868504
BCT785       118        215230518
BCT786       157        210771328
BCT787       160        225681299
BCT788       79         210040698
BCT789       5          27552189
BCT79        38         50860113
BCT790       78         221812250
BCT791       125        223032976
BCT792       140        234179597
BCT793       167        211230911
BCT794       31         48247471
BCT795       145        206703555
BCT796       89         208424027
BCT797       107        215428460
BCT798       110        209560866
BCT799       106        220941436
BCT8         191        234251938
BCT80        95         230912422
BCT800       3          4481381
BCT801       128        205340114
BCT802       106        203265351
BCT803       139        204388088
BCT804       87         221300486
BCT805       110        176919143
BCT806       83         213682455
BCT807       132        214084061
BCT808       85         238723239
BCT809       97         212907772
BCT81        117        227983621
BCT810       173        243843305
BCT811       193        252572996
BCT812       99         223006138
BCT813       143        210323440
BCT814       100        217158439
BCT815       136        242902599
BCT816       129        235229058
BCT817       86         217771426
BCT818       58         113742157
BCT819       130        211252931
BCT82        160        232898310
BCT820       110        216726316
BCT821       125        204450679
BCT822       142        236151839
BCT823       140        235868527
BCT824       91         208035626
BCT825       119        210404603
BCT826       89         236879950
BCT827       90         217207547
BCT828       83         211336854
BCT829       42         75218170
BCT83        154        221704284
BCT830       140        228520644
BCT831       255        231978344
BCT832       70         223323221
BCT833       118        217788342
BCT834       81         133308177
BCT835       145        214529738
BCT836       129        230089334
BCT837       184        214550899
BCT838       155        213625722
BCT839       109        191265874
BCT84        128        238275556
BCT840       108        211759980
BCT841       253        208752547
BCT842       119        206028053
BCT843       74         203708290
BCT844       43         213625042
BCT845       161        182685819
BCT846       121        206012040
BCT847       110        256475668
BCT848       85         208304207
BCT849       109        213696648
BCT85        114        230664549
BCT850       87         208762786
BCT851       107        246491807
BCT852       159        232973712
BCT853       126        213752254
BCT854       141        217104754
BCT855       95         195611205
BCT856       141        231519618
BCT857       115        244352528
BCT858       79         223100746
BCT859       133        208148034
BCT86        54         123393656
BCT860       79         217682004
BCT861       73         122025510
BCT862       115        218706583
BCT863       134        223109997
BCT864       159        222605771
BCT865       98         218026649
BCT866       25         59614182
BCT867       150        259656903
BCT868       179        212408378
BCT869       238        198562928
BCT87        300        239582260
BCT870       185        228633580
BCT871       213        232710561
BCT872       122        226554709
BCT873       91         118203323
BCT874       263        217517824
BCT875       151        199782010
BCT876       99         214237190
BCT877       58         201829849
BCT878       129        197235087
BCT879       131        201574620
BCT88        142        231562727
BCT880       166        214376471
BCT881       120        225472224
BCT882       73         211338908
BCT883       63         211553395
BCT884       3          13549243
BCT885       82         220570956
BCT886       80         205194221
BCT887       108        211035854
BCT888       101        214588511
BCT889       100        213425635
BCT89        354        225466658
BCT890       1          5979293
BCT891       88         218801230
BCT892       124        202073904
BCT893       128        204712199
BCT894       127        213208994
BCT895       63         119356279
BCT896       70         208480654
BCT897       88         223713662
BCT898       99         202827096
BCT899       126        199341451
BCT9         133        236750743
BCT90        110        222922994
BCT900       54         51715891
BCT901       121        202819434
BCT902       144        213687274
BCT903       124        216799504
BCT904       147        197082738
BCT905       42         66134976
BCT906       108        210889488
BCT907       118        213246087
BCT908       135        255523103
BCT909       78         340999538
BCT91        120        208517065
BCT910       193        324314277
BCT911       181        296388951
BCT912       75         70245377
BCT913       528        115589384
BCT914       1589       2511957
BCT915       3172       5268484
BCT916       6338       7796395
BCT917       12613      14997690
BCT918       25523      27672494
BCT919       50566      54072396
BCT92        120        227473574
BCT920       148883     156723393
BCT921       14200      193509772
BCT922       3297       203942569
BCT923       2512       213432676
BCT924       7212       212654349
BCT925       164        249069009
BCT926       39928      39703867
BCT927       75115      183078349
BCT928       11044      200071849
BCT929       6078       200796727
BCT93        99         226611423
BCT930       100695     182725025
BCT931       60982      67424103
BCT932       149218     156935579
BCT933       84522      88110899
BCT934       144591     151097868
BCT935       25887      25547121
BCT936       132574     167542096
BCT937       31491      43691434
BCT938       116487     178552316
BCT939       7594       16987633
BCT94        90         224039666
BCT940       33015      54143552
BCT941       39770      223762025
BCT942       4374       317254124
BCT943       2451       39148036
BCT944       5034       225438591
BCT945       3847       224092509
BCT946       1442       273316652
BCT947       109        222593498
BCT948       55         216844860
BCT949       70         213822191
BCT95        98         225070223
BCT950       34         137765382
BCT951       69         224394912
BCT952       364        238323955
BCT953       889        289911825
BCT954       316        85816731
BCT955       1274       198668008
BCT956       287        209619920
BCT957       559        377168493
BCT958       919        316619406
BCT959       271        80140439
BCT96        58         138528232
BCT960       3148       246273076
BCT961       677        253307538
BCT962       380        388957404
BCT963       317        211223197
BCT964       362        393266490
BCT965       364        392445913
BCT966       515        239197049
BCT967       1741       221923984
BCT968       11         22317190
BCT969       86         222746849
BCT97        53         211054879
BCT970       78         227354684
BCT971       3023       245927078
BCT972       1230       124242115
BCT973       1412       261424764
BCT974       47         241352896
BCT975       45         243003094
BCT976       2180       269716913
BCT977       945        54278114
BCT978       2284       261463112
BCT979       87         288890299
BCT98        45         210584326
BCT980       417        278222635
BCT981       3023       263078339
BCT982       11940      19905115
BCT983       25214      42009480
BCT984       118308     188758179
BCT985       115187     191772128
BCT986       91613      166275801
BCT987       97696      200781545
BCT988       119486     192838931
BCT989       55108      295511500
BCT99        45         210864282
BCT990       121705     203163652
BCT991       46216      276617913
BCT992       75         27843824
BCT993       346        260068821
BCT994       153        210584607
BCT995       207        206611728
BCT996       199        203778818
BCT997       198        205158243
BCT998       172        202714834
BCT999       58         72733221
ENV1         189936     141862723
ENV10        83         219720293
ENV11        109        229939058
ENV12        156        211660471
ENV13        588        220142141
ENV14        177324     166033906
ENV15        61231      29754757
ENV16        218970     102569503
ENV17        176356     159880917
ENV18        19591      17083640
ENV19        204687     124199025
ENV2         111957     180368104
ENV20        186312     145970812
ENV21        209230     131011406
ENV22        180828     144717204
ENV23        1251       1678054
ENV24        155433     156521287
ENV25        244834     67513585
ENV26        92643      21373836
ENV27        220959     118335235
ENV28        255264     109061988
ENV29        205163     126335257
ENV3         103094     171366661
ENV30        27420      25899715
ENV31        152288     158743920
ENV32        201173     103413016
ENV33        68233      51313819
ENV34        213271     108914748
ENV35        170978     153759453
ENV36        135004     163681015
ENV37        11561      15750708
ENV38        179940     128302204
ENV39        218035     118474873
ENV4         126        289839815
ENV40        78514      41736636
ENV41        143979     98000846
ENV42        100617     112273672
ENV43        130604     80420863
ENV44        173933     138863958
ENV45        163625     139554444
ENV46        179875     114638233
ENV47        200965     107345641
ENV48        196347     109548395
ENV49        111594     97825926
ENV5         94         222349120
ENV50        158037     134815999
ENV51        145071     136774292
ENV52        169155     47811798
ENV53        172154     133100300
ENV54        210921     100424019
ENV55        142450     62215028
ENV56        216484     84261358
ENV57        212740     92635014
ENV58        108070     43432737
ENV59        224266     98776745
ENV6         102        218755537
ENV60        224773     91722943
ENV61        142960     92501157
ENV62        198343     110962019
ENV63        182971     90536433
ENV64        184623     120064642
ENV65        51472      42529184
ENV66        128629     186314172
ENV67        223266     135703193
ENV68        235363     93587169
ENV69        95557      44026095
ENV7         69         218175793
ENV70        194516     112029976
ENV71        131084     170950120
ENV72        67445      134736730
ENV73        41591      215295054
ENV74        136459     144645976
ENV75        76496      183711215
ENV76        46339      226447634
ENV77        78143      298833672
ENV78        88499      296476120
ENV79        2991       292426315
ENV8         14         44651888
ENV9         76         217162029
EST1         152676     59069390
EST10        155716     67095973
EST100       152778     76471565
EST101       145010     99279907
EST102       145172     85252768
EST103       148873     93081688
EST104       7515       4350644
EST105       149617     109417790
EST106       135201     99318378
EST107       136259     97454300
EST108       136240     94831240
EST109       2404       1587299
EST11        163527     69169482
EST110       136751     77270907
EST111       176402     105757023
EST112       193950     119224074
EST113       236922     141664136
EST114       6627       4069381
EST115       229453     127643708
EST116       181415     102870914
EST117       190249     93414076
EST118       5248       4073334
EST119       148552     100253258
EST12        150881     64818035
EST120       154735     119130491
EST121       166280     97900067
EST122       22063      15461205
EST123       130028     82530428
EST124       83543      30920786
EST125       36769      12485692
EST126       84106      31034635
EST127       84264      34515269
EST128       33711      11378339
EST129       85031      32709177
EST13        186630     83471161
EST130       82017      34968192
EST131       83454      35266094
EST132       84118      32965334
EST133       14468      5903340
EST134       83460      51063090
EST135       173481     87480434
EST136       170361     77647991
EST137       145527     91797238
EST138       29659      18775715
EST139       140355     87014374
EST14        104811     47840316
EST140       149335     97877743
EST141       157292     78661333
EST142       181198     92623099
EST143       8928       5198058
EST144       141571     76041135
EST145       151619     73235123
EST146       148412     87034276
EST147       155766     83575958
EST148       11706      6903282
EST149       166215     102160051
EST15        197326     111627972
EST150       202194     107310927
EST151       158867     93286369
EST152       102222     51075859
EST153       155639     79042501
EST154       135075     80133731
EST155       141690     88158876
EST156       165810     85752287
EST157       9314       5218716
EST158       178955     104146744
EST159       218711     94419121
EST16        147207     104727434
EST160       145779     85813988
EST161       161375     87629602
EST162       3062       1523802
EST163       140660     82396713
EST164       132522     83740466
EST165       147239     88250074
EST166       146464     80718105
EST167       20644      10465585
EST168       117769     61073260
EST169       115690     61941713
EST17        156582     83437611
EST170       122419     54128062
EST171       121107     48630686
EST172       29423      11431564
EST173       122215     48678047
EST174       125709     48482605
EST175       165795     83310643
EST176       172205     75576921
EST177       24657      15513157
EST178       147743     104364925
EST179       163429     99358064
EST18        190951     116800077
EST180       205284     116217156
EST181       167108     93350542
EST182       154079     103286743
EST183       134219     92993843
EST184       10781      6013701
EST185       146582     94120876
EST186       154988     80945678
EST187       131949     71060625
EST188       160846     90600470
EST189       13393      8468221
EST19        177400     113022366
EST190       148840     87645185
EST191       153698     95464921
EST192       175523     99185391
EST193       140423     77123132
EST194       5092       4172247
EST195       123967     64273734
EST196       162722     90850517
EST197       173183     99602742
EST198       149609     92840514
EST199       6210       3892188
EST2         157282     60510852
EST20        71000      55722012
EST200       164744     79130838
EST201       122492     84332756
EST202       163358     96332572
EST203       163857     96044709
EST204       14395      6879298
EST205       5847       2580354
EST206       111103     63044131
EST207       151046     87021483
EST208       107365     63627893
EST209       164131     100717476
EST21        194381     109138766
EST210       168271     124553548
EST211       82827      67366748
EST212       186242     95036481
EST213       145260     90138733
EST214       87567      65796037
EST215       141914     85219333
EST216       137898     75149598
EST217       95604      30686008
EST218       146894     86267439
EST219       148594     82459905
EST22        179794     92387328
EST220       141359     94228947
EST221       155420     90008351
EST222       9706       6814092
EST223       161771     99542731
EST224       154079     93665372
EST225       123359     88323100
EST226       146020     90237685
EST227       6963       4216754
EST228       128831     82021098
EST229       127856     89666249
EST23        107402     50556226
EST230       44462      31954010
EST231       156429     83331488
EST232       167399     92029721
EST233       166930     92691445
EST234       158125     88082990
EST235       163896     91508682
EST236       163228     92242200
EST237       166033     91294921
EST238       154891     85088026
EST239       168030     90687163
EST24        190972     61390762
EST240       187909     98489047
EST241       191311     107041774
EST242       168381     100323964
EST243       180025     103224685
EST244       190025     112759300
EST245       186323     113230756
EST246       178010     115392887
EST247       7071       5607359
EST248       140689     86235688
EST249       212624     138847765
EST25        136527     39211071
EST250       226912     111308057
EST251       164069     113913134
EST252       183146     95756964
EST253       197974     98471029
EST254       123046     89289573
EST255       7475       5185523
EST256       140224     82365172
EST257       206165     112641063
EST258       162517     106389114
EST259       93648      92356852
EST26        102354     27619605
EST260       15357      19986774
EST261       147622     99189632
EST262       150767     89756528
EST263       139176     101742893
EST264       216336     99353332
EST265       4565       2821766
EST266       133636     96436124
EST267       129480     90283987
EST268       135526     98313237
EST269       113350     81420942
EST27        201338     85169852
EST270       17516      11104500
EST271       136224     84348047
EST272       125703     85851017
EST273       127789     96576509
EST274       36548      26163923
EST275       126643     89388805
EST276       116524     79042651
EST277       138898     83679903
EST278       145962     114898436
EST279       15579      11020136
EST28        19821      8893541
EST280       125395     117388350
EST281       132433     98775254
EST282       162337     97562555
EST283       165664     104470663
EST284       19257      12070221
EST285       142244     92439543
EST286       168943     115108709
EST287       151678     103899230
EST288       136291     103153979
EST289       3472       2297545
EST29        203801     100091766
EST290       159549     97229973
EST291       222526     90766361
EST292       152836     111325212
EST293       160406     71767282
EST294       10503      1187900
EST295       208917     37980980
EST296       212285     83331327
EST297       150079     115258622
EST298       168109     97764449
EST299       154827     103149238
EST3         156018     54727763
EST30        216481     109022941
EST300       169052     109970400
EST301       149395     109822175
EST302       2197       1476231
EST303       180745     102235670
EST304       178556     93090304
EST305       168973     109472164
EST306       158897     104102836
EST307       2411       1923896
EST308       225880     106203457
EST309       266222     115902028
EST31        153855     67071563
EST310       185440     112103160
EST311       151096     28710776
EST312       227853     99483459
EST313       175581     100343452
EST314       156175     99883140
EST315       159727     95006074
EST316       543        410397
EST317       166298     114042738
EST318       179945     95180012
EST319       143780     97257262
EST32        149562     63751558
EST320       188320     110423173
EST321       187360     49128528
EST322       201669     33864879
EST323       174165     95391984
EST324       14772      9232819
EST325       158235     113265480
EST326       184738     110428476
EST327       167428     97750567
EST328       165965     109745188
EST329       165849     71375282
EST33        165159     65680081
EST330       127635     80036880
EST331       121236     80456825
EST332       146639     101331657
EST333       22486      8250892
EST334       250611     26632520
EST335       254708     23392212
EST336       152004     94195783
EST337       152251     98608210
EST338       150976     99681932
EST339       145898     92253111
EST34        147004     64493309
EST340       237629     43480316
EST341       185646     80878769
EST342       4021       4963998
EST343       168840     99775969
EST344       163966     101133216
EST345       145648     92755775
EST346       189443     103114377
EST347       156148     109739284
EST348       153297     101566189
EST349       2426       915498
EST35        162552     70856093
EST350       184230     108290864
EST351       169884     94656881
EST352       169173     105206551
EST353       178636     59717910
EST354       195269     72030896
EST355       194748     75388710
EST356       197291     74551080
EST357       134728     70211808
EST358       174807     127367579
EST359       148391     85100581
EST36        160815     65981092
EST360       150483     86625647
EST361       121476     94901460
EST362       5932       4701523
EST363       142701     94368059
EST364       155330     94309089
EST365       162012     90113788
EST366       157009     100315910
EST367       23643      10396066
EST368       45656      24624838
EST369       155293     104537031
EST37        107941     33682655
EST370       137832     97018853
EST371       158406     101968297
EST372       152636     109694799
EST373       30266      25783558
EST374       173564     146756127
EST375       163544     85426714
EST376       127562     80904900
EST377       137826     94038840
EST378       51307      35926427
EST379       131619     88276056
EST38        99513      30489875
EST380       137093     89601408
EST381       139337     96986761
EST382       147160     97102148
EST383       51247      41093666
EST384       164163     86543504
EST385       143622     81414969
EST386       144917     86070913
EST387       144174     103725090
EST388       155671     93199334
EST389       137838     87384737
EST39        99154      31399112
EST390       132358     84149156
EST391       20621      12735139
EST392       196942     107257732
EST393       136851     75001285
EST394       92969      54570705
EST395       120408     80237774
EST396       23482      14313208
EST397       131137     82988342
EST398       119642     76596711
EST399       147274     80748116
EST4         142972     56362966
EST40        98816      29786908
EST400       210376     82563196
EST401       30531      12823211
EST402       163628     84364287
EST403       163914     99171502
EST404       159146     95828757
EST405       125989     81300696
EST406       12161      7969381
EST407       129505     86703580
EST408       137395     90180185
EST409       178556     111879524
EST41        39236      11600145
EST410       154174     93122560
EST411       27981      12146305
EST412       166683     91977745
EST413       168828     124886745
EST414       87419      56155432
EST415       69678      41106155
EST416       34134      16805232
EST417       137508     79953191
EST418       82435      49421981
EST419       139695     56837590
EST42        101326     31351096
EST420       148165     29996844
EST421       148030     30296764
EST422       162600     80122839
EST423       28322      14992272
EST424       201213     115842274
EST425       237755     108748070
EST426       220152     107479554
EST427       127106     74508992
EST428       128057     85803248
EST429       131704     80409324
EST43        102633     36243427
EST430       93228      56881081
EST431       174105     110064955
EST432       213136     84698644
EST433       106574     28506785
EST434       183471     112008437
EST435       203905     111386178
EST436       180307     106396407
EST437       199637     118042696
EST438       132935     62223660
EST439       110330     60167533
EST44        95475      48218258
EST440       162601     108614110
EST441       181152     115720728
EST442       108077     86015819
EST443       177004     139599957
EST444       150295     90619060
EST445       54250      34510266
EST446       166056     106956443
EST447       178219     101078638
EST448       42963      24524631
EST449       195466     106587863
EST45        121121     52335541
EST450       183935     94237774
EST451       52147      38920690
EST452       189910     115818986
EST453       180010     117991294
EST454       54575      33990107
EST455       196573     133887305
EST456       219857     123775014
EST457       190087     126956582
EST458       189311     147449039
EST459       240        204401
EST46        55810      33167886
EST460       204237     155999097
EST461       192186     115130551
EST462       160758     96336999
EST463       181263     94919465
EST464       7389       613153
EST465       53496      4381716
EST466       158232     12239421
EST467       144975     12987161
EST468       147925     29931089
EST469       148356     29501756
EST47        176557     89017795
EST470       8452       1761940
EST471       148043     30264080
EST472       141212     81174487
EST473       171368     100067589
EST474       161648     110828410
EST475       19450      13804348
EST476       160786     92773669
EST477       150648     104119784
EST478       133680     93215925
EST479       141644     98055796
EST48        158183     65088174
EST480       16394      8452879
EST481       157371     103675515
EST482       146436     105285373
EST483       162015     97563475
EST484       165796     50902234
EST485       11902      1870117
EST486       160476     40344382
EST487       150798     102143723
EST488       146638     96520117
EST489       170800     112269129
EST49        162221     91938423
EST490       21948      11903259
EST491       132527     75702844
EST492       189749     107907416
EST493       149390     109146835
EST494       53584      36369591
EST495       126855     87064282
EST496       145499     90195929
EST497       147345     88597360
EST498       163204     89119617
EST499       37036      18893940
EST5         162046     62591557
EST50        154876     80579871
EST500       151785     92116569
EST501       155952     91949431
EST502       168252     101940533
EST503       136388     85423657
EST504       15950      9025714
EST505       100253     71169364
EST506       78626      60620272
EST507       97471      64748244
EST508       143349     80447229
EST509       37265      21239218
EST51        156390     74771983
EST510       120626     73365540
EST511       133392     87396068
EST512       135163     79259009
EST513       151533     92857854
EST514       47048      25601310
EST515       155600     85748129
EST516       184618     110443864
EST517       120095     78936437
EST518       178668     94913542
EST519       5722       2172641
EST52        108219     61222574
EST520       52576      18674859
EST521       182569     100663650
EST522       152148     81321895
EST523       23053      13928703
EST524       162316     94446797
EST525       211236     123658554
EST526       30185      19341621
EST527       147958     99624045
EST528       158446     97595891
EST529       134305     87490150
EST53        153906     88947034
EST530       128605     87865201
EST531       26182      16357153
EST532       178675     74362205
EST533       179100     79391228
EST534       198856     83506649
EST535       194861     80609089
EST536       4095       1379666
EST537       178841     95307232
EST538       174076     102227567
EST539       180191     107920861
EST54        154191     84965745
EST540       172258     103856477
EST541       196663     126493129
EST542       186425     103119121
EST543       178904     82831722
EST544       148028     94300205
EST545       206518     125003286
EST546       205657     126701639
EST547       188926     108266858
EST548       208317     121345654
EST549       34317      17820709
EST55        152220     92234215
EST550       154052     96415299
EST551       188315     117674408
EST552       166547     98818629
EST553       133848     98348660
EST554       8666       7053012
EST555       157219     92146041
EST556       170364     84880278
EST557       149253     85158880
EST558       151161     81932105
EST559       11899      7114414
EST56        150018     69957229
EST560       156484     79967111
EST561       181237     106306680
EST562       162166     102980888
EST563       175037     107738299
EST564       4095       2823328
EST565       170706     117073091
EST566       183779     113547121
EST567       129219     83790320
EST568       168574     97322346
EST569       185350     110254910
EST57        142162     76714634
EST570       38647      25576104
EST571       204465     119127975
EST572       269500     91747576
EST573       25706      9441749
EST574       262208     83553217
EST575       157843     95706673
EST576       156061     104112677
EST577       162591     58135590
EST578       92203      36397309
EST58        151712     83218730
EST59        161193     65788370
EST6         166228     65026396
EST60        144589     70133092
EST61        160365     89939140
EST62        150337     92592984
EST63        150109     99270886
EST64        157599     94515357
EST65        2729       1149637
EST66        154753     103415401
EST67        162949     82998651
EST68        166589     84840478
EST69        142352     77836923
EST7         163850     67729799
EST70        148303     82498115
EST71        148982     86080694
EST72        148452     92219101
EST73        150506     87393909
EST74        3367       1993359
EST75        29919      18235506
EST76        186623     102758272
EST77        170455     90769208
EST78        212135     115450370
EST79        179537     103352293
EST8         161034     67849081
EST80        2595       1769868
EST81        196745     121640362
EST82        167532     93332595
EST83        136013     63286520
EST84        128083     62610791
EST85        11185      5740613
EST86        150319     92587484
EST87        154531     96912480
EST88        130223     66329267
EST89        140169     89287993
EST9         169413     69378292
EST90        14619      7602591
EST91        183459     91893008
EST92        204450     119806817
EST93        202065     108012137
EST94        192053     90423413
EST95        203798     86996774
EST96        145904     86952848
EST97        137792     84712145
EST98        158921     76750167
EST99        9280       6073374
GSS1         172818     126565512
GSS10        15063      14534273
GSS100       156116     139401502
GSS101       16660      10968419
GSS102       168722     143967545
GSS103       157878     109069542
GSS104       156130     106446313
GSS105       152737     105718247
GSS106       168006     122784077
GSS107       149452     126270618
GSS108       161684     125096048
GSS109       186495     115926183
GSS11        145620     106560749
GSS110       16919      10327274
GSS111       185687     119751799
GSS112       201287     103923207
GSS113       219830     124101551
GSS114       87638      57037950
GSS115       151982     114076675
GSS116       155174     118808984
GSS117       155138     118870658
GSS118       163305     106817350
GSS119       37490      21563377
GSS12        199531     104011176
GSS120       179013     131661113
GSS121       189765     117491847
GSS122       166053     55057548
GSS123       169938     76249060
GSS124       3108       2065491
GSS125       161448     105035511
GSS126       188861     124688564
GSS127       200296     82002210
GSS128       168220     79987296
GSS129       137268     94431217
GSS13        191750     84122819
GSS130       129855     104605133
GSS131       132043     108777560
GSS132       132451     106048276
GSS133       8056       5958858
GSS134       135214     112032054
GSS135       56598      47104660
GSS136       132584     107786768
GSS137       139149     116140565
GSS138       140043     114408742
GSS139       138251     109584898
GSS14        173813     89348055
GSS140       4155       2820771
GSS141       134784     106426486
GSS142       134049     108003847
GSS143       134400     111531585
GSS144       138188     116474348
GSS145       4675       3643453
GSS146       139468     108106612
GSS147       136810     113648547
GSS148       136898     113473892
GSS149       137299     112649085
GSS15        1942       990420
GSS150       559        466085
GSS151       137155     110923756
GSS152       134480     106278327
GSS153       133002     107665198
GSS154       138659     116136290
GSS155       1985       1674795
GSS156       127182     92203837
GSS157       174122     105056445
GSS158       184491     110111133
GSS159       162397     108642338
GSS16        167950     83915732
GSS160       177416     102428926
GSS161       195401     128350696
GSS162       201539     133261553
GSS163       200714     134062384
GSS164       181014     126532494
GSS165       198341     136948587
GSS166       196713     139067120
GSS167       196064     138671402
GSS168       174299     134354206
GSS169       144474     97339661
GSS17        159733     81434885
GSS170       138053     80502012
GSS171       165315     73484620
GSS172       130293     57961944
GSS173       162971     140972883
GSS174       170927     113508196
GSS175       80878      52986476
GSS176       191836     128985792
GSS177       195995     117721523
GSS178       29060      15232802
GSS179       180225     98140530
GSS18        155956     85599361
GSS180       181302     123365801
GSS181       178800     126906476
GSS182       181098     127179984
GSS183       19114      12799890
GSS184       165902     130533276
GSS185       170769     155442034
GSS186       219492     123624062
GSS187       216568     103419657
GSS188       17938      8362456
GSS189       210015     95106166
GSS19        153559     95946744
GSS190       162425     134536276
GSS191       16879      16812210
GSS192       125540     102753347
GSS193       122235     93469471
GSS194       156641     154268782
GSS195       167926     158459909
GSS196       131396     104305071
GSS197       149360     107958474
GSS198       170079     141603399
GSS199       173853     119767432
GSS2         172571     106974251
GSS20        153654     72719206
GSS200       20792      12076547
GSS201       181326     133978343
GSS202       184903     120111167
GSS203       180120     93026884
GSS204       172833     121727487
GSS205       189431     117159380
GSS206       189632     116856204
GSS207       21296      12387505
GSS208       200656     130020228
GSS209       215713     142627344
GSS21        106599     59132134
GSS210       217639     140378671
GSS211       166383     136378793
GSS212       152394     108659129
GSS213       159527     120137430
GSS214       159222     144721897
GSS215       159797     141631201
GSS216       160025     145012269
GSS217       161623     143744366
GSS218       162207     142682743
GSS219       161901     124660013
GSS22        132522     64635660
GSS220       168118     139542770
GSS221       162158     116272085
GSS222       180642     88789528
GSS223       2275       1543221
GSS224       251369     52150506
GSS225       262481     40466091
GSS226       262523     40408947
GSS227       122800     38229504
GSS228       253355     52912344
GSS229       182565     86129448
GSS23        125192     56723722
GSS230       188824     55952203
GSS231       154340     118464017
GSS232       177033     144334259
GSS233       160566     145786280
GSS234       158963     146486119
GSS235       175119     110481562
GSS236       238210     57319690
GSS237       198718     101419800
GSS238       228550     39520519
GSS239       119400     74782163
GSS24        133968     72981771
GSS240       173535     111783710
GSS241       148014     90085518
GSS242       140464     83790991
GSS243       159730     149647456
GSS244       6503       5533776
GSS245       112668     95722541
GSS246       180351     149222837
GSS247       172952     122406011
GSS248       201906     127716686
GSS249       188212     120277412
GSS25        142794     74274291
GSS250       166175     94403497
GSS251       159865     84500591
GSS252       156428     119869599
GSS253       203515     148105542
GSS254       14310      9406216
GSS255       171523     67875770
GSS256       176316     96175653
GSS257       195480     152066346
GSS258       199052     153893384
GSS259       8581       7079434
GSS26        12574      5388027
GSS260       197610     157072181
GSS261       197570     124238096
GSS262       194874     142538969
GSS263       853        588710
GSS264       214431     131244295
GSS265       189953     57620998
GSS266       211774     108913136
GSS267       177797     157192397
GSS268       163847     150141472
GSS269       233829     131848785
GSS27        140896     65655631
GSS270       241255     120361822
GSS28        159847     79832355
GSS29        156451     92519127
GSS3         138091     115757733
GSS30        164864     85230462
GSS31        10282      5319388
GSS32        171961     102867176
GSS33        182793     109077642
GSS34        182266     87042106
GSS35        173002     102201374
GSS36        190487     103919871
GSS37        162239     112347665
GSS38        160362     98313234
GSS39        173083     108442870
GSS4         140070     112435838
GSS40        4467       3211536
GSS41        183985     122974505
GSS42        181741     117322404
GSS43        52286      27335335
GSS44        177820     102905200
GSS45        164518     141969870
GSS46        179633     148569334
GSS47        139686     92499212
GSS48        182873     132017102
GSS49        181617     114554523
GSS5         12740      9526334
GSS50        204428     116967955
GSS51        185581     99459566
GSS52        211954     108037045
GSS53        211747     108318359
GSS54        197283     132772792
GSS55        158243     124832316
GSS56        185583     139405028
GSS57        196772     63136393
GSS58        171739     96411428
GSS59        157707     106161954
GSS6         152750     116376137
GSS60        23373      13575160
GSS61        166615     156644394
GSS62        177188     98818477
GSS63        161235     115245018
GSS64        172262     112292681
GSS65        175437     118749924
GSS66        184317     127706706
GSS67        205680     128787401
GSS68        187487     111746271
GSS69        904        494120
GSS7         170822     119987739
GSS70        200507     134082593
GSS71        215979     158545254
GSS72        188980     137988156
GSS73        173702     107612445
GSS74        198148     111946385
GSS75        140507     76313882
GSS76        163068     95818066
GSS77        10997      7015314
GSS78        159270     97756741
GSS79        159481     96970229
GSS8         177098     108890889
GSS80        172278     114346124
GSS81        170756     109404389
GSS82        174615     122489482
GSS83        188951     105344114
GSS84        175437     126363935
GSS85        163968     106294793
GSS86        1150       906691
GSS87        189248     108544814
GSS88        180902     113819623
GSS89        166588     117808805
GSS9         141916     118718103
GSS90        192391     105665595
GSS91        10240      5928398
GSS92        213831     107550639
GSS93        226833     89047322
GSS94        213068     138993481
GSS95        183490     92580894
GSS96        94686      37020965
GSS97        193805     75823638
GSS98        201086     123394316
GSS99        191020     122180795
HTC1         41190      63371632
HTC2         32318      72271528
HTC3         32081      77888423
HTC4         84851      50686507
HTC5         129506     161161965
HTC6         125282     123135242
HTC7         137566     130735831
HTC8         68694      61911760
HTG1         3784       374870703
HTG10        2848       363016285
HTG11        1976       365940103
HTG12        1714       382089084
HTG13        1718       381796340
HTG14        1659       383118453
HTG15        1835       380424998
HTG16        1750       361896240
HTG17        1843       380599315
HTG18        1752       382301790
HTG19        1775       381824019
HTG2         5068       373604329
HTG20        1891       380883515
HTG21        2135       355865123
HTG22        2426       376351102
HTG23        2269       379507879
HTG24        2442       381163865
HTG25        2175       382733656
HTG26        2070       368006459
HTG27        2074       380458182
HTG28        2061       380108509
HTG29        1047       202962639
HTG3         2556       370662362
HTG30        2040       379446758
HTG31        2203       375546591
HTG32        986        170706729
HTG33        2152       379221269
HTG34        2348       376393195
HTG35        1372       195850538
HTG36        2462       370234045
HTG37        2428       372528369
HTG38        1015       169191937
HTG39        2235       381490266
HTG4         2735       369989641
HTG40        2336       385145188
HTG41        1069       180930974
HTG42        2312       384776536
HTG43        2363       384490832
HTG44        906        155597869
HTG45        2500       379735659
HTG46        2319       385244375
HTG47        927        158722850
HTG48        2315       385567657
HTG49        2293       386023883
HTG5         2500       373389217
HTG50        900        149450476
HTG51        2237       385154833
HTG52        2106       380011723
HTG53        657        122585305
HTG54        2010       379525743
HTG55        1981       378955508
HTG56        1184       193581815
HTG57        2144       380658486
HTG58        2686       383430148
HTG59        2972       383122016
HTG6         2          386956
HTG60        885        128384665
HTG61        2959       380503057
HTG62        3012       366231486
HTG63        2990       372824610
HTG64        2953       336850403
HTG65        3178       359117111
HTG66        3179       359260560
HTG67        3186       360427818
HTG68        3128       367889098
HTG69        2913       377859052
HTG7         2327       375791086
HTG70        1846       312468258
HTG71        3415       365492036
HTG72        2071       381329139
HTG73        1668       298160154
HTG74        2088       382520375
HTG75        2244       384445864
HTG76        1669       296247510
HTG77        2201       385233869
HTG78        2249       384504439
HTG79        3218       384021459
HTG8         1500       384347777
HTG80        2165       384532378
HTG81        3034       373211752
HTG82        2129       232577023
HTG9         1582       384062276
INV1         154229     140145636
INV10        4          353796308
INV100       73599      60970631
INV100       1          476618521
INV100       1          348474640
INV100       1          332259893
INV100       1          287425978
INV100       1          237816702
INV100       1          222571878
INV100       2          391571136
INV100       8          340292240
INV100       1          47220557
INV100       4          366546274
INV101       167095     134109160
INV101       12         379725079
INV101       19         391162514
INV101       10         251573840
INV101       19         379932152
INV101       33         382987660
INV101       33         386339958
INV101       30         353746939
INV101       21         371601066
INV101       6          362567176
INV101       13         390937191
INV102       126882     112526423
INV102       12         231701502
INV102       27         388004708
INV102       229        382141802
INV102       33         392005379
INV102       11         192522327
INV102       20         349696121
INV102       9          386500094
INV102       11         373924042
INV102       9          250287188
INV102       16         392208593
INV103       37136      273256295
INV103       30         375590146
INV103       20         381850848
INV103       9          220479775
INV103       3          349443465
INV103       3          121655962
INV103       1          378734160
INV103       1          272287048
INV103       6          307813224
INV103       29         391276627
INV103       16         383716194
INV104       2779       371575686
INV104       34         374759466
INV104       5          262281928
INV104       11         371329702
INV104       6          368879584
INV104       7          350337011
INV104       14         345060509
INV104       28         376473495
INV104       20         387688055
INV104       25         387549397
INV104       16         273291927
INV105       44         370097884
INV105       21         391659234
INV105       15         388003948
INV105       17         392782098
INV105       22         384497843
INV105       1          384599746
INV105       1          375927842
INV105       5          382993214
INV105       19         385797313
INV105       11         123214675
INV105       3          392646952
INV106       24         379270301
INV106       11         381074049
INV106       23         391735799
INV106       18         390168307
INV106       2          42007124
INV106       17         349645545
INV106       36         391559871
INV106       15         393037217
INV106       17         380153622
INV106       3          59787137
INV106       18         391697154
INV107       5          76533839
INV107       18         366312255
INV107       3          337894111
INV107       4          302073392
INV107       2          299644653
INV107       2          270514050
INV107       3          389949835
INV107       3          377785151
INV107       1          117072231
INV107       7          379476447
INV107       13         370594929
INV108       32         391299062
INV108       19         385355871
INV108       19         310143194
INV108       24         379964624
INV108       23         389484464
INV108       18         384799792
INV108       11         311697054
INV108       19         385416179
INV108       23         381933246
INV108       21         387246911
INV108       4          249799159
INV109       25         362900281
INV109       2          366882438
INV109       14         388370346
INV109       21         372413558
INV109       11         364644469
INV109       9          299858585
INV109       3          322474280
INV109       5          373079097
INV109       6          253444959
INV109       1          278847389
INV109       2          381917736
INV11        6          363887313
INV110       18         380479131
INV110       5          382304965
INV110       10         386062363
INV110       10         259701476
INV110       13         376291971
INV110       17         379702260
INV110       14         391466716
INV110       23         381561736
INV110       7          104919562
INV110       17         384568933
INV110       4          354385143
INV111       19         390062857
INV111       5          393615696
INV111       5          350509167
INV111       13         170433122
INV111       41         385022073
INV111       30         380703697
INV111       20         392681339
INV111       13         369303117
INV111       3          121760452
INV111       10         368178692
INV111       15         386351526
INV112       5          134896453
INV112       16         393205423
INV112       22         382093519
INV112       5          84901051
INV112       23         391606292
INV112       19         384186373
INV112       24         387846790
INV112       20         373516354
INV112       4          111080816
INV112       18         393422118
INV112       46         378688286
INV113       18         373966012
INV113       19         382845041
INV113       14         380720656
INV113       16         377993913
INV113       13         388384596
INV113       15         353225248
INV113       10         385225146
INV113       11         273470899
INV113       12         363823232
INV113       18         371293482
INV113       18         391994412
INV114       24         386584721
INV114       31         390819384
INV114       6          350425796
INV114       14         392098573
INV114       29         373609145
INV114       17         389590392
INV114       16         381486986
INV114       15         318246839
INV114       17         388617783
INV114       14         389176964
INV114       29         259715661
INV115       8          380395300
INV115       4          364567413
INV115       8          381014917
INV115       2          78434448
INV115       5          350286208
INV115       2          290331975
INV115       2          278888238
INV115       2          276514222
INV115       2          269676904
INV115       4          363956289
INV115       18         391284265
INV116       19         379365223
INV116       12         224045865
INV116       19         391324862
INV116       17         390982751
INV116       18         376274198
INV116       19         352401134
INV116       3          302186515
INV116       4          353711471
INV116       5          357741396
INV116       13         382478042
INV116       12         224411599
INV117       9          138772803
INV117       17         376440323
INV117       17         366693890
INV117       13         391571027
INV117       18         382117156
INV117       3          51115388
INV117       24         358079042
INV117       12         377073348
INV117       21         382278417
INV117       30         359479577
INV117       2          70328500
INV118       28         391443580
INV118       13         381531391
INV118       10         308545783
INV118       3          357081424
INV118       3          303625532
INV118       2          181194408
INV118       13         384377122
INV118       33         392079687
INV118       13         343474254
INV118       1          226676804
INV118       1          219059534
INV119       28         392100242
INV119       16         385377860
INV119       22         389649401
INV119       14         386739832
INV119       14         369921279
INV119       1          61636059
INV119       7          366264750
INV119       9          350557811
INV119       15         365667369
INV119       6          378807618
INV119       186        393477787
INV12        15         387960114
INV120       45         382097969
INV120       10         373214505
INV120       7          128813925
INV120       37         384493639
INV120       27         388854011
INV120       23         380037898
INV120       28         363846557
INV120       15         377681854
INV120       22         393673783
INV120       9          130141504
INV120       20         389123558
INV121       27         372689086
INV121       20         387294169
INV121       14         389119304
INV121       19         379601315
INV121       23         386448258
INV121       8          389213531
INV121       13         380257717
INV121       204        387365574
INV121       30         392954113
INV121       3          276039202
INV121       2          378921420
INV122       18         385206419
INV122       2          303390991
INV122       9          391074667
INV122       16         390694906
INV122       12         366488514
INV122       4          325784878
INV122       6          389357642
INV122       9          384120626
INV122       11         376230233
INV122       5          157146748
INV122       15         387407218
INV123       12         373566826
INV123       10         372793310
INV123       13         386573559
INV123       15         366464331
INV123       25         368796884
INV123       14         394572131
INV123       15         272825452
INV123       7          382020802
INV123       3          377751995
INV123       1          74373700
INV123       6          372848766
INV124       1          94407144
INV124       19         392995865
INV124       20         361450650
INV124       18         393654662
INV124       27         368630202
INV124       24         392519924
INV124       20         384861097
INV124       24         394625452
INV124       21         320922556
INV124       4          339818558
INV124       6          372821066
INV125       15         381614547
INV125       12         375257232
INV125       18         356987095
INV125       14         392597749
INV125       21         390274896
INV125       3          43344510
INV125       31         388699035
INV125       27         388119446
INV125       10         369434192
INV125       17         377251515
INV125       4          346682597
INV126       29         387067226
INV126       3          85114833
INV126       22         388207738
INV126       17         378212285
INV126       16         392106212
INV126       25         393533165
INV126       6          365268265
INV126       9          317988506
INV126       13         387631941
INV126       19         375812714
INV126       6          360702987
INV127       25         384930026
INV127       9          377395012
INV127       315        360903659
INV127       24         386975977
INV127       2          20618579
INV127       11         379797353
INV127       7          271219600
INV127       6          392152830
INV127       13         379500142
INV127       21         377719287
INV127       17         385022185
INV128       18         381070342
INV128       3          60281174
INV128       8          344365302
INV128       4          370341263
INV128       5          385484997
INV128       3          361480762
INV128       2          227816091
INV128       3          326627480
INV128       3          179785975
INV128       1          394411929
INV128       1          208357731
INV129       96888      235175056
INV129       2          387387157
INV129       28         393959523
INV129       241        387119275
INV129       22         379489872
INV129       23         385909353
INV129       7          124975265
INV129       15         390696136
INV129       18         371915036
INV129       16         382295963
INV129       15         370940962
INV13        26         384468692
INV130       124542     97379247
INV130       8          363964332
INV130       7          216076461
INV130       1          222508353
INV130       2          378391780
INV130       11         365473561
INV130       4          178163008
INV130       24         386512327
INV130       26         391903437
INV130       36         382490299
INV130       14         376797262
INV131       28942      319697553
INV131       8          203772100
INV131       21         389229967
INV131       14         386982868
INV131       19         389026688
INV131       10         374195572
INV131       7          158156167
INV131       15         377259953
INV131       23         388223446
INV131       14         372625691
INV131       19         382678381
INV132       28941      347133943
INV132       10         189595137
INV132       24         380015923
INV132       20         388962198
INV132       14         379590905
INV132       13         301439739
INV132       15         378313646
INV132       15         386611886
INV132       23         392780439
INV132       14         300976708
INV132       22         355579415
INV133       20         388604938
INV133       6          382504563
INV133       8          311266892
INV133       3          335903695
INV133       1          91272002
INV133       4          340601518
INV133       5          393178719
INV133       7          378352357
INV133       8          368654020
INV133       3          55757405
INV133       1          219663937
INV134       15         389699299
INV134       2          347956425
INV134       5          371419038
INV134       12         376377240
INV134       16         384236082
INV134       8          176370631
INV134       18         372019888
INV134       24         386509465
INV134       24         389713698
INV134       31         307760477
INV134       5          386523964
INV135       16         252138391
INV135       1          28255227
INV135       5          90894419
INV135       1          485851375
INV135       1          214862200
INV135       8          378994418
INV135       19         376407609
INV135       46         376414438
INV135       3          388122302
INV135       11         318389619
INV135       3          234762902
INV136       34         391108680
INV136       2          315919502
INV136       6          393647630
INV136       11         381373389
INV136       19         381074705
INV136       22         386497102
INV136       21         390526659
INV136       254        366101051
INV136       12         386296471
INV136       16         387655277
INV136       21         383151662
INV137       71         392017627
INV137       20         383401877
INV137       19         344640379
INV137       1          82766246
INV137       17         385091065
INV137       20         387924663
INV137       12         388536663
INV137       8          219178196
INV137       11         367097380
INV137       13         382777311
INV137       13         359364339
INV138       24         388974367
INV138       7          252534006
INV138       7          348359881
INV138       6          327698438
INV138       2          316788101
INV138       3          312494531
INV138       4          204379861
INV138       1          406294527
INV138       1          310928733
INV138       3          388958877
INV138       11         148169598
INV139       21         381982755
INV139       1          249786838
INV139       2          319646621
INV139       4          298015822
INV139       1          281865375
INV139       1          241717587
INV139       10         375364887
INV139       17         384501009
INV139       11         328663993
INV139       1          106314825
INV139       4          339541539
INV14        28         386959391
INV140       20         377528210
INV140       7          369695073
INV140       5          344800758
INV140       8          394204524
INV140       4          119862796
INV140       10         365101424
INV140       18         388033671
INV140       26         393220942
INV140       12         266980887
INV140       19         392458449
INV140       55         389557696
INV141       24         388990898
INV141       24         387260689
INV141       13         234291481
INV141       7          258353618
INV141       2          295700062
INV141       7          366943025
INV141       11         381355472
INV141       4          106561761
INV141       19         343847635
INV141       17         382516650
INV141       2          332743733
INV142       29         394663938
INV142       6          313828708
INV142       16         380123343
INV142       45         361967714
INV142       3          372946856
INV142       7          266485410
INV142       18         382230867
INV142       10         304685791
INV142       3          347667496
INV142       20         363448675
INV142       26         391194852
INV143       27         393364046
INV143       9          375785816
INV143       10         364023583
INV143       9          272133891
INV143       9          363725267
INV143       8          384234607
INV143       10         393372120
INV143       40         329899252
INV143       6          337260709
INV143       5          383946385
INV143       12         302989156
INV144       23         381713426
INV144       19         376745921
INV144       15         386872820
INV144       19         377921066
INV144       21         391511415
INV144       5          268714484
INV144       2          354551436
INV144       1          157299779
INV144       3          175039039
INV144       1          258850354
INV144       2          335699355
INV145       137        350719386
INV145       4          247610254
INV145       1          210654766
INV145       2          362253048
INV145       2          291631295
INV145       2          121261647
INV145       1          373316775
INV145       1          242235330
INV145       1          230154751
INV145       1          215250610
INV145       11         384181851
INV146       4          381900476
INV146       21         394628944
INV146       21         388317282
INV146       5          124958072
INV146       20         371325954
INV146       17         377167253
INV146       16         316992586
INV146       8          380596977
INV146       3          59344420
INV146       26         368094122
INV146       14         385505339
INV147       24         389620289
INV147       18         337616521
INV147       2          326309498
INV147       4          392502457
INV147       5          316388481
INV147       10         382487467
INV147       14         367500819
INV147       17         393579082
INV147       16         320660384
INV147       5          358120367
INV147       8          361433354
INV148       33         393229173
INV148       3          310200528
INV148       16         382164179
INV148       24         382990678
INV148       14         386676724
INV148       20         389628974
INV148       9          139734111
INV148       30         384304423
INV148       22         379619161
INV148       5          201083147
INV148       1          214309029
INV149       9          344807465
INV149       2          362516173
INV149       2          344553920
INV149       2          335374504
INV149       2          321615305
INV149       2          309892614
INV149       2          295904703
INV149       2          292629611
INV149       2          287511714
INV149       2          281066585
INV149       3          371349787
INV15        37215      321579386
INV150       23         323415557
INV150       23         393225346
INV150       13         347530107
INV150       4          341473635
INV150       4          373447781
INV150       5          352685990
INV150       20         386769473
INV150       15         361943918
INV150       9          358194592
INV150       11         383437796
INV150       12         371566673
INV151       32         372756064
INV151       29         394011208
INV151       28         385746331
INV151       18         332976093
INV151       4          318142276
INV151       11         388330882
INV151       6          356025686
INV151       25         390407770
INV151       17         150566893
INV151       2          352537966
INV151       2          276070255
INV152       20         384740836
INV152       24         393379081
INV152       43         374993362
INV152       23         391094723
INV152       26         389040069
INV152       17         334905483
INV152       6          351795300
INV152       13         391964421
INV152       31         333085123
INV152       1          240654870
INV152       1          223236985
INV153       25         385708589
INV153       3          226917127
INV153       1          225692979
INV153       1          215602707
INV153       2          359154098
INV153       2          283138276
INV153       3          366799603
INV153       3          307774329
INV153       5          386006823
INV153       6          377763960
INV153       17         380578375
INV154       29         388680045
INV154       23         179650194
INV154       9          279714746
INV154       1          319955300
INV154       4          294686109
INV154       3          364144297
INV154       11         369858529
INV154       26         367540634
INV154       9          377516512
INV154       10         371704098
INV154       12         343109056
INV155       22         323658394
INV155       10         354589932
INV155       34         375616881
INV155       19         394326882
INV155       21         374608767
INV155       23         392617132
INV155       19         390763580
INV155       21         373694902
INV155       20         389092152
INV155       6          342447720
INV155       6          392638958
INV156       25         386606940
INV156       17         377689199
INV156       27         389728640
INV156       22         354327927
INV156       14         387821915
INV156       24         384209358
INV156       18         387080188
INV156       27         368588306
INV156       22         392029793
INV156       14         327862994
INV156       19         377119881
INV157       22         384360764
INV157       17         307555546
INV157       3          353482681
INV157       5          299619810
INV157       1          132666048
INV157       3          317464440
INV157       7          393544312
INV157       19         384876011
INV157       22         371202890
INV157       12         198837579
INV157       23         355220600
INV158       22         375170759
INV158       10         359923815
INV158       2          335082113
INV158       6          386079520
INV158       5          230433460
INV158       5          352992863
INV158       5          380688199
INV158       7          352664180
INV158       9          377429293
INV158       12         394660557
INV158       10         197942219
INV159       31         394116451
INV159       2          336892074
INV159       3          370983084
INV159       3          332872960
INV159       1          123574484
INV159       5          334741585
INV159       6          361874674
INV159       1          600392024
INV159       1          498054485
INV159       6          212627368
INV159       3          241875280
INV16        129080     165753959
INV160       20         281624502
INV160       2          286554524
INV160       9          387182087
INV160       14         386910348
INV160       17         374265432
INV160       12         327252261
INV160       16         290303689
INV160       4          388534210
INV160       7          367452973
INV160       8          347321293
INV160       6          318055136
INV161       11         364532943
INV161       2          231996794
INV161       7          379250551
INV161       13         385052985
INV161       14         392864015
INV161       23         389418814
INV161       24         358524871
INV161       11         358125685
INV161       6          377157459
INV161       5          313090362
INV161       1          203836987
INV162       14         378464462
INV162       2          361472882
INV162       7          389230467
INV162       2          66154651
INV162       19         379925762
INV162       26         382380400
INV162       7          340680974
INV162       11         368263801
INV162       15         378509559
INV162       11         160650367
INV162       3          346301993
INV163       38         390437780
INV163       4          227914153
INV163       1          463878994
INV163       1          411919547
INV163       3          385717261
INV163       7          354882817
INV163       11         387442772
INV163       7          154050618
INV163       3          374261553
INV163       4          259154223
INV163       2          338881051
INV164       20         259303673
INV164       2          297311018
INV164       8          367421825
INV164       4          151351292
INV164       8          326797151
INV164       2          273333741
INV164       4          277445847
INV164       1          262796939
INV164       2          271972204
INV164       1          127864911
INV164       7          367980411
INV165       35         382133951
INV165       8          350419278
INV165       8          346802129
INV165       7          388895464
INV165       6          332687782
INV165       17         389980029
INV165       19         275721668
INV165       2          316756308
INV165       5          378077717
INV165       8          376434480
INV165       22         386292603
INV166       38912      329097860
INV166       14         359535040
INV166       31         393401082
INV166       23         252185357
INV166       21         393889915
INV166       25         385063393
INV166       31         389476731
INV166       28         383285214
INV166       29         383108478
INV166       30         382677493
INV166       4          368098288
INV167       150897     102338830
INV167       10         361306401
INV167       3          310174203
INV167       5          377713589
INV167       5          310344155
INV167       5          388826641
INV167       17         355257629
INV167       5          277866332
INV167       7          377579832
INV167       6          331962748
INV167       8          379965026
INV168       33141      23765134
INV168       6          351494758
INV168       7          325767769
INV168       1          305569956
INV168       1          202803143
INV168       5          370802707
INV168       20         387233220
INV168       17         383557345
INV168       12         367544820
INV168       15         379680131
INV168       8          367593407
INV169       149053     103687625
INV169       12         383019718
INV169       8          342062699
INV169       14         347824666
INV169       1          54263138
INV169       11         355902671
INV169       6          247193371
INV169       2          339071690
INV169       2          311526032
INV169       11         376067292
INV169       15         392012949
INV17        207        346774014
INV170       152025     116276134
INV170       14         382723066
INV170       21         393287380
INV170       30         386815739
INV170       4          70209508
INV170       20         393833935
INV170       23         371772514
INV170       36         378152407
INV170       7          361576036
INV170       3          144800141
INV170       12         386123069
INV171       122358     84053272
INV171       18         379682883
INV171       24         376237200
INV171       18         382676377
INV171       10         136249824
INV171       17         376448086
INV171       24         392500034
INV171       23         358451346
INV171       12         387353786
INV171       9          196688578
INV171       7          352292992
INV172       154876     113576871
INV172       10         379488587
INV172       22         377064691
INV172       16         383674032
INV172       5          109367460
INV172       18         286866675
INV172       3          347598182
INV172       5          338175262
INV172       4          383058601
INV172       1          247560496
INV172       4          303728199
INV173       153316     120330665
INV173       1          271964629
INV173       1          239161613
INV173       2          386396440
INV173       2          162310632
INV173       1          370326948
INV173       3          388116385
INV173       6          377917711
INV173       5          354494059
INV173       7          379606228
INV173       20084      210153974
INV174       54954      36674445
INV175       153092     110242305
INV176       153400     114920460
INV177       39143      33916720
INV178       141656     88560214
INV179       147688     93941872
INV18        85         322154899
INV180       44854      33882904
INV181       148165     97285400
INV182       139432     81643923
INV183       42661      25296150
INV184       138615     82881829
INV185       138426     82991925
INV186       52979      35047492
INV187       139291     83577925
INV188       135371     98983086
INV189       74599      58389158
INV19        3          136766944
INV190       141943     107980743
INV191       149728     121383879
INV192       155512     117821762
INV193       119243     185622090
INV194       34195      81755829
INV195       181112     235169059
INV196       218151     167649786
INV197       38629      187147326
INV198       800        42674647
INV199       566        40635863
INV2         2291       316412759
INV20        14         359428768
INV200       8037       115580217
INV201       23265      332345847
INV202       23319      172531536
INV203       67585      303875862
INV204       121343     264933975
INV205       66775      80327893
INV206       180562     231780487
INV207       41599      303967104
INV208       314        393292454
INV209       1015       105322314
INV21        9          363281720
INV210       2059       383654064
INV211       2          41011863
INV212       591        361654729
INV213       8          378508614
INV214       974        354275690
INV215       6          380479040
INV216       2          95552909
INV217       22         390382246
INV218       10036      362338941
INV219       380        367128711
INV22        52         355336707
INV220       197        343944761
INV221       27         353316387
INV222       25         362372590
INV223       18         224818646
INV224       552        321019135
INV225       2          371500015
INV226       2          289902239
INV227       2965       358959205
INV228       59309      333102202
INV229       34         383065485
INV23        14         371434550
INV230       19         393344928
INV231       14         327270017
INV232       27         393651567
INV233       32         390738662
INV234       24         383706815
INV235       25         382049854
INV236       31         378115211
INV237       13         297748085
INV238       18         387848062
INV239       24         381271345
INV24        78         134821644
INV240       36         390867092
INV241       34         389743485
INV242       26         391141334
INV243       19         292893418
INV244       11         371260264
INV245       19         391738075
INV246       12         391781067
INV247       13         372901688
INV248       32         389502835
INV249       22         330411078
INV25        6          384224499
INV250       29         389284801
INV251       38         387663352
INV252       17         367589223
INV253       12         387517245
INV254       17         362786034
INV255       10         320557524
INV256       13         376469258
INV257       35         380323776
INV258       26         392110960
INV259       24         388964019
INV26        14         390998271
INV260       21         391745060
INV261       22         309540561
INV262       27         392282931
INV263       24         388632304
INV264       12         375724207
INV265       16         393313708
INV266       13         392068868
INV267       10         277290815
INV268       15         358735036
INV269       11         386907833
INV27        25         372322353
INV270       40         377177573
INV271       21         392427759
INV272       5          215849302
INV273       15         382505853
INV274       743        382889760
INV275       26         386022184
INV276       28         394591284
INV277       7          307846648
INV278       4          182170525
INV279       2          342421305
INV28        18         383937723
INV280       2          269826459
INV281       18         385786230
INV282       1901       346423954
INV283       8862       318236250
INV284       11615      311304128
INV285       29313      84782847
INV286       137007     98938577
INV287       129604     76455969
INV288       119653     73620623
INV289       151082     93749861
INV29        26         392368732
INV290       144113     102739869
INV291       68416      59109015
INV292       151295     123294512
INV293       150032     121860639
INV294       87035      70804508
INV295       148878     115757857
INV296       142067     123096034
INV297       101865     121530576
INV298       142798     130428615
INV299       144156     117539859
INV3         104314     181651058
INV30        36         374901277
INV300       98496      183567447
INV301       1934       378969756
INV302       3142       253694876
INV303       96781      321023124
INV304       217342     232110336
INV305       60949      250981301
INV306       103988     292596017
INV307       28973      364551361
INV308       1764       378352969
INV309       2739       197024699
INV31        4          251686535
INV310       184144     268358078
INV311       1785       378880292
INV312       5583       374469857
INV313       20768      153711624
INV314       288223     205808194
INV315       1224       379793465
INV316       4515       373876603
INV317       92490      210334617
INV318       391527     140904810
INV319       109733     258294965
INV32        3          241225934
INV320       80040      286704883
INV321       3569       375757529
INV322       31480      357683960
INV323       16121      41281259
INV324       298725     199657065
INV325       214334     249067665
INV326       2226       377046597
INV327       19303      366955288
INV328       16948      41978773
INV329       298408     186907243
INV33        3          393880593
INV330       1355       379516794
INV331       3687       378313727
INV332       136930     300095839
INV333       38349      357698579
INV334       664        92151452
INV335       8529       370827851
INV336       197744     256830145
INV337       359558     128682792
INV338       93023      322972837
INV339       2568       378355489
INV34        3          261336042
INV340       61847      343439542
INV341       72069      24187260
INV342       150408     127523135
INV343       141892     119323297
INV344       144476     130459280
INV345       77887      229176054
INV346       19         288115740
INV347       15         379655485
INV348       6          355188453
INV349       1          239744465
INV35        3          322765503
INV350       1          231634122
INV351       1          221096292
INV352       1          220877407
INV353       1          216720617
INV354       1          210676062
INV355       2          387811394
INV356       2          329972158
INV357       2          302384449
INV358       20         360081608
INV359       9          301825222
INV36        2          265971290
INV360       23         382490317
INV361       23         380735444
INV362       18         387931948
INV363       33         390736486
INV364       795        381170065
INV365       20         391287680
INV366       2          32244328
INV367       27         388830496
INV368       21         386972019
INV369       9          351834369
INV37        4          328757598
INV370       5          163634948
INV371       1          292306469
INV372       1          164045107
INV373       2          318230244
INV374       868        391036523
INV375       30         390895475
INV376       25         383908286
INV377       25         388289419
INV378       3          49480870
INV379       25         384967191
INV38        5          378753109
INV380       26         391463882
INV381       22         392427991
INV382       26         383547221
INV383       26         265978999
INV384       6          371290168
INV385       13         374069663
INV386       19         385560269
INV387       15         373391572
INV388       13         350978987
INV389       22         386100611
INV39        5          371191486
INV390       24         386055502
INV391       23         389090030
INV392       31         366704932
INV393       12         307588661
INV394       24         393914970
INV395       16         362929629
INV396       8          361035446
INV397       13         369493806
INV398       13         384884009
INV399       18         390461886
INV4         59679      271719145
INV40        4          376987297
INV400       22         394170044
INV401       11         336163521
INV402       6          353407420
INV403       7          372089599
INV404       3          84055545
INV405       9          390327029
INV406       19         393988728
INV407       11         137914990
INV408       1          346874609
INV409       1          248688513
INV41        4          293537168
INV410       1          195213701
INV411       21         389226046
INV412       16         380802157
INV413       17         384888603
INV414       24         390785021
INV415       14         272669524
INV416       19         394017224
INV417       17         391933486
INV418       7          291754234
INV419       2          360067285
INV42        4          373434888
INV420       1          158111693
INV421       5          390880948
INV422       1          269711166
INV423       1          265788494
INV424       5          389225578
INV425       8          84827761
INV426       32         385135770
INV427       29         391336068
INV428       26         380265073
INV429       8          257485661
INV43        42         369246043
INV430       20         383534134
INV431       18         388997674
INV432       13         372064491
INV433       12         246225518
INV434       18         394216238
INV435       18         380558243
INV436       10         378653212
INV437       35         286756574
INV438       57         386542022
INV439       41         394290459
INV44        71         345464815
INV440       30         391877099
INV441       23         388833300
INV442       17         384297034
INV443       310        391634117
INV444       26         381054851
INV445       8          105967983
INV446       29         389236155
INV447       23         387510109
INV448       25         393194949
INV449       29         393406758
INV45        11         126310825
INV450       10         389413895
INV451       12         256001243
INV452       25         382453876
INV453       25         387644779
INV454       17         390017898
INV455       13         185974631
INV456       1          252586203
INV457       2          382245123
INV458       1          170640157
INV459       3          172715237
INV46        33         389894099
INV460       1          265601162
INV461       1          235131548
INV462       8          377013040
INV463       18         389308576
INV464       6          76294397
INV465       2          316929497
INV466       5          371999024
INV467       13         377525467
INV468       22         380131966
INV469       4          94235370
INV47        24         300399380
INV470       20         386111019
INV471       10         330750052
INV472       8          388492156
INV473       29         385235322
INV474       3          68204675
INV475       1          375708846
INV476       177        377903380
INV477       3          72566929
INV478       18         393806697
INV479       12         375328864
INV48        7          368066952
INV480       13         388485421
INV481       17         389690952
INV482       10         355855682
INV483       12         388165924
INV484       5          66893570
INV485       2          334507981
INV486       2          271847796
INV487       9          384970046
INV488       14         380331769
INV489       17         331062789
INV49        17         353983817
INV490       4          353245537
INV491       5          361980503
INV492       1          66459093
INV493       6          375950524
INV494       11         380698960
INV495       13         393299321
INV496       16         371834617
INV497       4          107829629
INV498       16         390859621
INV499       35         393136677
INV5         85         394194283
INV50        7          374779506
INV500       18         389411089
INV501       80         348191458
INV502       10         366985680
INV503       18         382945053
INV504       3          55752453
INV505       23         351194891
INV506       4          361297550
INV507       19         383086968
INV508       16         391635138
INV509       22         382293034
INV51        1          208110490
INV510       15         196098011
INV511       12         326431359
INV512       3          345780114
INV513       4          385052575
INV514       6          392605260
INV515       17         135120912
INV516       1          319032388
INV517       1          282837000
INV518       1          278321370
INV519       1          265031889
INV52        2          302887577
INV520       1          264456228
INV521       1          255727343
INV522       1          255305493
INV523       1          230784347
INV524       9          392641003
INV525       28         356306819
INV526       2          278332741
INV527       8          361353987
INV528       10         379658367
INV529       13         380787037
INV53        3          341397147
INV530       8          386860579
INV531       6          361028373
INV532       3          168396230
INV533       7          375518624
INV534       10         375539956
INV535       5          355133492
INV536       12         346368422
INV537       4          128335036
INV538       18         344289019
INV539       6          343424801
INV54        3          306059974
INV540       6          355424926
INV541       9          361129815
INV542       1          209131117
INV543       2          365485920
INV544       2          326453370
INV545       2          310804349
INV546       3          355594170
INV547       7          341653095
INV548       44         372332433
INV549       6          201861407
INV55        4          375190511
INV550       19         385553829
INV551       11         389495243
INV552       9          318918022
INV553       7          359994759
INV554       11         363361177
INV555       18         352506103
INV556       2          121342079
INV557       11         370878851
INV558       38         392392993
INV559       39         383674587
INV56        4          333576383
INV560       29         392907305
INV561       24         381869223
INV562       13         164951452
INV563       41         380881169
INV564       15         386326246
INV565       9          137942415
INV566       1          410988561
INV567       2          347081175
INV568       2          60458881
INV569       1          429819325
INV57        5          348361494
INV570       1          230177572
INV571       2          394052085
INV572       35         354776612
INV573       7          318208416
INV574       5          336561253
INV575       7          357043306
INV576       7          262116983
INV577       1          170575982
INV578       2          287036945
INV579       2          275604705
INV58        8          237198412
INV580       3          367947227
INV581       3          342256987
INV582       5          256835876
INV583       13         321847088
INV584       5          332460113
INV585       95         319933371
INV586       12         328718900
INV587       9          217598510
INV588       20         352503315
INV589       9          379049671
INV59        13         392726641
INV590       14         374215308
INV591       15         347131978
INV592       3          328312092
INV593       4          369177951
INV594       3          246468438
INV595       5          376372316
INV596       11         376604103
INV597       17         381822991
INV598       22         391138986
INV599       6          54648714
INV6         84         293302731
INV60        66         317360954
INV600       12         377183847
INV601       30         388952266
INV602       3          326197890
INV603       3          271412684
INV604       6          360181556
INV605       18         382522482
INV606       24         379871629
INV607       21         312971658
INV608       22         381784561
INV609       21         380590911
INV61        4          328154363
INV610       13         371720425
INV611       17         390781836
INV612       3          78204341
INV613       17         377301939
INV614       12         357316205
INV615       6          368644317
INV616       9          270151474
INV617       12         189039214
INV618       1          244108438
INV619       1          210424776
INV62        3          230854823
INV620       2          347597490
INV621       2          286016373
INV622       2          120783828
INV623       22         392193755
INV624       13         360806743
INV625       11         375564408
INV626       9          362288897
INV627       3          377576368
INV628       4          158823784
INV629       12         376095937
INV63        5          362121003
INV630       6          372905819
INV631       7          388366567
INV632       7          351386075
INV633       12         377915288
INV634       10         168222845
INV635       21         336280653
INV636       11         387853015
INV637       17         383594904
INV638       12         371624632
INV639       4          205127384
INV64        211        385264302
INV640       1          255265360
INV641       1          230794410
INV642       2          372619140
INV643       2          311523487
INV644       13         393665610
INV645       24         199571394
INV646       2          323510804
INV647       12         381394394
INV648       12         281321844
INV649       6          301645505
INV65        55         389266884
INV650       3          327580854
INV651       2          283053804
INV652       4          358883688
INV653       3          313487646
INV654       12         372628339
INV655       11         296511468
INV656       12         205288598
INV657       1          329103898
INV658       1          266482116
INV659       1          255371252
INV66        16         251967525
INV660       1          249620899
INV661       11         381319634
INV662       28         382489592
INV663       15         383181010
INV664       13         350686833
INV665       1          90894639
INV666       5          367141834
INV667       4          355766912
INV668       6          390997169
INV669       1          283143227
INV67        24         388112032
INV670       7          385962722
INV671       18         390420686
INV672       14         352409616
INV673       3          310319640
INV674       1          94671628
INV675       4          375545906
INV676       2          330374624
INV677       9          385008187
INV678       36         348936130
INV679       7          362657616
INV68        39         380190174
INV680       12         375776805
INV681       21         386373372
INV682       28         385558874
INV683       2          30875957
INV684       30         377576257
INV685       16         383023174
INV686       25         385163881
INV687       20         289852567
INV688       11         387811488
INV689       13         388478264
INV69        33         379073437
INV690       20         388641472
INV691       37         387165660
INV692       14         208952549
INV693       33         393285708
INV694       13         364621498
INV695       12         378544770
INV696       14         393303348
INV697       17         283001740
INV698       25         393022599
INV699       6          259595995
INV7         170        364968923
INV70        50         299834692
INV700       2          306898484
INV701       22         392724989
INV702       11         81108636
INV703       1          334972678
INV704       1          327956322
INV705       4          369938243
INV706       10         387945021
INV707       6          333511012
INV708       3          390034570
INV709       6          388490213
INV71        20         393500649
INV710       37         293380102
INV711       3          330508129
INV712       3          304092200
INV713       4          386935527
INV714       16         364918260
INV715       10         392609098
INV716       30         381546124
INV717       2          331139274
INV718       5          390800394
INV719       2          93184197
INV72        19         386117294
INV720       9          363742103
INV721       11         374818742
INV722       13         353874383
INV723       29         353592845
INV724       6          313902203
INV725       2          325968719
INV726       2          326866526
INV727       2          294862287
INV728       2          277963616
INV729       1          135489923
INV73        20         393838616
INV730       5          389105293
INV731       21         334259074
INV732       19         374293438
INV733       21         257681977
INV734       15         378008119
INV735       18         345890599
INV736       9          374177525
INV737       13         282334662
INV738       13         367448714
INV739       14         383036237
INV74        9          185353717
INV740       9          337662876
INV741       4          285079875
INV742       13         380626621
INV743       20         391060643
INV744       17         236492487
INV745       1          253604678
INV746       1          244180387
INV747       2          385719063
INV748       2          323852856
INV749       3          391496974
INV75        16         368214362
INV750       69         343048078
INV751       3          58690555
INV752       1          427500052
INV753       1          280788551
INV754       1          231232069
INV755       2          365961697
INV756       2          306037738
INV757       2          294194033
INV758       8          383537417
INV759       10         382401646
INV76        17         373531597
INV760       15         373941744
INV761       2          278659155
INV762       5          350216916
INV763       5          342671345
INV764       7          377861791
INV765       14         385594223
INV766       25         241789371
INV767       2          304382108
INV768       5          380650692
INV769       6          108274197
INV77        17         378099553
INV770       30         387029729
INV771       27         330887562
INV772       3          314705854
INV773       4          344406745
INV774       5          389867528
INV775       5          353121931
INV776       14         392298773
INV777       2          53978732
INV778       17         382363442
INV779       13         374918202
INV78        11         222599361
INV780       15         379396417
INV781       103        385952128
INV782       20         386688731
INV783       18         382007266
INV784       57         153866701
INV785       5          219711870
INV786       2          319873814
INV787       6          380185718
INV788       3          381341903
INV789       1          111009446
INV79        17         378099553
INV790       5          379226736
INV791       12         393993623
INV792       22         391120037
INV793       20         316738233
INV794       1          263587734
INV795       2          374750442
INV796       2          338140745
INV797       2          298578205
INV798       5          384869169
INV799       30         387739996
INV8         5          352575630
INV80        18         381766905
INV800       13         296449972
INV801       18         279137441
INV802       2          322765580
INV803       3          390029089
INV804       4          345523436
INV805       2          287481868
INV806       3          368157705
INV807       4          330380185
INV808       2          273986171
INV809       11         380263283
INV81        18         381766905
INV810       21         357807916
INV811       12         391993231
INV812       8          369418028
INV813       9          378821074
INV814       10         378877305
INV815       2          122089777
INV816       7          366744808
INV817       18         393384596
INV818       28         374632208
INV819       17         380406226
INV82        11         244247504
INV820       10         104480107
INV821       1          298134333
INV822       6          372478433
INV823       7          273110839
INV824       1          174811163
INV825       1          246577358
INV826       3          380592957
INV827       8          336515494
INV828       5          388249994
INV829       7          360174377
INV83        18         381766905
INV830       8          393835422
INV831       7          326451249
INV832       18         390226185
INV833       4          212448392
INV834       2          361639366
INV835       11         389090510
INV836       24         261483440
INV837       20         187767331
INV838       1          300440965
INV839       1          255158195
INV84        18         381766905
INV840       1          235639307
INV841       1          234027751
INV842       5          364518894
INV843       1          52122333
INV844       17         394627877
INV845       24         372312688
INV846       5          353472817
INV847       6          348815087
INV848       3          142239958
INV849       10         371554285
INV85        17         378099553
INV850       10         389038857
INV851       15         393343847
INV852       354        351174080
INV853       61         370950558
INV854       13         377490054
INV855       17         362779264
INV856       1          215246178
INV857       1          179976030
INV858       2          326215908
INV859       12         393295794
INV86        10         214458835
INV860       17         355147463
INV861       7          364022270
INV862       8          232711543
INV863       10         320236834
INV864       5          374560279
INV865       5          347050153
INV866       6          365683735
INV867       8          350757240
INV868       8          330705725
INV869       7          319315304
INV87        17         373531597
INV870       8          294380847
INV871       8          300070536
INV872       5          296140165
INV873       7          321898042
INV874       8          344779364
INV875       5          204172647
INV876       8          363714706
INV877       8          335684798
INV878       7          325614821
INV879       8          343203705
INV88        17         376354888
INV880       8          295765726
INV881       4          296872836
INV882       1          277791574
INV883       2          374437900
INV884       3          384355230
INV885       4          287970803
INV886       8          310860357
INV887       1          87642240
INV888       3          322074102
INV889       5          350860081
INV89        17         378128112
INV890       3          341421742
INV891       3          303252646
INV892       3          274953531
INV893       5          354560190
INV894       4          293401691
INV895       5          291612199
INV896       6          363161146
INV897       7          367190402
INV898       1          63881323
INV899       7          369938164
INV9         7          383441747
INV90        11         244218945
INV900       24         385109501
INV901       29         371254400
INV902       3          369936174
INV903       3          324539581
INV904       4          365244967
INV905       5          389493350
INV906       6          394661900
INV907       13         382083182
INV908       31         381763837
INV909       28         392125926
INV91        18         377201651
INV910       4          128300843
INV911       4          359450428
INV912       5          357390477
INV913       10         360971319
INV914       10         388368184
INV915       12         376602273
INV916       78         347723211
INV917       3          159381941
INV918       8          277689252
INV919       2          308292894
INV92        19         384750213
INV920       4          378776770
INV921       3          224250587
INV922       2          353669327
INV923       3          365790299
INV924       5          373092601
INV925       25         383158187
INV926       13         390048803
INV927       10         389033966
INV928       13         387771417
INV929       15         383558849
INV93        19         386574986
INV930       8          145928775
INV931       16         387212131
INV932       17         373736547
INV933       10         387894809
INV934       13         380870662
INV935       36         385258928
INV936       13         163501620
INV937       28         381827489
INV938       22         374847337
INV939       2          310213387
INV94        11         217953999
INV940       4          223537066
INV941       1          311186714
INV942       4          305252952
INV943       1          117261666
INV944       4          325431757
INV945       5          343105299
INV946       8          390057518
INV947       11         390412576
INV948       18         344362951
INV949       4          389304644
INV95        18         390383119
INV950       8          374713972
INV951       4          67335450
INV952       1          354881887
INV953       1          306296502
INV954       2          379020699
INV955       10         369838626
INV956       2          26750373
INV957       1          249865697
INV958       3          387636064
INV959       14         388824602
INV96        19         393479571
INV960       16         387485480
INV961       8          379220830
INV962       6          382970618
INV963       3          146110617
INV964       10         369487108
INV965       12         390659631
INV966       23         390394397
INV967       25         366663447
INV968       15         378170753
INV969       12         180879245
INV97        18         363756879
INV970       22         392034752
INV971       12         386348701
INV972       10         373953727
INV973       6          388811552
INV974       25         386609090
INV975       13         334938607
INV976       3          236174852
INV977       5          333202408
INV978       7          380888452
INV979       6          288483784
INV98        7          331556300
INV980       3          359596411
INV981       3          275853845
INV982       5          376167017
INV983       7          369632890
INV984       15         378314108
INV985       17         368087933
INV986       5          133748391
INV987       20         388296339
INV988       17         379457536
INV989       20         368530964
INV99        79441      240613960
INV990       5          394539175
INV991       1          71901920
INV992       6          370194894
INV993       8          316109534
INV994       1          991969171
INV995       1          1533311695
INV996       1          991394496
INV997       1          709211797
INV998       1          559013835
INV999       1          538612828
MAM1         32392      323881936
MAM10        26814      24994146
MAM100       4          383777488
MAM101       5          381968701
MAM102       4          345040697
MAM103       3          176472919
MAM104       6          356825309
MAM105       3          354814440
MAM106       3336       333279354
MAM107       67918      268571517
MAM108       98815      192640750
MAM109       25643      271339235
MAM11        13731      20581276
MAM110       4          274800947
MAM111       4          294612101
MAM112       4          368804057
MAM113       5          360824188
MAM114       3          381844289
MAM115       4          323611747
MAM116       5          314441637
MAM117       278        273083750
MAM118       1          216965501
MAM119       1          210729441
MAM12        3445       7368868
MAM120       2          349064804
MAM121       2          311803703
MAM122       2          284093331
MAM123       3          348809871
MAM124       4          369368223
MAM125       5          363867118
MAM126       1          61486999
MAM127       391        303038843
MAM128       2          387082860
MAM129       2          304198725
MAM13        107        699953
MAM130       3          374133223
MAM131       3          326166110
MAM132       4          378433792
MAM133       4          343736516
MAM134       26         156134288
MAM135       2          295910882
MAM136       3          365955123
MAM137       3          347352947
MAM138       3          322237442
MAM139       4          341689478
MAM14        20         277696380
MAM140       5          362834364
MAM141       7          390905713
MAM142       3          258595851
MAM143       2          333773690
MAM144       3          387942990
MAM145       3          354718536
MAM146       2          226942227
MAM147       3          311333393
MAM148       4          346893067
MAM149       5          358087510
MAM15        1          249270926
MAM150       7          370527586
MAM151       141        52864919
MAM152       2          381699852
MAM153       2          379453767
MAM154       2          323756069
MAM155       3          363198547
MAM156       2          215864552
MAM157       4          373314142
MAM158       5          370562270
MAM159       3          229138897
MAM16        2          343930246
MAM160       2          357862388
MAM161       1          148378616
MAM162       2          277983130
MAM163       3          347551233
MAM164       3          317094091
MAM165       4          359797234
MAM166       5          367203739
MAM167       2          35182349
MAM168       3          344892062
MAM169       3          310823791
MAM17        3          325384739
MAM170       4          343820600
MAM171       5          380959867
MAM172       5          326724081
MAM173       2          125670854
MAM174       6          349136452
MAM175       5          249014812
MAM176       4          263893466
MAM177       2          255070854
MAM178       2          283025985
MAM179       3          333227068
MAM18        1          90795278
MAM180       3          347405297
MAM181       3          311786266
MAM182       3          370283980
MAM183       3          367382503
MAM184       3          376930704
MAM185       2          186941709
MAM186       1          212679785
MAM187       1          200210433
MAM188       2          301321370
MAM189       2          204542634
MAM19        4          322903327
MAM190       4          342554685
MAM191       6          373951174
MAM192       9          394516191
MAM193       1          178365832
MAM194       2          317576479
MAM195       3          382289813
MAM196       3          333151314
MAM197       4          387058184
MAM198       1          88847605
MAM199       5          393069609
MAM2         22255      277077797
MAM20        4          298795355
MAM200       5          297820775
MAM201       2          370199356
MAM202       2          296330659
MAM203       3          378321649
MAM204       3          341779801
MAM205       4          389646286
MAM206       3          260392119
MAM207       5          252937523
MAM208       1          210889723
MAM209       2          390094915
MAM21        6          353843759
MAM210       3          369279389
MAM211       1          134025529
MAM212       3          382647393
MAM213       3          348525342
MAM214       4          385414949
MAM215       8          367669076
MAM216       3          338644129
MAM217       4          384410696
MAM218       4          321255648
MAM219       5          366955574
MAM22        5          329700903
MAM220       2          129330055
MAM221       6          369468462
MAM222       7          368094007
MAM223       3          278321486
MAM224       2          356989359
MAM225       2          294642091
MAM226       3          374469516
MAM227       3          321593661
MAM228       4          372512269
MAM229       5          394669051
MAM23        2          289079565
MAM230       6          352162926
MAM231       3          338100906
MAM232       3          320896055
MAM233       4          391714968
MAM234       5          389929348
MAM235       8040       354274270
MAM24        3          348530310
MAM25        4          336581445
MAM26        5          375256260
MAM27        6          373952570
MAM28        8          377813420
MAM29        5          379300313
MAM3         2          316219032
MAM30        1          38035513
MAM31        5          285741626
MAM32        5          342804543
MAM33        8          370485433
MAM34        6          316655225
MAM35        4          238884849
MAM36        4          355768297
MAM37        6          355037276
MAM38        7          389945117
MAM39        6          319172640
MAM4         2          376685399
MAM40        5          323047396
MAM41        4          347221982
MAM42        5          288444151
MAM43        5          375232988
MAM44        5          248962388
MAM45        1          277956744
MAM46        1          154038104
MAM47        3          374028897
MAM48        2          298256496
MAM49        3          355148320
MAM5         2          295769989
MAM50        3          355658200
MAM51        3          369352591
MAM52        7          388919640
MAM53        10         86285931
MAM54        54         7614329
MAM55        215        34073042
MAM56        431        71272130
MAM57        861        68509101
MAM58        1706       2411269
MAM59        6879       6176592
MAM6         2          385026516
MAM60        110526     193403794
MAM61        33191      281608286
MAM62        4          358286156
MAM63        5          387739617
MAM64        5          335893012
MAM65        6          364021592
MAM66        6          304412506
MAM67        10         386743576
MAM68        132589     153984716
MAM69        117941     169515490
MAM7         3          316699161
MAM70        8161       7127267
MAM71        1          716413629
MAM72        1          662751787
MAM73        1          611347268
MAM74        1          464895054
MAM75        1          288121652
MAM76        3          338107697
MAM77        1          223449203
MAM78        1          210645437
MAM79        1          201318998
MAM8         5          343489620
MAM80        1          197708286
MAM81        2          320231256
MAM82        2          293750401
MAM83        3          367535284
MAM84        4          351244600
MAM85        367        269065793
MAM86        1          203623556
MAM87        2          383513587
MAM88        4          383666147
MAM89        5          381503248
MAM9         933        216317382
MAM90        263        390074346
MAM91        2          265153725
MAM92        4          366992153
MAM93        5          369689861
MAM94        5          392803577
MAM95        6          298207437
MAM96        3          363734450
MAM97        1          118519168
MAM98        3          328935722
MAM99        4          359964523
PAT1         420061     157355783
PAT10        304138     130867531
PAT100       352852     189327041
PAT101       310862     206556098
PAT102       261889     226571161
PAT103       130469     96637053
PAT104       304402     217824161
PAT105       276793     236021165
PAT106       255575     243191966
PAT107       219302     91982645
PAT108       185287     167791854
PAT109       193743     145685359
PAT11        236000     217102698
PAT110       99368      56253342
PAT111       244010     110313663
PAT112       143101     226372350
PAT113       78462      27199293
PAT114       88271      271848246
PAT115       224845     124890800
PAT116       225594     104795397
PAT117       1438       4521973
PAT118       247765     75673289
PAT119       230776     33741646
PAT12        83481      75660869
PAT120       94886      123403652
PAT121       98574      119749391
PAT122       81936      115812708
PAT123       202979     107720634
PAT124       26273      9055851
PAT125       203753     100524714
PAT126       183494     80758738
PAT127       117402     19496593
PAT128       249514     208801641
PAT129       384339     114595216
PAT13        242994     211781414
PAT130       54376      7592936
PAT131       283235     179645326
PAT132       123902     298030477
PAT133       110602     304047818
PAT134       393154     122356229
PAT135       289816     158257933
PAT136       13531      9112466
PAT137       287141     182646284
PAT138       409360     14039521
PAT139       496791     33315069
PAT14        328208     148438838
PAT140       525210     7878150
PAT141       153479     3896888
PAT142       377386     123753542
PAT143       245736     106349729
PAT144       259895     238802744
PAT145       4634       392128968
PAT146       190899     207809354
PAT147       308470     120437803
PAT148       140524     153724833
PAT149       6434       91722304
PAT15        63798      1594950
PAT150       177885     181303248
PAT151       71548      185117089
PAT152       75797      115786083
PAT153       75754      115775734
PAT154       46229      38674255
PAT155       245082     68541385
PAT156       202131     63183116
PAT157       264557     57807328
PAT158       309556     83973872
PAT159       458768     54678301
PAT16        197467     165309742
PAT160       227775     118065838
PAT161       359509     132219309
PAT162       288075     50680332
PAT163       154907     4647915
PAT164       228342     77240328
PAT165       228222     72940292
PAT166       281346     18592211
PAT167       65059      7149742
PAT168       153380     170208828
PAT169       73414      134988828
PAT17        217861     141775743
PAT170       74138      123431971
PAT171       137210     84284016
PAT172       175218     2628270
PAT173       233542     99258089
PAT174       198424     145045449
PAT175       229728     110451824
PAT176       105704     68109998
PAT177       80124      122466507
PAT178       260804     46028890
PAT179       294811     4422165
PAT18        217806     104610120
PAT180       7895       118425
PAT181       278538     10765362
PAT182       99587      135915370
PAT183       220909     105875938
PAT184       23921      35278691
PAT185       143999     206566501
PAT186       173285     186742155
PAT187       70129      243259642
PAT188       6542       8869371
PAT189       137168     133366031
PAT19        238917     105580979
PAT190       136589     204923242
PAT191       208571     98960049
PAT192       284102     31395277
PAT193       26291      42269637
PAT194       264589     66935450
PAT195       227269     82111943
PAT196       179588     5746816
PAT197       194345     81150973
PAT198       52348      9088648
PAT199       82690      146051882
PAT2         329678     203028339
PAT20        217486     131790698
PAT200       75930      116106222
PAT201       76058      115438165
PAT202       205771     85563217
PAT203       2801       56020
PAT204       342231     6844620
PAT205       341891     7168782
PAT206       341071     7503562
PAT207       331154     110021550
PAT208       268658     230373189
PAT209       282624     222310160
PAT21        295530     53380151
PAT210       192664     139614235
PAT211       276098     235021090
PAT212       188385     291326630
PAT213       137484     196232251
PAT214       247191     246690030
PAT215       11728      387687504
PAT216       313354     152356909
PAT217       244602     252477336
PAT218       160029     300870611
PAT219       215545     135077252
PAT22        146945     94866926
PAT220       172971     290885692
PAT221       266022     215702867
PAT222       351335     145810696
PAT223       304081     76036592
PAT224       317818     206630332
PAT225       43590      365712261
PAT226       151381     180550783
PAT227       338212     193787787
PAT228       332520     206353769
PAT229       155792     199233054
PAT23        196054     155782932
PAT230       249094     251157045
PAT231       209852     277995521
PAT232       184404     195925874
PAT233       326554     210405939
PAT234       203551     272092254
PAT235       99377      335866542
PAT236       108195     332037529
PAT237       262380     184432769
PAT238       10552      3893024
PAT239       223856     118359658
PAT24        279883     73143527
PAT240       272864     62593307
PAT241       204521     140753766
PAT242       283956     19296326
PAT243       274495     22246419
PAT244       281624     22162860
PAT245       286514     14630240
PAT246       287155     13479675
PAT247       96564      20012546
PAT248       263509     44902329
PAT249       293106     5569014
PAT25        228121     146709629
PAT250       337152     75444577
PAT251       207126     270199202
PAT252       330273     192780592
PAT253       253593     160160166
PAT254       145599     308869479
PAT255       133194     316274917
PAT256       270854     159658753
PAT257       52995      1006905
PAT258       256574     81412648
PAT259       237934     109712268
PAT26        208817     140778194
PAT260       178431     59528901
PAT27        63078      54091824
PAT28        304662     206975876
PAT29        321045     202870000
PAT3         50198      20265965
PAT30        69609      127456994
PAT31        217213     274043600
PAT32        399532     38379558
PAT33        255490     168750319
PAT34        232041     138095126
PAT35        62904      29388979
PAT36        159604     193117909
PAT37        187245     152012324
PAT38        211992     134514047
PAT39        97888      9820583
PAT4         329467     180384618
PAT40        349664     21561844
PAT41        269135     102155446
PAT42        166        390395449
PAT43        7284       386170254
PAT44        91554      5256927
PAT45        304606     19422510
PAT46        304621     19407682
PAT47        188128     183518573
PAT48        31167      33402871
PAT49        100015     274294276
PAT5         261731     200080973
PAT50        347902     22047460
PAT51        356635     6776065
PAT52        92449      1756531
PAT53        351467     15875870
PAT54        360979     6858601
PAT55        133572     2537868
PAT56        360626     6851894
PAT57        359974     6839506
PAT58        125418     2711844
PAT59        535700     100616524
PAT6         217887     164406285
PAT60        111356     330233433
PAT61        289774     158820679
PAT62        481491     50382930
PAT63        225647     89298195
PAT64        254299     194540151
PAT65        328266     204074318
PAT66        172089     140783562
PAT67        349862     190728733
PAT68        612603     75778089
PAT69        132887     40797313
PAT7         247416     122521672
PAT70        484033     127126269
PAT71        126354     109119371
PAT72        150168     307250321
PAT73        318626     211710240
PAT74        51881      214846609
PAT75        189165     289007376
PAT76        317843     207880789
PAT77        123868     129694058
PAT78        342751     192409991
PAT79        362616     180214431
PAT8         224251     103110544
PAT80        20467      17346132
PAT81        311143     212599739
PAT82        414691     138165335
PAT83        481149     57356673
PAT84        327469     49354802
PAT85        456776     82420764
PAT86        157678     116098863
PAT87        166943     185722450
PAT88        315011     151647986
PAT89        225043     179144124
PAT9         153351     78054396
PAT90        161475     40743438
PAT91        548289     10417491
PAT92        499577     9491963
PAT93        509421     32468072
PAT94        211222     45802544
PAT95        257666     203185753
PAT96        387962     140930961
PAT97        39820      44653056
PAT98        361773     186862184
PAT99        415062     154422395
PHG1         8932       217079125
PHG2         4747       226100295
PHG3         5295       215809493
PHG4         5125       232426131
PHG5         6847       227866052
PHG6         4427       200615627
PLN1         135613     171556809
PLN10        18946      157439113
PLN100       1          252943167
PLN100       1          717542863
PLN100       1          493761083
PLN100       1          746502734
PLN100       1          752612656
PLN100       1          648661963
PLN100       572        38290762
PLN100       1          540897063
PLN100       1          449127287
PLN100       1          425675180
PLN100       1          463192880
PLN101       1          225803546
PLN101       1          485323027
PLN101       1          448461343
PLN101       1          493511962
PLN101       1          462796039
PLN101       1          589118817
PLN101       1          638425132
PLN101       1          716105986
PLN101       1          613160974
PLN101       1          626220839
PLN101       1          551718542
PLN102       1          219123305
PLN102       1          484215583
PLN102       1          532103454
PLN102       1          480949782
PLN102       1          455353809
PLN102       1          499214392
PLN102       1          298028472
PLN102       1          528225653
PLN102       218        367788603
PLN102       6          375232671
PLN102       299        384945076
PLN103       2          394302667
PLN103       9          251431714
PLN103       130        156049603
PLN103       1          593930347
PLN103       1          702775664
PLN103       1          494594617
PLN103       1          792837209
PLN103       1          812232696
PLN103       1          661835603
PLN103       1          750337041
PLN103       1          854463248
PLN104       55         43040327
PLN104       1          623248023
PLN104       1          749950614
PLN104       1          673746810
PLN104       1          520815567
PLN104       1          712547961
PLN104       1          703299309
PLN104       1          569771178
PLN104       1          620176429
PLN104       1          717542863
PLN104       1          493761083
PLN105       15         305289289
PLN105       1          746502734
PLN105       1          752612656
PLN105       1          648661963
PLN105       53         362278903
PLN105       6678       233646823
PLN105       1          445829560
PLN105       1          657893865
PLN105       1          636117214
PLN105       1          520569408
PLN105       1          614738994
PLN106       2          286029496
PLN106       1          536175046
PLN106       1          610578938
PLN106       4          16378138
PLN106       58         389996895
PLN106       14         385024567
PLN106       30         368986150
PLN106       14         379761940
PLN106       14         388380456
PLN106       5          138123356
PLN106       14         386817082
PLN107       2          307738366
PLN107       14         393670454
PLN107       28         388378543
PLN107       21         371825237
PLN107       14         382705053
PLN107       5          137783507
PLN107       13         362021382
PLN107       14         384652328
PLN107       14         385328574
PLN107       14         387607699
PLN107       13         362161900
PLN108       2          269669619
PLN108       7          192427420
PLN108       14         391787584
PLN108       14         371741286
PLN108       10         360532952
PLN108       5          370119782
PLN108       8          393655910
PLN108       6          194621872
PLN108       23         318601285
PLN108       4          331833036
PLN108       6          383779503
PLN109       1          157681923
PLN109       7          364418253
PLN109       6          168945745
PLN109       11         364495457
PLN109       13         371343624
PLN109       14         390506009
PLN109       50         388504808
PLN109       129        388429313
PLN109       2          272777406
PLN109       3          366184951
PLN109       4          390049233
PLN11        29376      278343654
PLN110       40         376080648
PLN110       26         393235158
PLN110       9          339543817
PLN110       86         386159307
PLN110       4          322858024
PLN110       1          79481305
PLN110       5          345056615
PLN110       6          348214746
PLN110       7          349249048
PLN110       8          356243003
PLN110       3          198571596
PLN111       33         389701062
PLN111       3          333480027
PLN111       53         388888259
PLN111       222        363108809
PLN111       10         364192173
PLN111       1          291295799
PLN111       1          258385429
PLN111       1          310695138
PLN111       2          390386182
PLN111       1          268171085
PLN111       29         349658376
PLN112       106        384154506
PLN112       6          349885803
PLN112       7          374035469
PLN112       5          384499932
PLN112       3          317526865
PLN112       4          348522543
PLN112       121        392720692
PLN112       11         336203737
PLN112       2          287149637
PLN112       3          359070095
PLN112       10         373903616
PLN113       55         188199075
PLN113       2          159588847
PLN113       5          371769032
PLN113       7          383050287
PLN113       9          373845120
PLN113       7          344699691
PLN113       187        262122807
PLN113       1          865431811
PLN113       1          841368522
PLN113       1          772393794
PLN113       1          766078222
PLN114       2          324178388
PLN114       1          735900830
PLN114       1          693266847
PLN114       1          690056233
PLN114       1          654671025
PLN114       1          681539918
PLN114       1          650134427
PLN114       1          643737533
PLN114       1          547487370
PLN114       1          545352555
PLN114       1          528421643
PLN115       3          383186249
PLN115       1          538505002
PLN115       1          487455108
PLN115       1          484156440
PLN115       1          426775217
PLN115       2          882175
PLN115       1          1574527093
PLN115       1          1805244829
PLN115       1          1716769615
PLN115       1          1637815978
PLN115       1          1645877737
PLN116       2          268356222
PLN116       1          1365994436
PLN116       1          1520236431
PLN116       21         341095642
PLN116       5          135803197
PLN116       14         377335903
PLN116       14         378243710
PLN116       14         386520074
PLN116       14         381342717
PLN116       13         352824152
PLN116       1          158169978
PLN117       2          324123174
PLN117       2          351634268
PLN117       1          279860179
PLN117       1          259520967
PLN117       2          294703259
PLN117       1          238633233
PLN117       1          162496318
PLN117       1          420743833
PLN117       1          155907
PLN117       1          454733196
PLN117       1          446096000
PLN118       3          363018427
PLN118       1          431552901
PLN118       1          379526086
PLN118       1          338376119
PLN118       1          315777457
PLN118       4          356829234
PLN118       13         321943140
PLN118       1          77851525
PLN118       8          384718303
PLN118       44         392277346
PLN118       15         353953398
PLN119       27         379124606
PLN119       10         239865754
PLN119       25         62927445
PLN119       1          475425392
PLN119       1          592785984
PLN119       1          369077699
PLN119       1          639092456
PLN119       1          650132723
PLN119       1          502756319
PLN119       1          616552515
PLN119       1          734473537
PLN12        2660       334399488
PLN120       19         134550855
PLN120       1          475660819
PLN120       1          624362023
PLN120       1          589372991
PLN120       1          401580522
PLN120       1          568783180
PLN120       1          587942095
PLN120       1          429272691
PLN120       1          492611322
PLN120       1          588888971
PLN120       1          366110095
PLN121       57         390189770
PLN121       1          602817757
PLN121       1          637984644
PLN121       1          484660871
PLN121       13         380754168
PLN121       7          360887511
PLN121       11         370515825
PLN121       7          255465082
PLN121       10         393847493
PLN121       16         394123581
PLN121       39         387990033
PLN122       11         373036233
PLN122       40         384498328
PLN122       3          143841883
PLN122       45         371187078
PLN122       15         352055437
PLN122       6          377527293
PLN122       10         393434419
PLN122       10         276610078
PLN122       9          376864900
PLN122       12         372511925
PLN122       9          378086189
PLN123       8          357693623
PLN123       11         263651859
PLN123       1          199739593
PLN123       2          344461905
PLN123       3          374253733
PLN123       4          381821281
PLN123       4          318572652
PLN123       78         393634732
PLN123       2          159167131
PLN123       6          388559936
PLN123       8          340431512
PLN124       6          351635285
PLN124       15         383095456
PLN124       9          394035375
PLN124       12         352824577
PLN124       10         351790580
PLN124       9          389123571
PLN124       11         385826758
PLN124       10         349341323
PLN124       12         386750055
PLN124       8          382846237
PLN124       4          317913936
PLN125       12         293471641
PLN125       5          382620307
PLN125       5          361453536
PLN125       6          383120782
PLN125       6          325499506
PLN125       3          326992284
PLN125       3          309672594
PLN125       2          199284186
PLN125       4          381810661
PLN125       4          368895169
PLN125       4          320171181
PLN126       78         341267500
PLN126       5          360856103
PLN126       17         55384138
PLN126       11         382432891
PLN126       15         364788400
PLN126       9          365792098
PLN126       36670      319092833
PLN127       131        317758159
PLN128       130        348798505
PLN129       119        246756089
PLN13        37         329935405
PLN130       196        355571810
PLN131       129        347273899
PLN132       99         327554070
PLN133       48         365833376
PLN134       60         352557038
PLN135       204        383855350
PLN136       112        391758974
PLN137       84         391468457
PLN138       110        340740848
PLN139       69         334048427
PLN14        46         124218893
PLN140       15         374915998
PLN141       15         376631523
PLN142       117        268512615
PLN143       100        319711472
PLN144       22         387363813
PLN145       60         393232941
PLN146       290        225319064
PLN147       49         376691198
PLN148       107        332762629
PLN149       6          326759735
PLN15        9          366014477
PLN150       17         340023864
PLN151       115        393450449
PLN152       81         370027281
PLN153       29         394591747
PLN154       78         345758298
PLN155       2          265995834
PLN156       3          380342000
PLN157       3          341478110
PLN158       4          364941990
PLN159       2          267241309
PLN16        2396       340681670
PLN160       3          377845747
PLN161       2          218300262
PLN162       3          351455647
PLN163       3          282049637
PLN164       2          296748967
PLN165       2          276176029
PLN166       2          265406188
PLN167       3          366102397
PLN168       3          310633103
PLN169       1          90243615
PLN17        1949       233857567
PLN170       2          339450567
PLN171       2          383562320
PLN172       2          318742289
PLN173       2          356433379
PLN174       2          302010261
PLN175       2          361337975
PLN176       41         389463936
PLN177       56         346155909
PLN178       28         344950285
PLN179       74         110183622
PLN18        3          330514248
PLN180       46         387316355
PLN181       26         388412848
PLN182       45         374130688
PLN183       3          296654434
PLN184       5          362932580
PLN185       3          174796239
PLN186       1          307467675
PLN187       1          240644346
PLN188       1          237923589
PLN189       1          251400564
PLN19        37         343581774
PLN190       1          222005600
PLN191       2          353275669
PLN192       1          180355996
PLN193       18         373335959
PLN194       193        309368743
PLN195       61         366968421
PLN196       235        341917939
PLN197       1          67442382
PLN198       5          294376703
PLN199       5          302707417
PLN2         43057      277185489
PLN20        126        319952181
PLN200       7          303689386
PLN201       1          594546470
PLN202       1          587543788
PLN203       1          587190583
PLN204       1          583925327
PLN205       1          527343613
PLN206       1          513337126
PLN207       1          453691697
PLN208       37         334786838
PLN209       8          340070582
PLN21        1          337042926
PLN210       9          390483320
PLN211       13         354545671
PLN212       11         348059534
PLN213       10         393966332
PLN214       9          383224710
PLN215       48         384036176
PLN216       12         297308040
PLN217       16         390767870
PLN218       15         342302130
PLN219       6          394536461
PLN22        1          177533547
PLN220       6          379300625
PLN221       4          282458791
PLN222       47         384062827
PLN223       2          387361086
PLN224       9          393103628
PLN225       8          364968328
PLN226       13         372570551
PLN227       22         341526713
PLN228       37         16871
PLN229       149        79314
PLN23        1          292038349
PLN230       2469       93786416
PLN231       7181       18795412
PLN232       14346      29953091
PLN233       97593      209249304
PLN234       129575     90168428
PLN235       158758     148037237
PLN236       162647     146387113
PLN237       58044      31864056
PLN238       181513     123932492
PLN239       49956      254170640
PLN24        1          253125799
PLN240       41545      288268410
PLN241       72045      110649218
PLN242       98644      85504671
PLN243       49729      72847341
PLN244       25060      110564695
PLN245       13561      89764040
PLN246       1          774434471
PLN247       8305       28494037
PLN248       1861       361385154
PLN249       5          372618381
PLN25        1          251194792
PLN250       6          372447772
PLN251       6          368295254
PLN252       2          132503639
PLN253       498        311771607
PLN254       8          327823341
PLN255       6          343447962
PLN256       1          66465249
PLN257       1          474651383
PLN258       1          612216829
PLN259       1          571018318
PLN26        1          253267520
PLN260       1          574020038
PLN261       1          538550714
PLN262       1          514282554
PLN263       1          575541767
PLN264       134        336045988
PLN265       13675      307007082
PLN266       174186     123952105
PLN267       24774      16090513
PLN268       148143     156040944
PLN269       149391     145731344
PLN27        1          267785325
PLN270       87088      72025186
PLN271       154398     132579389
PLN272       163871     118479895
PLN273       25392      27605570
PLN274       148076     133569995
PLN275       126447     157675433
PLN276       167379     121297811
PLN277       116226     121197202
PLN278       134561     149271517
PLN279       102264     122021935
PLN28        1          175912755
PLN280       135670     149875291
PLN281       126481     162979955
PLN282       120445     166598788
PLN283       21323      19226286
PLN284       124171     164074184
PLN285       112837     172579451
PLN286       86183      159283399
PLN287       118873     172013099
PLN288       116204     186427777
PLN289       42424      238457033
PLN29        1          266007691
PLN290       18948      355887289
PLN291       19737      363518883
PLN292       10232      333664247
PLN293       302        288936846
PLN294       5          324373291
PLN295       1670       369972731
PLN296       1620       2256477
PLN297       1384       387002570
PLN298       8          179149947
PLN299       1282       232633870
PLN3         3690       380066186
PLN30        1          244603042
PLN300       1          522466905
PLN301       1          675310294
PLN302       1          628753756
PLN303       1          624247919
PLN304       1          599018945
PLN305       1          573247234
PLN306       1          634667502
PLN307       8563       149646365
PLN308       1          727344967
PLN309       1          946003158
PLN31        1          277312646
PLN310       1          965754312
PLN311       1          906459801
PLN312       1          876148008
PLN313       1          885153844
PLN314       1          899925126
PLN315       1          528437893
PLN316       4156       344360411
PLN317       10         362580157
PLN318       4          120184706
PLN319       129        363594612
PLN32        136        366824829
PLN320       404        366581476
PLN321       9          335385998
PLN322       130        308977848
PLN323       206        92200731
PLN324       16         383095167
PLN325       47         120890229
PLN326       1          541700351
PLN327       1          696809892
PLN328       1          655542733
PLN329       1          648987779
PLN33        19722      52892634
PLN330       1          622068216
PLN331       1          583456046
PLN332       1          654005093
PLN333       130        298375
PLN334       1          522466905
PLN335       1          675310294
PLN336       1          628753756
PLN337       1          624247919
PLN338       1          599018945
PLN339       1          573247234
PLN34        96584      101383193
PLN340       1          634667502
PLN341       344        95023900
PLN342       1          521073757
PLN343       1          672273650
PLN344       1          634137895
PLN345       1          624121443
PLN346       1          607506942
PLN347       1          564293627
PLN348       1          632401812
PLN349       1          520603772
PLN35        113437     117621940
PLN350       1          661076038
PLN351       1          626572591
PLN352       1          612852138
PLN353       1          598896166
PLN354       1          570629545
PLN355       1          623813090
PLN356       1          513014082
PLN357       1          653624577
PLN358       1          616219606
PLN359       1          610044819
PLN36        57311      72144580
PLN360       1          583417444
PLN361       1          550735148
PLN362       1          620104558
PLN363       1          536602846
PLN364       1          685423969
PLN365       1          640667275
PLN366       1          639123876
PLN367       1          612949391
PLN368       1          577192767
PLN369       1          641629864
PLN37        28689      28922869
PLN370       1          500012378
PLN371       1          648922534
PLN372       1          604770208
PLN373       1          597403059
PLN374       1          576456374
PLN375       1          556080982
PLN376       1          603311816
PLN377       1          512023576
PLN378       1          652551272
PLN379       1          615767531
PLN38        2648       194594881
PLN380       1          605571303
PLN381       1          592249714
PLN382       1          549757368
PLN383       1          616509610
PLN384       2          1184
PLN385       1          550024188
PLN386       1          710194481
PLN387       1          661081403
PLN388       1          659460550
PLN389       1          630572514
PLN39        344        254550430
PLN390       1          598618390
PLN391       1          658974642
PLN392       1          559656399
PLN393       1          717517502
PLN394       1          672450454
PLN395       1          665297378
PLN396       1          636785599
PLN397       1          599706080
PLN398       1          675658265
PLN399       1          523168208
PLN4         3522       387726869
PLN40        400        261235914
PLN400       1          671211297
PLN401       1          630677708
PLN402       1          623428415
PLN403       1          604298040
PLN404       1          558526623
PLN405       1          628419988
PLN406       1          495661851
PLN407       1          640830439
PLN408       1          597781253
PLN409       1          600363860
PLN41        198        168828441
PLN410       1          570178053
PLN411       1          534998810
PLN412       1          616598997
PLN413       1          537457279
PLN414       1          685947972
PLN415       1          649921694
PLN416       1          641099225
PLN417       1          611845738
PLN418       1          581041262
PLN419       1          655783664
PLN42        298        258873545
PLN420       1          521174834
PLN421       1          667717957
PLN422       1          631819663
PLN423       1          624692602
PLN424       1          597351075
PLN425       1          561737938
PLN426       1          629651422
PLN427       1          524514255
PLN428       1          670202054
PLN429       1          631946783
PLN43        339        265493888
PLN430       1          626743494
PLN431       1          600801835
PLN432       1          566971015
PLN433       1          629827058
PLN434       1          522114480
PLN435       1          671530377
PLN436       1          631910401
PLN437       1          622474059
PLN438       1          598240357
PLN439       1          562137082
PLN44        485        350911896
PLN440       1          633805855
PLN441       1          525723083
PLN442       1          684336246
PLN443       1          636053469
PLN444       1          629969872
PLN445       1          604087610
PLN446       1          568600391
PLN447       1          640498578
PLN448       1          519546829
PLN449       1          665715246
PLN45        112        80604200
PLN450       1          624683667
PLN451       1          621078253
PLN452       1          600910593
PLN453       1          558953701
PLN454       1          626840912
PLN455       1          543344542
PLN456       1          697540743
PLN457       1          655862368
PLN458       1          646765634
PLN459       1          618540729
PLN46        455        379563194
PLN460       1          587963859
PLN461       1          658085510
PLN462       449        378687213
PLN463       15         312691008
PLN464       20         111531882
PLN465       1          596211899
PLN466       1          705338699
PLN467       1          493450010
PLN468       1          804285258
PLN469       1          810734643
PLN47        143        364543151
PLN470       1          673981989
PLN471       1          754496630
PLN472       1          855759449
PLN473       1          614042580
PLN474       1          743847818
PLN475       1          673340788
PLN476       1          515668560
PLN477       1          713320806
PLN478       1          703598484
PLN479       1          570159854
PLN48        92         268011045
PLN480       1          625793224
PLN481       1          721110502
PLN482       1          459355444
PLN483       1          745201001
PLN484       1          749284433
PLN485       1          643344672
PLN486       1          595297365
PLN487       1          688905267
PLN488       1          491807393
PLN489       1          769338634
PLN49        108        325736871
PLN490       1          671568023
PLN491       1          635285330
PLN492       1          745618965
PLN493       1          839470345
PLN494       1          646400022
PLN495       1          747589525
PLN496       1          665179885
PLN497       1          506585010
PLN498       1          703962928
PLN499       1          702438406
PLN5         97869      212110241
PLN50        17         390428741
PLN500       1          568126671
PLN501       1          610851963
PLN502       1          707596419
PLN503       1          465558328
PLN504       1          734536914
PLN505       1          738743901
PLN506       1          636778132
PLN507       1          602900890
PLN508       1          697493198
PLN509       1          490518203
PLN51        246        346776993
PLN510       1          784661008
PLN511       1          810500911
PLN512       1          655314739
PLN513       1          752710991
PLN514       1          890847171
PLN515       1          621781073
PLN516       1          743084022
PLN517       1          676741658
PLN518       1          509452426
PLN519       1          710124532
PLN52        155        383508558
PLN520       1          480767623
PLN521       1          578021311
PLN522       1          620140791
PLN523       1          716573881
PLN524       1          476726550
PLN525       1          756324664
PLN526       1          977471539
PLN527       1          642207261
PLN528       1          502612092
PLN529       1          646234737
PLN53        85         329381794
PLN530       1          605172934
PLN531       1          593744788
PLN532       1          571972453
PLN533       1          545472572
PLN534       1          607667504
PLN535       1          590561804
PLN536       1          685720839
PLN537       1          490910922
PLN538       1          782694893
PLN539       1          796420183
PLN54        15         388403916
PLN540       1          650274702
PLN541       1          739889549
PLN542       1          848590828
PLN543       1          610626473
PLN544       1          738023571
PLN545       1          667607564
PLN546       1          506274898
PLN547       1          701434008
PLN548       1          690770133
PLN549       1          567265955
PLN55        22         360710420
PLN550       1          612987783
PLN551       1          704156067
PLN552       1          475327881
PLN553       1          732118298
PLN554       1          733931846
PLN555       1          636796232
PLN556       1          599764323
PLN557       1          691313424
PLN558       1          493357854
PLN559       1          782685093
PLN56        6          376299569
PLN560       1          786410271
PLN561       1          648139033
PLN562       1          744407562
PLN563       1          835583350
PLN564       1          623221719
PLN565       1          741299132
PLN566       1          669032550
PLN567       1          517040482
PLN568       1          711661679
PLN569       1          708205786
PLN57        1          65870126
PLN570       1          573398137
PLN571       1          583494258
PLN572       1          707105489
PLN573       1          471251328
PLN574       1          737453356
PLN575       1          736349413
PLN576       1          639162162
PLN577       1          586755746
PLN578       1          704478343
PLN579       1          492109999
PLN58        93         388494695
PLN580       1          791475352
PLN581       1          785940626
PLN582       1          661246824
PLN583       1          756990402
PLN584       1          858776195
PLN585       1          621195942
PLN586       1          754256086
PLN587       1          670301833
PLN588       1          509263899
PLN589       1          708234589
PLN59        15         373888800
PLN590       1          725120110
PLN591       1          575129590
PLN592       1          620883766
PLN593       1          727285804
PLN594       1          479660269
PLN595       1          745978486
PLN596       1          750160716
PLN597       1          642428577
PLN598       1          591313643
PLN599       1          705330581
PLN6         111631     128056225
PLN60        9          363551984
PLN600       1          495656580
PLN601       1          803232604
PLN602       1          790745243
PLN603       1          657494025
PLN604       1          759305888
PLN605       1          856542542
PLN606       1          628321883
PLN607       1          754364263
PLN608       1          697113365
PLN609       1          504254270
PLN61        60         374148929
PLN610       1          715354979
PLN611       1          713929667
PLN612       1          572943128
PLN613       1          626959190
PLN614       1          715714221
PLN615       1          483823121
PLN616       1          742917797
PLN617       1          748536659
PLN618       1          643784981
PLN619       1          600654286
PLN62        14         212654302
PLN620       1          685083685
PLN621       1          486317123
PLN622       1          794150360
PLN623       1          799857935
PLN624       1          655329108
PLN625       1          749763888
PLN626       1          838116175
PLN627       1          610468321
PLN628       1          736551279
PLN629       1          666328382
PLN63        74         124609184
PLN630       1          504826275
PLN631       1          702606209
PLN632       1          467876140
PLN633       1          566465558
PLN634       1          614421429
PLN635       1          698878671
PLN636       1          480431564
PLN637       1          735408736
PLN638       1          969998116
PLN639       1          635024734
PLN64        8          358353307
PLN640       10         3368
PLN641       1          595339094
PLN642       1          698605642
PLN643       1          499102108
PLN644       1          791748890
PLN645       1          797311483
PLN646       1          656817438
PLN647       1          753360318
PLN648       1          845838138
PLN649       1          619661694
PLN65        3          347496433
PLN650       1          752772853
PLN651       1          689709469
PLN652       1          509595892
PLN653       1          712797596
PLN654       1          710493282
PLN655       1          570643040
PLN656       1          619886155
PLN657       1          705533140
PLN658       1          484551304
PLN659       1          740148362
PLN66        4          370651368
PLN660       1          757233630
PLN661       1          642499559
PLN662       1          594006513
PLN663       1          693261537
PLN664       1          492948387
PLN665       1          781462734
PLN666       1          802944975
PLN667       1          650275864
PLN668       1          756841830
PLN669       1          850623622
PLN67        2          271593360
PLN670       1          614136911
PLN671       1          723255126
PLN672       1          669876730
PLN673       1          507533340
PLN674       1          712168462
PLN675       1          712339524
PLN676       1          564869106
PLN677       1          619418949
PLN678       1          715454519
PLN679       1          478264344
PLN68        1          150766190
PLN680       1          734693445
PLN681       1          749685439
PLN682       1          633598967
PLN683       1          782818162
PLN684       1          1022071454
PLN685       1          971920087
PLN686       1          827198496
PLN687       1          867619200
PLN688       1          806566123
PLN689       1          1015700474
PLN69        2          288204953
PLN690       1          742303966
PLN691       1          956173857
PLN692       1          916702776
PLN693       1          874517040
PLN694       1          816294110
PLN695       1          750216944
PLN696       1          862608691
PLN697       20         4493
PLN698       175        140763171
PLN699       1          516505932
PLN7         64212      184494355
PLN70        2          286787940
PLN700       1          665585731
PLN701       1          621516506
PLN702       1          610333535
PLN703       1          588218686
PLN704       1          561794515
PLN705       1          632540561
PLN706       118        87991
PLN707       1          313789095
PLN708       1          248068439
PLN709       1          241454477
PLN71        2          295931502
PLN710       1          251811976
PLN711       1          225452224
PLN712       1          173806927
PLN713       2          370152128
PLN714       168        374290347
PLN715       603        391598667
PLN716       10         362580157
PLN717       7          281547701
PLN718       1          314258027
PLN719       1          394306295
PLN72        64         355204210
PLN720       1          325599754
PLN721       1          288763641
PLN722       1          187311108
PLN723       1          277174932
PLN724       1          235078182
PLN725       15         332895745
PLN726       16436      36185494
PLN727       5636       1862075
PLN728       5224       2478918
PLN729       1          563502314
PLN73        8          357495982
PLN730       833        298337632
PLN731       1194       92707173
PLN732       1          594102056
PLN733       1          689851870
PLN734       1          495453186
PLN735       1          780798557
PLN736       1          801256715
PLN737       1          651852609
PLN738       1          750843639
PLN739       1          830829764
PLN74        2          99419683
PLN740       1          615552423
PLN741       1          744588157
PLN742       1          673617499
PLN743       1          509857067
PLN744       1          709773743
PLN745       1          713149757
PLN746       1          566080677
PLN747       1          618079260
PLN748       1          720988478
PLN749       1          473592718
PLN75        7          376229618
PLN750       1          736706236
PLN751       1          750620385
PLN752       1          638686055
PLN753       1          480980714
PLN754       6684       330577769
PLN755       3760       370633860
PLN756       10098      326491459
PLN757       1753       12315783
PLN758       1          585266722
PLN759       1          681112512
PLN76        6          342806685
PLN760       1          775448786
PLN761       1          790338525
PLN762       1          746673839
PLN763       1          836514780
PLN764       1          736872137
PLN765       1          676292951
PLN766       1          669155517
PLN767       1          701372996
PLN768       1          615672275
PLN769       1          698614761
PLN77        6          347730275
PLN770       1          728031845
PLN771       1          722970987
PLN772       12302      8480478
PLN773       94681      142561266
PLN774       109099     181645523
PLN775       87294      199567737
PLN776       84113      200950924
PLN777       96877      192949726
PLN778       103808     189012171
PLN779       102090     189085883
PLN78        6          350661716
PLN780       14738      36814224
PLN781       88908      206505027
PLN782       83900      206548878
PLN783       73448      223610334
PLN784       45236      139025166
PLN785       67487      233342618
PLN786       69271      218649165
PLN787       62427      240724906
PLN788       2557       11680467
PLN789       63754      236475493
PLN79        43         144640005
PLN790       49389      247148884
PLN791       46394      247692333
PLN792       24088      77236992
PLN793       63423      234674485
PLN794       53520      244141932
PLN795       53654      245106175
PLN796       55387      259880210
PLN797       54717      241281795
PLN798       10396      39950604
PLN799       54083      252654623
PLN8         21754      107220939
PLN80        144        326417895
PLN800       59762      235712433
PLN801       56712      242585573
PLN802       46266      151576695
PLN803       61937      237634925
PLN804       48934      251839502
PLN805       35741      291290546
PLN806       22678      126817534
PLN807       57117      248650346
PLN808       86610      206151367
PLN809       55004      247171828
PLN81        7          298887356
PLN810       22698      318065415
PLN811       7          376527656
PLN812       1          528447123
PLN813       1          678170541
PLN814       1          639558213
PLN815       1          629672760
PLN816       1          608467472
PLN817       1          565695744
PLN818       1          634886329
PLN819       1          532083992
PLN82        6          332369654
PLN820       1          684376481
PLN821       1          642597466
PLN822       1          631979072
PLN823       1          607115911
PLN824       1          582960187
PLN825       1          640026769
PLN826       1          608979116
PLN827       1          720972993
PLN828       1          501257520
PLN829       1          804602427
PLN83        50         340388796
PLN830       1          808121247
PLN831       1          649118519
PLN832       1          758906661
PLN833       1          861141126
PLN834       1          642382296
PLN835       1          759893476
PLN836       1          689766370
PLN837       1          531462149
PLN838       1          714517032
PLN839       1          717288350
PLN84        40         308864128
PLN840       1          586345039
PLN841       1          626266972
PLN842       1          738085275
PLN843       1          505809789
PLN844       1          759124079
PLN845       1          751612808
PLN846       1          653055523
PLN847       7          358620060
PLN848       687        177292972
PLN849       1          478410592
PLN85        2          108425436
PLN850       1          530843944
PLN851       1          529541203
PLN852       1          616320322
PLN853       1          560314678
PLN854       1          552570299
PLN855       1          477706438
PLN856       1          464083788
PLN857       1          411577152
PLN858       1          461076154
PLN859       1          463363089
PLN86        202        322775705
PLN860       1          481348281
PLN861       1          411112127
PLN862       1          485809178
PLN863       1          525998845
PLN864       1          469027344
PLN865       1          409103995
PLN866       1          460274876
PLN867       1          476570508
PLN868       1          445971407
PLN869       1          490396672
PLN87        6          336790634
PLN870       1          426632976
PLN871       1          538887009
PLN872       1          574640544
PLN873       1          667652801
PLN874       1          573769737
PLN875       1          579564072
PLN876       1          506557729
PLN877       1          469999753
PLN878       1          516880681
PLN879       1          454437434
PLN88        5          336035871
PLN880       1          415133431
PLN881       1          489887590
PLN882       1          289026301
PLN883       1          490033736
PLN884       1          542991241
PLN885       1          484002173
PLN886       1          527161174
PLN887       1          513237590
PLN888       1          458108957
PLN889       1          448178421
PLN89        6          326965702
PLN890       1          577845554
PLN891       1          529955746
PLN892       1          534821622
PLN893       1          551069265
PLN894       1          588203704
PLN895       1          459891171
PLN896       1          555382095
PLN897       1          455803086
PLN898       1          509477500
PLN899       1          582703961
PLN9         35208      291130285
PLN90        5          304407451
PLN900       1          567151184
PLN901       1          459232789
PLN902       1          577255397
PLN903       1          441736736
PLN904       1          534335728
PLN905       19         2859863
PLN906       1          613662638
PLN907       1          794474755
PLN908       1          760111594
PLN909       1          769810128
PLN91        20         316869596
PLN910       1          715684684
PLN911       1          623890083
PLN912       1          755457679
PLN913       1          717109572
PLN914       1          817712742
PLN915       1          864624966
PLN916       1          701857263
PLN917       1          726425509
PLN918       1          738041677
PLN919       1          767912069
PLN92        5          284426683
PLN920       1          504659958
PLN921       1          662526948
PLN922       1          633282846
PLN923       1          534651777
PLN924       1          584285409
PLN925       1          507261758
PLN926       1          659687352
PLN927       1          224073253
PLN928       1          198628823
PLN929       1          322486422
PLN93        8          327303441
PLN930       1          260047251
PLN931       1          262402055
PLN932       1          330012911
PLN933       1          349800169
PLN934       1          354403191
PLN935       1          317988395
PLN936       1          376468909
PLN937       313        342168471
PLN938       5          315557653
PLN939       18         309282167
PLN94        61         76849044
PLN940       10         333088290
PLN941       79         344751863
PLN942       38         343074766
PLN943       5          325733636
PLN944       389        384262295
PLN945       10         375480087
PLN946       10         379071384
PLN947       9          351388705
PLN948       2          74237962
PLN949       1          472108912
PLN95        2          355063454
PLN950       1          611709054
PLN951       1          571129681
PLN952       1          563957086
PLN953       1          535211053
PLN954       1          496554540
PLN955       1          578502594
PLN956       127        369812338
PLN957       10         389503495
PLN958       10         374804231
PLN959       8          300501703
PLN96        1          333667882
PLN960       10         369372075
PLN961       1042       169430586
PLN962       1          605966608
PLN963       1          703076930
PLN964       1          495911329
PLN965       1          796169439
PLN966       1          779372321
PLN967       1          665561653
PLN968       1          757165295
PLN969       1          852704148
PLN97        1          302574826
PLN970       1          623698249
PLN971       1          745048881
PLN972       1          677947850
PLN973       1          524289323
PLN974       1          726838826
PLN975       1          701430346
PLN976       1          584133940
PLN977       1          622677745
PLN978       1          745712656
PLN979       1          490622797
PLN98        1          296818136
PLN980       1          748850018
PLN981       1          753856519
PLN982       1          643890519
PLN983       699        30235861
PLN984       1          593930347
PLN985       1          702775664
PLN986       1          494594617
PLN987       1          792837209
PLN988       1          812232696
PLN989       1          661835603
PLN99        1          257455782
PLN990       1          750337041
PLN991       1          854463248
PLN992       1          623248023
PLN993       1          749950614
PLN994       1          673746810
PLN995       1          520815567
PLN996       1          712547961
PLN997       1          703299309
PLN998       1          569771178
PLN999       1          620176429
PRI1         23047      60053106
PRI10        2265       387936439
PRI11        4375       381717987
PRI12        2068       191950792
PRI13        2459       391017609
PRI14        17343      243216304
PRI15        27929      79132073
PRI16        96050      166265556
PRI17        11025      363947920
PRI18        3741       383223079
PRI19        15303      353911286
PRI2         23840      319341223
PRI20        2239       172855211
PRI21        1          250749103
PRI22        1          238414537
PRI23        2          387789264
PRI24        2          351926207
PRI25        2          301224727
PRI26        2          270924633
PRI27        3          376243325
PRI28        4          374251276
PRI29        5          290585290
PRI3         2613       370370379
PRI30        42294      314449515
PRI31        19027      23602325
PRI32        53141      193817517
PRI33        4          351860731
PRI34        5          337827736
PRI35        3          297245061
PRI36        3          382019003
PRI37        2          285375381
PRI38        2          306826759
PRI39        2          354172067
PRI4         2409       360399901
PRI40        2          394680893
PRI41        1          242696752
PRI42        1          248387328
PRI43        17505      351769399
PRI44        118186     177543446
PRI45        43987      90998900
PRI46        74331      199953923
PRI47        54422      215579299
PRI48        34648      144367010
PRI49        69722      214218592
PRI5         2593       353874487
PRI50        97791      190663069
PRI51        1165       237482673
PRI52        1          190673448
PRI53        9368       358512524
PRI54        49037      210795631
PRI55        84598      191050479
PRI56        45507      262598445
PRI57        41023      294434612
PRI58        38614      71559567
PRI6         2112       282951291
PRI7         2729       356953890
PRI8         3181       362167571
PRI9         2423       385530941
ROD1         38460      309640694
ROD10        15053      352243468
ROD100       5          331474410
ROD101       2          318539651
ROD102       3          346986554
ROD103       2          195914539
ROD104       3          320471619
ROD105       2          303502892
ROD106       2          280790320
ROD107       3          392932004
ROD108       4          351698734
ROD109       2          368221265
ROD11        1336       2453179
ROD110       2          303625032
ROD111       2          292706097
ROD112       2          278161066
ROD113       3          373049758
ROD114       3          349653794
ROD115       3          308876130
ROD116       4          238660990
ROD117       2          379622902
ROD118       2          334811729
ROD119       2          307236712
ROD12        22213      347967024
ROD120       2          287806543
ROD121       3          391762678
ROD122       3          360814732
ROD123       3          314134467
ROD124       4          239932575
ROD125       2          373193903
ROD126       1          157584965
ROD127       2          299783671
ROD128       2          295158694
ROD129       3          388896513
ROD13        1002       157743814
ROD130       3          359745676
ROD131       3          334741362
ROD132       5          333237167
ROD133       2          317726462
ROD134       1          118876157
ROD135       3          341713382
ROD136       4          374029993
ROD137       3          389445867
ROD138       2          291998396
ROD139       2          278095263
ROD14        53466      238707384
ROD140       4          390852856
ROD141       2          370533799
ROD142       2          304047488
ROD143       2          292691026
ROD144       2          276929041
ROD145       3          372795034
ROD146       3          347692711
ROD147       3          308420172
ROD148       4          236625227
ROD149       2          370341452
ROD15        21658      310382782
ROD150       2          307760277
ROD151       2          294424009
ROD152       2          281871870
ROD153       3          372472209
ROD154       3          349207861
ROD155       2          214783614
ROD156       5          332654019
ROD157       2          367229262
ROD158       2          304331769
ROD159       2          288798215
ROD16        228306     97098819
ROD160       2          275554257
ROD161       2          251405689
ROD162       3          354090641
ROD163       3          326613543
ROD164       5          331013327
ROD165       2          368057253
ROD166       2          306226071
ROD167       1          147422267
ROD168       2          291393309
ROD169       3          385188841
ROD17        97458      65701988
ROD170       3          355338747
ROD171       3          326750920
ROD172       5          331081197
ROD173       1          196977572
ROD174       2          340285783
ROD175       2          310111918
ROD176       2          296020819
ROD177       2          268302591
ROD178       3          367814812
ROD179       3          354083518
ROD18        40402      250919327
ROD180       4          377434897
ROD181       2          58596888
ROD182       2          316597187
ROD183       3          346141334
ROD184       3          309646819
ROD185       3          235883790
ROD186       2          332395505
ROD187       2          297647048
ROD188       2          282771228
ROD189       4          393253035
ROD19        2          383374219
ROD190       2          311845466
ROD191       3          332317170
ROD192       4          331904146
ROD193       2          328442178
ROD194       2          293393805
ROD195       1          133371210
ROD196       2          271974197
ROD197       2          251802734
ROD198       13         271995219
ROD199       2          270496589
ROD2         1810       346955540
ROD20        2          353017828
ROD200       3          366902997
ROD201       3          316563723
ROD202       2          193388464
ROD203       4          334716799
ROD204       5          351324292
ROD205       7          371849360
ROD206       6          366049425
ROD207       3          376938858
ROD208       3          338808579
ROD209       4          381108299
ROD21        2          317259772
ROD210       4          323564818
ROD211       6          393907859
ROD212       8          351603620
ROD213       8          357587743
ROD214       1          188060799
ROD215       2          341922886
ROD216       2          316883888
ROD217       2          280377800
ROD218       3          347137656
ROD219       3          315189109
ROD22        2          289653994
ROD220       3          271011851
ROD221       5          354922138
ROD222       5          294688320
ROD223       2          387647059
ROD224       2          325165809
ROD225       2          311669100
ROD226       2          279641759
ROD227       3          378019186
ROD228       3          366857421
ROD229       4          391937005
ROD23        1          140975125
ROD230       3          259447828
ROD231       2          338914351
ROD232       1          159396618
ROD233       2          300967943
ROD234       2          278090573
ROD235       3          382029770
ROD236       3          346788880
ROD237       4          341355724
ROD238       3          299539788
ROD239       2          384716882
ROD24        3          385591618
ROD240       2          334812016
ROD241       2          317562325
ROD242       2          297867706
ROD243       3          391596307
ROD244       3          375850127
ROD245       3          319077903
ROD246       1          96079412
ROD247       4          372403099
ROD248       2          339353113
ROD249       2          291476052
ROD25        4          335044383
ROD250       3          361948668
ROD251       3          323820154
ROD252       4          334059592
ROD253       2          135967815
ROD254       6          388732520
ROD255       2          384840810
ROD256       2          325715141
ROD257       2          293400725
ROD258       3          361928079
ROD259       3          312575313
ROD26        5          356599364
ROD260       4          339307352
ROD261       6          387071614
ROD262       3          323777831
ROD263       2          323038558
ROD264       2          290396403
ROD265       3          353192969
ROD266       2          176309395
ROD267       4          317700958
ROD268       5          354035076
ROD269       5          364586500
ROD27        2          394024503
ROD270       2          377919911
ROD271       2          322351463
ROD272       2          275598125
ROD273       3          359387094
ROD274       4          359114848
ROD275       5          381796720
ROD276       5          291605963
ROD277       2          349406529
ROD278       2          332414924
ROD279       1          154951719
ROD28        2          369416674
ROD280       2          276957429
ROD281       3          340415119
ROD282       4          344898844
ROD283       5          391338277
ROD284       5          302617006
ROD285       2          360867642
ROD286       2          323987561
ROD287       2          295177884
ROD288       3          353085942
ROD289       4          349381944
ROD29        2          335852806
ROD290       5          391992857
ROD291       6          346362378
ROD292       2          318921425
ROD293       2          329179204
ROD294       1          153606186
ROD295       3          389462371
ROD296       3          321351180
ROD297       4          331856423
ROD298       6          392378592
ROD299       4          297015981
ROD3         1885       351998373
ROD30        2          300392300
ROD300       2          343527564
ROD301       3          385070196
ROD302       3          320857378
ROD303       4          353697838
ROD304       5          370381281
ROD305       6          372002468
ROD306       20450      223453126
ROD31        2          283621167
ROD32        3          348161973
ROD33        5          386542915
ROD34        154        237877425
ROD35        1          193958709
ROD36        2          350925653
ROD37        2          319642044
ROD38        2          276360533
ROD39        3          382322699
ROD4         1944       361078959
ROD40        3          366447402
ROD41        84         375321811
ROD42        2          329179204
ROD43        2          290564596
ROD44        3          362508543
ROD45        3          304367499
ROD46        5          385423505
ROD47        6          342729329
ROD48        3          325864489
ROD49        4          358685719
ROD5         1990       363733749
ROD50        4          302148481
ROD51        5          337904903
ROD52        6          385168143
ROD53        6          347801590
ROD54        6          283624907
ROD55        86642      225709587
ROD56        5381       213475379
ROD57        2          307631349
ROD58        2          273205312
ROD59        2          272523522
ROD6         306        57843793
ROD60        3          367476852
ROD61        3          318205593
ROD62        5          305035074
ROD63        2          318173246
ROD64        2          308990189
ROD65        2          273361793
ROD66        3          387778067
ROD67        3          350884214
ROD68        4          388911322
ROD69        4          237246301
ROD7         1975       368354297
ROD70        2          368078907
ROD71        2          295232279
ROD72        2          276158786
ROD73        3          370764878
ROD74        3          367374895
ROD75        5          389069045
ROD76        100        129934266
ROD77        2          318742393
ROD78        3          344928637
ROD79        4          373808507
ROD8         1990       369693686
ROD80        3          390678500
ROD81        2          278778348
ROD82        2          267696443
ROD83        2          294192228
ROD84        3          240341385
ROD85        2          368562428
ROD86        2          305746062
ROD87        2          295306346
ROD88        2          279190114
ROD89        1          126990816
ROD9         1959       368016559
ROD90        3          364697793
ROD91        3          342498328
ROD92        4          374582747
ROD93        3          249713888
ROD94        2          330770236
ROD95        2          292927924
ROD96        2          286762350
ROD97        3          381058419
ROD98        3          353678059
ROD99        3          326328631
STS1         170406     86844690
STS10        202241     61367008
STS11        167006     59450871
STS2         143556     63323860
STS3         8293       4868512
STS4         108725     63673512
STS5         110380     70041358
STS6         106165     81422843
STS7         122522     86626105
STS8         198951     60928175
STS9         8743       2376203
SYN1         54444      100627167
SYN10        2          382762979
SYN11        2          332214168
SYN12        4          386933112
SYN13        1          271050050
SYN14        2          294093621
SYN15        3          329883353
SYN16        4          353920981
SYN17        2          328712085
SYN18        4          357672913
SYN19        1          207870274
SYN2         1          271050050
SYN20        2          382762979
SYN21        2          332214168
SYN22        8          392789107
SYN23        6050       279301077
SYN24        60395      178639794
SYN25        9183       352928592
SYN26        17230      334487459
SYN27        109321     160822936
SYN28        33227      99558648
SYN29        18327      273842269
SYN3         2          294093621
SYN4         3          329883353
SYN5         4          353920981
SYN6         1          64242768
SYN7         3          371658272
SYN8         2          250483958
SYN9         1          207870274
TSA1         233360     79647647
TSA10        168556     151807723
TSA100       63252      114802277
TSA101       79841      41351312
TSA102       82721      28609319
TSA103       67721      19747702
TSA104       84021      22863253
TSA105       84236      21912832
TSA106       84446      20981295
TSA107       134042     46621688
TSA108       155667     149676184
TSA109       183730     101083950
TSA11        157777     129834268
TSA110       47348      107503283
TSA111       136867     166252974
TSA112       166495     124901244
TSA113       97423      237859520
TSA114       99257      234633653
TSA115       12708      5978473
TSA116       134189     172362066
TSA117       127781     180160426
TSA118       129595     177105775
TSA119       121186     168272985
TSA12        97090      81392351
TSA120       161588     123667649
TSA121       122311     187541168
TSA122       147961     145186533
TSA123       94592      61300137
TSA124       136202     168455642
TSA125       159235     124954199
TSA126       156460     125810552
TSA127       123500     121448801
TSA13        143803     166125438
TSA14        181274     128537289
TSA15        66503      19953423
TSA16        206960     109167065
TSA17        187291     103573225
TSA18        49603      65723896
TSA19        154594     149438301
TSA2         222146     88664556
TSA20        216430     100054673
TSA21        205490     102782849
TSA22        23776      14252292
TSA23        157937     126687163
TSA24        173072     148399453
TSA25        214206     84411561
TSA26        107859     75824864
TSA27        170344     70732329
TSA28        221651     89477532
TSA29        29733      20452936
TSA3         74968      22652895
TSA30        203801     105213489
TSA31        180099     145440715
TSA32        69822      31097770
TSA33        187865     125693344
TSA34        147174     170803041
TSA35        162308     143165183
TSA36        151039     162405461
TSA37        167242     151938086
TSA38        140834     133825444
TSA39        170040     156652284
TSA4         197157     115804961
TSA40        69540      96684132
TSA41        171848     122209118
TSA42        189667     128235933
TSA43        179069     130028168
TSA44        75738      42986921
TSA45        179829     148956459
TSA46        157580     110411669
TSA47        134660     95403465
TSA48        183454     131877937
TSA49        208660     102956314
TSA5         214836     133894002
TSA50        80586      111968754
TSA51        191615     109275606
TSA52        179941     117349019
TSA53        113521     119199539
TSA54        155201     136003572
TSA55        161488     91817237
TSA56        130889     143855858
TSA57        137079     81286772
TSA58        155441     162401639
TSA59        162373     156460053
TSA6         19260      21470091
TSA60        193151     120607701
TSA61        58953      96808413
TSA62        173904     118336485
TSA63        151844     162145055
TSA64        61002      124261245
TSA65        201330     152320116
TSA66        185417     143496051
TSA67        162494     121036165
TSA68        181441     137352733
TSA69        171437     97550710
TSA7         193237     53106267
TSA70        41533      39009849
TSA71        119065     123313318
TSA72        131964     141438855
TSA73        151655     115933671
TSA74        830        251943
TSA75        153005     102368390
TSA76        156511     143520695
TSA77        40571      33632062
TSA78        176683     138455592
TSA79        161599     158562361
TSA8         156250     122191293
TSA80        11806      9816655
TSA81        185669     115791752
TSA82        143260     147547562
TSA83        177228     144669069
TSA84        158729     177360001
TSA85        18209      12701058
TSA86        168396     128972709
TSA87        156485     150537294
TSA88        194540     124973144
TSA89        32593      22930994
TSA9         101489     69225839
TSA90        195904     138162133
TSA91        113368     113467451
TSA92        98986      206634893
TSA93        87112      229168164
TSA94        77344      247719367
TSA95        30093      107285833
TSA96        141033     144555977
TSA97        106053     76615758
TSA98        74413      65471527
TSA99        33768      32853514
UNA1         760        4530817
VRL1         131699     138794459
VRL10        120974     144239643
VRL100       10099      221654041
VRL100       12198      364404573
VRL100       12199      364430871
VRL100       12200      364463878
VRL100       12210      364752729
VRL100       2511       75016203
VRL100       12194      364262276
VRL100       12198      364407746
VRL100       12202      364523876
VRL100       12200      364461675
VRL100       7486       223638527
VRL101       3401       89651365
VRL101       12174      363696717
VRL101       12175      363751290
VRL101       12075      360851140
VRL101       7676       229440372
VRL101       12104      361449404
VRL101       11985      356799115
VRL101       12019      358023652
VRL101       9529       284184584
VRL101       11952      355810531
VRL101       12097      356085075
VRL102       9616       221612590
VRL102       11986      356944187
VRL102       11972      356737886
VRL102       29776      32791063
VRL103       11735      218786492
VRL104       9342       221397228
VRL105       3880       111129363
VRL106       7740       222413091
VRL107       9023       221994397
VRL108       7809       221674998
VRL109       8262       197841067
VRL11        43850      307774280
VRL110       7547       222351449
VRL111       8008       221562610
VRL112       7869       221743555
VRL113       2191       65297472
VRL114       8464       221483872
VRL115       7710       221269153
VRL116       10178      220790352
VRL117       7766       222257150
VRL118       171        5095946
VRL119       7825       219494238
VRL12        115979     144624453
VRL120       7362       217947535
VRL121       8225       221898519
VRL122       3876       115020512
VRL123       7642       221204272
VRL124       7468       222605611
VRL125       8350       222718674
VRL126       7445       219700261
VRL127       158        4680085
VRL128       7991       218419087
VRL129       8949       221302258
VRL13        23222      82082896
VRL130       7510       220577264
VRL131       7362       217947263
VRL132       5506       161792265
VRL133       12345      369032529
VRL134       12370      369697978
VRL135       12372      369939371
VRL136       12364      369688221
VRL137       12362      369613714
VRL138       5694       170227962
VRL139       12371      369781020
VRL14        113812     144638740
VRL140       12373      369792803
VRL141       12375      369826375
VRL142       8053       240653467
VRL143       12388      370186985
VRL144       12383      370039801
VRL145       12371      369530068
VRL146       5929       175935992
VRL147       7438       221720425
VRL148       8138       222153515
VRL149       7436       221629084
VRL15        112156     147882405
VRL150       2915       82731417
VRL151       7942       222816613
VRL152       7470       221831146
VRL153       8023       221748161
VRL154       9140       220633913
VRL155       3899       115600600
VRL156       7575       220443196
VRL157       7401       219629478
VRL158       7406       219532528
VRL159       3637       104745014
VRL16        27054      44683094
VRL160       7431       218929276
VRL161       7906       222150305
VRL162       7706       219545819
VRL163       7639       222832285
VRL164       4271       119343334
VRL165       8010       221376536
VRL166       7446       221323810
VRL167       7356       217836247
VRL168       8076       221009482
VRL169       3655       102042307
VRL17        90454      158875957
VRL170       7436       221704344
VRL171       7410       220394033
VRL172       7571       220559196
VRL173       5270       151251118
VRL174       7594       221660605
VRL175       7478       221621778
VRL176       7577       219174838
VRL177       1997       59084201
VRL178       7585       221735125
VRL179       7825       221774298
VRL18        96116      150075079
VRL180       7427       220819814
VRL181       2346       68509657
VRL182       8076       222756930
VRL183       7940       222724721
VRL184       7838       223110568
VRL185       7628       218210704
VRL186       7357       217798071
VRL187       7526       221894920
VRL188       7628       222851047
VRL189       7936       222614819
VRL19        62197      101160460
VRL190       107        3187018
VRL191       7439       221651602
VRL192       7682       222041907
VRL193       7603       221247314
VRL194       2634       78559766
VRL195       7594       221755119
VRL196       7380       218829625
VRL197       7520       220151146
VRL198       7491       222632432
VRL199       4430       119383423
VRL2         126042     151052400
VRL20        92198      165759101
VRL200       7686       222456010
VRL201       7714       221866051
VRL202       8856       221767820
VRL203       7736       218194622
VRL204       4205       123969957
VRL205       8143       222118020
VRL206       7510       221460568
VRL207       7658       224114337
VRL208       9437       223791299
VRL209       4788       139111686
VRL21        90976      163605275
VRL210       7778       221939633
VRL211       8946       222539688
VRL212       7483       221572525
VRL213       7389       218445357
VRL214       4264       126966021
VRL215       7729       221761362
VRL216       8044       221838792
VRL217       8241       224040759
VRL218       7916       223157610
VRL219       4132       119158877
VRL22        54327      121524737
VRL220       7658       221726300
VRL221       7552       222964992
VRL222       7350       217830050
VRL223       8163       223063250
VRL224       4341       126389372
VRL225       7958       222343966
VRL226       9532       219763888
VRL227       8556       221891762
VRL228       7446       221412869
VRL229       4178       123763074
VRL23        83025      172215138
VRL230       7428       220433440
VRL231       7590       222296901
VRL232       7837       222380437
VRL233       7434       221582927
VRL234       4422       121896013
VRL235       7928       222170329
VRL236       7710       221693354
VRL237       7723       221884090
VRL238       7388       219607115
VRL239       3526       104676726
VRL24        85554      166899243
VRL240       7432       221490436
VRL241       7537       222032585
VRL242       8151       222521755
VRL243       7669       222610990
VRL244       3936       117093658
VRL245       7574       222770999
VRL246       8786       222559443
VRL247       7410       219746404
VRL248       7424       221266874
VRL249       3923       116943646
VRL25        70032      119960997
VRL250       7424       221004936
VRL251       8376       222237418
VRL252       7645       221202012
VRL253       7559       221906378
VRL254       4011       117064643
VRL255       7980       220734403
VRL256       7386       219283530
VRL257       7783       221314684
VRL258       2048       61046862
VRL259       8930       220503224
VRL26        82604      167346882
VRL260       8239       221770236
VRL261       8798       221892631
VRL262       2160       64347662
VRL263       7463       221769723
VRL264       7462       222264480
VRL265       7402       220051865
VRL266       7632       221540990
VRL267       8063       221905076
VRL268       7619       222827814
VRL269       3658       109021120
VRL27        83077      166465647
VRL270       7466       221888492
VRL271       8019       220951946
VRL272       7693       222343859
VRL273       7808       222313633
VRL274       3781       112702688
VRL275       7524       221455523
VRL276       7745       220864075
VRL277       7737       222123607
VRL278       7502       221856538
VRL279       4711       116528412
VRL28        50882      113244753
VRL280       7510       220262506
VRL281       7486       221844509
VRL282       7595       222163951
VRL283       7466       221334941
VRL284       6226       184574828
VRL285       7451       221948430
VRL286       7446       221941433
VRL287       7491       222054544
VRL288       2481       73963232
VRL289       7519       222265703
VRL29        90683      178568760
VRL290       7667       222371933
VRL291       7519       222801965
VRL292       3392       101114242
VRL293       7541       218788614
VRL294       7641       221623371
VRL295       7446       221429004
VRL296       4656       137549576
VRL297       7455       230678110
VRL298       7680       220306131
VRL299       7737       222841869
VRL3         93445      168135159
VRL30        36910      299879053
VRL300       4079       119577042
VRL301       7972       221579339
VRL302       7382       219925223
VRL303       7526       221517245
VRL304       5550       165290465
VRL305       7503       221879775
VRL306       8205       222928193
VRL307       7441       220245299
VRL308       5817       171715446
VRL309       7513       222403973
VRL31        77080      184083874
VRL310       7601       223191798
VRL311       7557       222966687
VRL312       7472       220369586
VRL313       376        11201677
VRL314       7865       220324747
VRL315       7514       220301134
VRL316       7492       222701928
VRL317       4238       120052508
VRL318       13126      228484419
VRL319       7415       219048485
VRL32        55253      138690109
VRL320       8319       221528474
VRL321       3745       111430642
VRL322       7778       222435572
VRL323       7586       221187505
VRL324       7516       220771676
VRL325       2506       73262197
VRL326       7801       221564442
VRL327       8142       221616306
VRL328       8611       221070665
VRL329       8711       220054015
VRL33        67602      181926095
VRL330       1047       31189289
VRL331       7853       220693310
VRL332       7435       219775426
VRL333       7416       220390680
VRL334       7248       203105310
VRL335       20449      210572516
VRL336       7440       220960934
VRL337       8440       219145488
VRL338       7683       220128958
VRL339       34         1013669
VRL34        77881      184815930
VRL340       7340       218437065
VRL341       7517       221971863
VRL342       7531       221073709
VRL343       10947      221157812
VRL344       2216       65973623
VRL345       9184       220799752
VRL346       7828       222148265
VRL347       7400       219474138
VRL348       3082       83056403
VRL349       7485       220684760
VRL35        66619      159461581
VRL350       7645       219868104
VRL351       7626       220669643
VRL352       6820       200050794
VRL353       7578       221737035
VRL354       7529       221550216
VRL355       7383       218633333
VRL356       3423       98618833
VRL357       7596       222361948
VRL358       7675       221563923
VRL359       7399       220313944
VRL36        74544      192216793
VRL360       5495       160014237
VRL361       7823       221542095
VRL362       7515       221058723
VRL363       7419       219871438
VRL364       8190       219579044
VRL365       2301       68539850
VRL366       8928       217968848
VRL367       7975       220787712
VRL368       7460       221243672
VRL369       7384       219133172
VRL37        83870      169596590
VRL370       7732       220641119
VRL371       7482       219844968
VRL372       7874       221151929
VRL373       7564       220491729
VRL374       9909       218782899
VRL375       7844       222143459
VRL376       7468       221413584
VRL377       4938       123750203
VRL378       7657       219780079
VRL379       7552       222131405
VRL38        73075      148489219
VRL380       8039       221530742
VRL381       4535       115707569
VRL382       7595       221636930
VRL383       8196       220498424
VRL384       8469       221317614
VRL385       3559       104595079
VRL386       8068       221144032
VRL387       9358       220011067
VRL388       8348       219984089
VRL389       4586       133457750
VRL39        78286      176697543
VRL390       7619       223791272
VRL391       8851       223142146
VRL392       8018       222816370
VRL393       3673       98908472
VRL394       8975       220382625
VRL395       7615       222726348
VRL396       7751       222544839
VRL397       2678       72339688
VRL398       8469       221665726
VRL399       7525       222865787
VRL4         14356      137406370
VRL40        69976      179634678
VRL400       8067       222910608
VRL401       3507       103582796
VRL402       8723       221584697
VRL403       7540       222593665
VRL404       8394       222166937
VRL405       6941       203099976
VRL406       8248       223292974
VRL407       7881       222952182
VRL408       7674       221779668
VRL409       6808       184459045
VRL41        44591      196834925
VRL410       7873       222440928
VRL411       7882       222344918
VRL412       7541       223579669
VRL413       2851       84682789
VRL414       7573       223520412
VRL415       8879       219519426
VRL416       7706       222082073
VRL417       3919       107635063
VRL418       7832       220656189
VRL419       7895       223377518
VRL42        20389      137900845
VRL420       7610       221168921
VRL421       3277       93635779
VRL422       11916      217470835
VRL423       7657       221038728
VRL424       7730       220705331
VRL425       6693       177688870
VRL426       8707       222109765
VRL427       7558       223852914
VRL428       7728       221143983
VRL429       4727       132388134
VRL43        25055      217763452
VRL430       7820       219976645
VRL431       7519       222458098
VRL432       7384       218780069
VRL433       5849       167601166
VRL434       10594      219305572
VRL435       7591       222440765
VRL436       8921       218463290
VRL437       7809       220563375
VRL438       1878       53951426
VRL439       8013       223073402
VRL44        15069      218715380
VRL440       8232       222779347
VRL441       7670       224464029
VRL442       3159       93397595
VRL443       8381       221312922
VRL444       7525       220205402
VRL445       7623       222512678
VRL446       7938       222521341
VRL447       9321       223603365
VRL448       5971       176975201
VRL449       10206      221711088
VRL45        33842      207432986
VRL450       7529       222833725
VRL451       7457       222233903
VRL452       4547       123529645
VRL453       7915       220684222
VRL454       7613       220134003
VRL455       7849       221250171
VRL456       2393       71129807
VRL457       7735       225041188
VRL458       10127      217486996
VRL459       7503       221815625
VRL46        11261      128864136
VRL460       6248       169258400
VRL461       9489       225067854
VRL462       7792       219926719
VRL463       8438       222670077
VRL464       9664       224034807
VRL465       4548       122907537
VRL466       7877       224461783
VRL467       7758       220251581
VRL468       10742      220175125
VRL469       4109       121928069
VRL47        18950      217639810
VRL470       8249       224652588
VRL471       7536       220510780
VRL472       7710       223822290
VRL473       5321       150192020
VRL474       8027       220514127
VRL475       9232       221182900
VRL476       9041       219045150
VRL477       4595       124876797
VRL478       9777       220257795
VRL479       8019       221725929
VRL48        25234      214685962
VRL480       8693       219189848
VRL481       6427       126367479
VRL482       11904      216607002
VRL483       7432       219819191
VRL484       7814       221849610
VRL485       7381       202543244
VRL486       8036       220710073
VRL487       8029       221219465
VRL488       7771       221220565
VRL489       8417       204867846
VRL49        17075      217691282
VRL490       10112      222234240
VRL491       7675       220876628
VRL492       7564       221290628
VRL493       7637       222507829
VRL494       7745       222871639
VRL495       7589       220196298
VRL496       3553       104607998
VRL497       11961      218768419
VRL498       9893       221506786
VRL499       8205       223374631
VRL5         93703      148000355
VRL50        10599      155739470
VRL500       7564       220689086
VRL501       4726       108057147
VRL502       7511       223081384
VRL503       8299       222398571
VRL504       8101       220202874
VRL505       4149       123439470
VRL506       8027       220700155
VRL507       6796       227661702
VRL508       8717       220638558
VRL509       2538       85493862
VRL51        13564      220432006
VRL510       7912       223214869
VRL511       7899       220986313
VRL512       8425       222629769
VRL513       3731       99367929
VRL514       10169      219544958
VRL515       6642       228066074
VRL516       8175       219907523
VRL517       2729       109513216
VRL518       7897       222647445
VRL519       7682       223126034
VRL52        10303      219273588
VRL520       7854       224523045
VRL521       8185       223212060
VRL522       4861       149188001
VRL523       7557       223200900
VRL524       10185      220338740
VRL525       11137      214727615
VRL526       12649      220210262
VRL527       5841       147597877
VRL528       9146       222161694
VRL529       7595       222018105
VRL53        10141      221051064
VRL530       8492       224591233
VRL531       9656       220671867
VRL532       6613       186944744
VRL533       8457       220384699
VRL534       8311       223213284
VRL535       14673      215659693
VRL536       5214       136875926
VRL537       8461       219880376
VRL538       6919       228228204
VRL539       9599       220510600
VRL54        5717       126051635
VRL540       5598       154429438
VRL541       8093       223088984
VRL542       11252      217741019
VRL543       11359      219597513
VRL544       8433       220955110
VRL545       3347       78425589
VRL546       8307       220965274
VRL547       9271       219802436
VRL548       7845       219523528
VRL549       3322       98965193
VRL55        8939       223188128
VRL550       7953       222393200
VRL551       7467       222210471
VRL552       8348       221265923
VRL553       5722       135008521
VRL554       7720       222543943
VRL555       10546      218666004
VRL556       9917       218743123
VRL557       3233       89084000
VRL558       11587      218269910
VRL559       11392      216960165
VRL56        9713       220570663
VRL560       13397      216367079
VRL561       4554       87953553
VRL562       7846       221968091
VRL563       8095       222308164
VRL564       8286       221948131
VRL565       2676       75701368
VRL566       11286      218161494
VRL567       8666       221638187
VRL568       7887       222814678
VRL569       3131       92728532
VRL57        8656       222018563
VRL570       7552       223827538
VRL571       8231       221068394
VRL572       11327      224524150
VRL573       1870       142483056
VRL574       7655       226034803
VRL575       8824       223332449
VRL576       7748       224056325
VRL577       6347       142782761
VRL578       8638       221381322
VRL579       7764       221389049
VRL58        10142      221362831
VRL580       8238       221954265
VRL581       3048       85863223
VRL582       17955      211487595
VRL583       9159       222632787
VRL584       10789      221244148
VRL585       7281       164296143
VRL586       8716       224232745
VRL587       8320       225286626
VRL588       14975      217208979
VRL589       9298       207591354
VRL59        3740       86774371
VRL590       8414       221676540
VRL591       7713       223167026
VRL592       7569       223565650
VRL593       2614       77214433
VRL594       9034       221023881
VRL595       13352      228033735
VRL596       17770      213183584
VRL597       5267       152532865
VRL598       8102       224627599
VRL599       10807      221994697
VRL6         86711      143039034
VRL60        10252      221317455
VRL600       9930       220608391
VRL601       6799       185987498
VRL602       11056      220498934
VRL603       7847       223345777
VRL604       8642       224593760
VRL605       8549       217966640
VRL606       7466       222556773
VRL607       7466       222586657
VRL608       7463       222361587
VRL609       7835       223204716
VRL61        13552      217700285
VRL610       7634       228361748
VRL611       1529       45677843
VRL612       12227      365289108
VRL613       12325      368313892
VRL614       6297       188087927
VRL615       1904       56895892
VRL616       12391      370252025
VRL617       12593      375872798
VRL618       12622      376617188
VRL619       6402       190822693
VRL62        8973       220495159
VRL620       12618      376375108
VRL621       12711      378788647
VRL622       12720      379050405
VRL623       7071       210913275
VRL624       12683      378032374
VRL625       12621      376515872
VRL626       12463      372108084
VRL627       4385       130881012
VRL628       12487      372570636
VRL629       12526      373795899
VRL63        11200      219149341
VRL630       12566      374816528
VRL631       3672       109697863
VRL632       12471      372279880
VRL633       12411      370816826
VRL634       12385      370092114
VRL635       6455       192829868
VRL636       12399      370295335
VRL637       12384      370112732
VRL638       12372      369777172
VRL639       3505       104760027
VRL64        2901       81961587
VRL640       12444      371585092
VRL641       12422      371006390
VRL642       12188      367344437
VRL643       2967       88674279
VRL644       3626       108345075
VRL645       12533      374033673
VRL646       12394      370328985
VRL647       12135      361916853
VRL648       3077       91965120
VRL649       12402      370569546
VRL65        7481       220718827
VRL650       12241      365853241
VRL651       12364      369448773
VRL652       11636      347775069
VRL653       12354      368959568
VRL654       12405      369442683
VRL655       12361      369463614
VRL656       3560       106411167
VRL657       12270      366781694
VRL658       12489      372406490
VRL659       12347      368667305
VRL66        8116       221893665
VRL660       8901       266036794
VRL661       12350      368951698
VRL662       12383      369943743
VRL663       12538      374215279
VRL664       12350      369107637
VRL665       6907       206120230
VRL666       12335      368607449
VRL667       12414      370808444
VRL668       12350      369120146
VRL669       12418      370890906
VRL67        9175       219150853
VRL670       1404       41924092
VRL671       12281      367037689
VRL672       12355      369223656
VRL673       12353      369167640
VRL674       9985       298422907
VRL675       12385      370126990
VRL676       12335      368658957
VRL677       12334      368612870
VRL678       8841       264200894
VRL679       12372      369711446
VRL68        18463      212788176
VRL680       12344      368933144
VRL681       12353      369197678
VRL682       6111       182640523
VRL683       12070      360742551
VRL684       11865      354610114
VRL685       12257      366337685
VRL686       7774       232348838
VRL687       12389      370108432
VRL688       12352      369160805
VRL689       12237      365479875
VRL69        2444       68464306
VRL690       7117       212707893
VRL691       12336      368685684
VRL692       12269      366371284
VRL693       12367      369586431
VRL694       7148       213231773
VRL695       12621      376192384
VRL696       12392      370220839
VRL697       12483      372625354
VRL698       7201       215101258
VRL699       12378      369843501
VRL7         91435      144082435
VRL70        7825       220313598
VRL700       12246      365820026
VRL701       12456      371790520
VRL702       7139       213357797
VRL703       12340      368749870
VRL704       12344      368927014
VRL705       12421      370120372
VRL706       6907       206428316
VRL707       12296      367498256
VRL708       12248      366038633
VRL709       12442      372129165
VRL71        7777       220691622
VRL710       12540      373980303
VRL711       3409       101887034
VRL712       12366      369584171
VRL713       12381      370012499
VRL714       12359      369375604
VRL715       12363      369469223
VRL716       1948       58190281
VRL717       12281      366786435
VRL718       12528      373622973
VRL719       12531      373794912
VRL72        8144       220353623
VRL720       12516      373424280
VRL721       2472       73740642
VRL722       12511      373317579
VRL723       12417      370921926
VRL724       12411      370713753
VRL725       2932       87629297
VRL726       12414      370859460
VRL727       12239      365608522
VRL728       12281      366779971
VRL729       3198       95503906
VRL73        6587       182464490
VRL730       12389      370027978
VRL731       12463      371877239
VRL732       12458      371736014
VRL733       3210       95853682
VRL734       12484      372491339
VRL735       12389      369902373
VRL736       12421      370850328
VRL737       12416      370735519
VRL738       3864       115229529
VRL739       12385      369714210
VRL74        7893       221311927
VRL740       12340      368683545
VRL741       12363      369226423
VRL742       6420       191784589
VRL743       12374      369602677
VRL744       12344      368677922
VRL745       12362      369271877
VRL746       12423      370805020
VRL747       7875       235009520
VRL748       12407      370351983
VRL749       12364      369293567
VRL75        8408       220098191
VRL750       12265      366456082
VRL751       9827       293612294
VRL752       12287      367084198
VRL753       12314      367799365
VRL754       12265      366434093
VRL755       12309      367617260
VRL756       12336      368310951
VRL757       12367      369156641
VRL758       3173       94670275
VRL759       12421      370381742
VRL76        8627       218882918
VRL760       12471      372009482
VRL761       12371      369292216
VRL762       12387      369774056
VRL763       12324      368142839
VRL764       11775      351748607
VRL765       12329      368300282
VRL766       12323      368080815
VRL767       12313      367812242
VRL768       12336      368489238
VRL769       9671       288886614
VRL77        6092       160584138
VRL770       12345      368738853
VRL771       12367      369426509
VRL772       12332      368366126
VRL773       12404      370579163
VRL774       2016       60229555
VRL775       12486      371371422
VRL776       12587      376136321
VRL777       12343      368686816
VRL778       12364      369322928
VRL779       12404      370541402
VRL78        12594      218595173
VRL780       8130       242893704
VRL781       12496      373365842
VRL782       12432      371399948
VRL783       12347      368784251
VRL784       12345      368711538
VRL785       9089       271464899
VRL786       12336      368408718
VRL787       12339      368518437
VRL788       12359      369096817
VRL789       12364      369244387
VRL79        8520       219154612
VRL790       595        17768358
VRL791       12381      369696945
VRL792       12374      369501082
VRL793       12379      369644695
VRL794       12369      369361792
VRL795       559        16693996
VRL796       12369      369334319
VRL797       12319      367883423
VRL798       11977      357823472
VRL799       12189      364090905
VRL8         130929     139336527
VRL80        8507       221330902
VRL800       1157       34548722
VRL801       12410      370392096
VRL802       12353      368814433
VRL803       12368      369260664
VRL804       12369      369253976
VRL805       270        8061056
VRL806       12368      369226825
VRL807       12366      369159314
VRL808       12359      368944008
VRL809       6005       179251803
VRL81        5226       145525714
VRL810       12374      369400888
VRL811       12366      369123428
VRL812       12398      370174224
VRL813       12412      370600813
VRL814       1291       38537124
VRL815       12366      369127168
VRL816       12367      369150031
VRL817       12462      371495742
VRL818       12608      375399077
VRL819       1512       45062470
VRL82        7487       220567461
VRL820       12503      372903703
VRL821       12545      374851085
VRL822       12445      371631592
VRL823       4763       142249867
VRL824       12423      370936414
VRL825       12484      372907724
VRL826       12489      373040331
VRL827       4692       140179365
VRL828       12326      368003805
VRL829       12357      368963039
VRL83        7756       222081311
VRL830       12438      371485547
VRL831       4886       146029693
VRL832       12457      371960700
VRL833       12070      360256200
VRL834       11939      356294173
VRL835       5354       159780884
VRL836       12308      367394797
VRL837       12105      361326031
VRL838       11914      355237809
VRL839       5524       163959206
VRL84        7732       222582376
VRL840       12538      371903410
VRL841       12591      375430613
VRL842       12558      374548591
VRL843       4880       144920184
VRL844       12639      376713378
VRL845       12655      376553425
VRL846       12555      374447869
VRL847       4942       147491721
VRL848       12541      374002589
VRL849       12655      376277562
VRL85        802        19946259
VRL850       12646      376463564
VRL851       12651      376010820
VRL852       12587      375090299
VRL853       5286       157447544
VRL854       12554      373766796
VRL855       12634      376058990
VRL856       12672      376416507
VRL857       9395       280019540
VRL858       12589      375044030
VRL859       12627      376412349
VRL86        8446       221799654
VRL860       12616      375952502
VRL861       2976       88570591
VRL862       12667      377031073
VRL863       12460      371429938
VRL864       12367      369022583
VRL865       7720       230064788
VRL866       12689      377040785
VRL867       12696      377435664
VRL868       12564      375068053
VRL869       12421      370661452
VRL87        7785       221836855
VRL870       12556      374506757
VRL871       12559      375397390
VRL872       1985       59310040
VRL873       12563      375268346
VRL874       12493      373092601
VRL875       12529      376499599
VRL876       7192       214822798
VRL877       12208      364524330
VRL878       11870      354290693
VRL879       12426      366602335
VRL88        7414       220726434
VRL880       12465      372204456
VRL881       4809       143349099
VRL882       12575      375508602
VRL883       12547      374776214
VRL884       12526      374129811
VRL885       12453      371821049
VRL886       3728       111382956
VRL887       12536      374510811
VRL888       12522      373995879
VRL889       12553      375021905
VRL89        3109       82331903
VRL890       12550      374886399
VRL891       12515      373703906
VRL892       45         1343589
VRL893       12373      369521193
VRL894       12333      368446726
VRL895       12422      370851181
VRL896       10550      315017672
VRL897       12459      373079805
VRL898       12419      371360929
VRL899       12428      371345506
VRL9         72920      93402868
VRL90        7987       221802828
VRL900       4986       148899678
VRL901       12242      369489762
VRL902       12317      367592887
VRL903       12174      365156432
VRL904       4053       115032319
VRL905       12703      367485505
VRL906       12532      367814176
VRL907       12762      364368272
VRL908       12516      362023073
VRL909       10180      294970939
VRL91        9309       221496928
VRL910       12261      364246493
VRL911       11983      358129926
VRL912       11992      358281709
VRL913       11970      357626813
VRL914       8265       246937176
VRL915       11985      358078812
VRL916       11989      358195256
VRL917       12156      363313311
VRL918       6489       193957041
VRL919       12177      363891834
VRL92        7844       220504321
VRL920       12137      362741999
VRL921       12131      362590917
VRL922       3657       109292202
VRL923       12028      359490869
VRL924       12169      363409112
VRL925       12161      363033444
VRL926       12058      360081778
VRL927       12080      360896706
VRL928       12014      358872295
VRL929       2730       81547016
VRL93        3528       85483983
VRL930       12189      364192061
VRL931       12163      363192710
VRL932       12165      363203605
VRL933       12155      362921616
VRL934       12158      362938293
VRL935       12161      363091473
VRL936       2684       80138103
VRL937       12166      363165165
VRL938       12166      363241275
VRL939       12170      363353847
VRL94        9354       218773213
VRL940       12156      362931637
VRL941       12160      363069167
VRL942       12172      363405368
VRL943       4051       120940847
VRL944       12163      363155849
VRL945       12161      363080282
VRL946       12159      363040526
VRL947       12167      363291692
VRL948       8121       242458743
VRL949       12179      363588312
VRL95        8380       221630714
VRL950       12288      366296193
VRL951       12230      364766866
VRL952       12230      364839180
VRL953       7809       232891999
VRL954       12517      372202470
VRL955       12317      367134006
VRL956       12282      366448464
VRL957       12249      365463821
VRL958       11793      351737800
VRL959       12265      365816846
VRL96        8451       222830486
VRL960       12500      371907321
VRL961       12723      377505161
VRL962       12719      377463781
VRL963       1201       35640765
VRL964       12717      377511559
VRL965       12723      377863447
VRL966       12726      377938716
VRL967       3902       115891389
VRL968       12724      377690033
VRL969       12722      377704390
VRL97        4324       101854625
VRL970       12688      377181119
VRL971       8598       255311387
VRL972       12713      377435894
VRL973       12711      377421860
VRL974       12708      377276141
VRL975       6966       206828459
VRL976       12717      377598387
VRL977       12717      377605219
VRL978       12708      377503136
VRL979       10992      326518655
VRL98        10034      222284387
VRL980       12705      377463451
VRL981       12735      377938774
VRL982       12744      378176551
VRL983       13984      367703008
VRL984       2008       59965245
VRL985       12178      363611919
VRL986       12170      363294216
VRL987       12171      363366859
VRL988       12170      363344721
VRL989       2448       73171005
VRL99        9769       222928227
VRL990       12085      361231699
VRL991       12148      363137057
VRL992       12247      365877482
VRL993       9052       270368356
VRL994       12257      366107876
VRL995       12195      364314106
VRL996       12197      364373211
VRL997       12196      364347675
VRL998       3888       116150579
VRL999       12203      364552380
VRT1         70113      272305903
VRT10        37396      74041240
VRT100       13         379441801
VRT101       3          70710155
VRT102       16         344076996
VRT103       10         385210617
VRT104       15         392781064
VRT105       22         370094349
VRT106       1          839681426
VRT107       1          825560060
VRT108       1          595904407
VRT109       1          486875112
VRT11        18698      27611025
VRT110       1          387033265
VRT111       1          371528181
VRT112       1          313513962
VRT113       1          277530821
VRT114       1          268302114
VRT115       3          319484498
VRT116       5          386368861
VRT117       7          393936069
VRT118       7          384166854
VRT119       1          46063367
VRT12        5986       380511905
VRT120       7          344525641
VRT121       6          384186008
VRT122       8          388949147
VRT123       332        334400544
VRT124       1          222115097
VRT125       3          377547369
VRT126       10         383496928
VRT127       33         389650655
VRT128       6          59236435
VRT129       1          772932187
VRT13        3363       217068541
VRT130       1          662004353
VRT131       1          535506559
VRT132       1          376147139
VRT133       1          364230008
VRT134       1          346409914
VRT135       1          311292523
VRT136       1          247732340
VRT137       1          228143320
VRT138       1          221182781
VRT139       2          321892640
VRT14        4685       4674270
VRT140       490        332426844
VRT141       12         378048109
VRT142       9          378909870
VRT143       6          345737823
VRT144       2          137693511
VRT145       7          385107928
VRT146       8          360581972
VRT147       10         364952837
VRT148       4          133261911
VRT149       8          359905961
VRT15        1171       26255719
VRT150       5          370674748
VRT151       9          378247816
VRT152       6          166907986
VRT153       14         379842153
VRT154       15         375595384
VRT155       41         289507176
VRT156       11         366984719
VRT157       14         374291772
VRT158       10         185283047
VRT159       1          550518975
VRT16        293        13983146
VRT160       1          529596002
VRT161       1          413748038
VRT162       1          326378286
VRT163       1          272612222
VRT164       1          260396842
VRT165       1          197956435
VRT166       2          384149701
VRT167       2          288058306
VRT168       4          353983664
VRT169       461        371881983
VRT17        37         392789976
VRT170       2          310725315
VRT171       2          280326572
VRT172       3          371471404
VRT173       3          354148189
VRT174       3          303679844
VRT175       4          341249946
VRT176       382        371460784
VRT177       13         392880011
VRT178       13         164097178
VRT179       1          313568160
VRT18        13         392458500
VRT180       1          289498315
VRT181       1          277254249
VRT182       1          244324502
VRT183       1          233859027
VRT184       1          225974235
VRT185       1          211674833
VRT186       1          199962141
VRT187       2          390673241
VRT188       2          334991523
VRT189       2          324316137
VRT19        12         379958897
VRT190       2          292002398
VRT191       1          133841611
VRT192       3          336899598
VRT193       28         389500106
VRT194       6          332993899
VRT195       6          378599539
VRT196       1          47256133
VRT197       6          330076811
VRT198       7          362796652
VRT199       8          365387335
VRT2         72833      271627248
VRT20        11         316368323
VRT200       20         273534543
VRT201       9          378632578
VRT202       11         392575991
VRT203       205        341394663
VRT204       7          347210350
VRT205       7          370650631
VRT206       8          391548385
VRT207       6          385659507
VRT208       7          341110862
VRT209       1          55350661
VRT21        13         385338369
VRT210       8          387616857
VRT211       3          259325358
VRT212       5          392602723
VRT213       41         394037361
VRT214       3          148003845
VRT215       7          387415360
VRT216       7          365756282
VRT217       6          352657526
VRT218       5          346047628
VRT219       2          134650353
VRT22        14         372163844
VRT220       5          356250620
VRT221       6          374573269
VRT222       6          364137996
VRT223       7          343458516
VRT224       2          121348818
VRT225       7          358240592
VRT226       8          383435354
VRT227       8          365970383
VRT228       6          357597984
VRT229       7          355728138
VRT23        14         352781625
VRT230       8          362648569
VRT231       7          390172982
VRT232       8          391413434
VRT233       8          377681388
VRT234       1          42933508
VRT235       100        376541917
VRT236       20         391000381
VRT237       13         383659375
VRT238       58         386123281
VRT239       11         394338841
VRT24        19         384683297
VRT240       11         274288418
VRT241       1          843366180
VRT242       1          842558404
VRT243       1          707956555
VRT244       1          635713434
VRT245       1          567300182
VRT246       1          439630435
VRT247       1          236595445
VRT248       1          231667822
VRT249       2          382351630
VRT25        16         379729070
VRT250       2          103223822
VRT251       1          690654357
VRT252       1          541439571
VRT253       1          495417988
VRT254       1          481763206
VRT255       1          429350720
VRT256       1          224823088
VRT257       1          212589178
VRT258       2          374746477
VRT259       2          318111367
VRT26        16         381718727
VRT260       32         270969991
VRT261       2          352563619
VRT262       7          386835620
VRT263       4317       352826229
VRT264       19         370712563
VRT265       15986      152828107
VRT266       139090     132686980
VRT267       144392     126087358
VRT268       137602     133563190
VRT269       4377       5311641
VRT27        2          51507477
VRT270       127984     142604837
VRT271       129559     142622927
VRT272       117615     155736051
VRT273       1          8842833
VRT274       3          351846198
VRT275       5          374381301
VRT276       16         387558511
VRT277       48         262478695
VRT278       14         376657571
VRT279       16         394062851
VRT28        6          344600068
VRT280       16         377073984
VRT281       8          278699154
VRT282       13         345916081
VRT283       3          386677656
VRT284       5          363840571
VRT285       25         336198071
VRT286       10         365551181
VRT287       392        383359217
VRT288       3          345650541
VRT289       4          347682430
VRT29        7          384846875
VRT290       8          375481157
VRT291       12         376742698
VRT292       33         366827136
VRT293       11         349043615
VRT294       35         386781479
VRT295       3          345588977
VRT296       4          349532575
VRT297       6          304738240
VRT298       7          374752607
VRT299       9          383055365
VRT3         9032       335126292
VRT30        7          359521465
VRT300       13         380263163
VRT301       17         345430885
VRT302       9          382470915
VRT303       10         392600820
VRT304       9          279911807
VRT305       9          254611438
VRT306       4          93451292
VRT307       92         46093787
VRT308       1          427870202
VRT309       1          378320336
VRT31        6          265537261
VRT310       1          361305601
VRT311       1          335235059
VRT312       1          330123935
VRT313       1          263823987
VRT314       2          310916606
VRT315       2          280963255
VRT316       2          253397968
VRT317       5          196338409
VRT318       14         353408674
VRT319       9          362327333
VRT32        2          352172328
VRT320       12         386562662
VRT321       37         393359699
VRT322       1          197209046
VRT323       4          354626559
VRT324       14         388834320
VRT325       19         380393320
VRT326       6          393746332
VRT327       3          88205163
VRT328       142        344732119
VRT329       5          347463485
VRT33        4          299372801
VRT330       7          380950384
VRT331       7          382163289
VRT332       1          41123832
VRT333       1534       370418439
VRT334       13         372631033
VRT335       17         382625440
VRT336       14         376221586
VRT337       27         384724785
VRT338       24         309028163
VRT339       1          359753992
VRT34        33         361630329
VRT340       1          294454259
VRT341       2          339959923
VRT342       4          389503140
VRT343       17         386338679
VRT344       15         391956294
VRT345       9          391549346
VRT346       8          381532502
VRT347       10         359729387
VRT348       16         366027269
VRT349       14         376088571
VRT35        2          87752637
VRT350       7          235869622
VRT351       2          242903655
VRT352       1          103130777
VRT353       2          195276619
VRT354       3          251633161
VRT355       5          300573695
VRT356       66         301934620
VRT357       25         392090725
VRT358       2          90346900
VRT359       10         381757438
VRT36        1          317477549
VRT360       13         384001666
VRT361       18         378998104
VRT362       14         354514736
VRT363       15         389607510
VRT364       7          359846472
VRT365       10         392276936
VRT366       11         351492602
VRT367       12         385397876
VRT368       11         360161366
VRT369       6          387856588
VRT37        1          272440768
VRT370       6          342298758
VRT371       7          364180089
VRT372       6          278597912
VRT373       4          383566318
VRT374       4          341682881
VRT375       5          369366758
VRT376       1          168556870
VRT377       4          366711607
VRT378       12         382161691
VRT379       28         370268341
VRT38        2          394160013
VRT380       16         348486879
VRT381       8          306781019
VRT382       16         388050719
VRT383       11         367388364
VRT384       14         365878669
VRT385       12         375095837
VRT386       1          25932624
VRT387       24         353612648
VRT388       6          369805903
VRT389       7          384607923
VRT39        2          283573173
VRT390       8          368212165
VRT391       5          378213586
VRT392       5          365493039
VRT393       33         331537940
VRT394       2          361339847
VRT395       5          387184689
VRT396       27         349981705
VRT397       2          365371943
VRT398       3          264326299
VRT399       27         376036092
VRT4         3          141387178
VRT40        32         345758883
VRT400       12         388111625
VRT401       15         355427980
VRT402       9          359004013
VRT403       14         370674190
VRT404       6          357293315
VRT405       9          392750267
VRT406       19         345301356
VRT407       2          270081366
VRT408       3          337747199
VRT409       4          372760969
VRT41        147        10842596
VRT410       6          374441870
VRT411       2          91343234
VRT412       12         365458181
VRT413       14         381904327
VRT414       10         379659381
VRT415       12         335882457
VRT416       2          378852029
VRT417       3          278326430
VRT418       13         391321309
VRT419       29         394238386
VRT42        586        15797052
VRT420       11         392187451
VRT421       12         390891610
VRT422       13         390766262
VRT423       12954      217749222
VRT43        2343       67436863
VRT44        19198      357652178
VRT45        54122      304773229
VRT46        158594     137242521
VRT47        18244      13425822
VRT48        117658     200728888
VRT49        84331      68324415
VRT5         8          354279535
VRT50        156211     129530257
VRT51        40549      26960978
VRT52        185409     123431799
VRT53        149926     106560965
VRT54        168326     113454020
VRT55        8513       7300419
VRT56        133023     105741590
VRT57        156324     117904454
VRT58        142331     87481495
VRT59        188485     120062689
VRT6         11         387350249
VRT60        103272     61402986
VRT61        157452     119332741
VRT62        160387     124656392
VRT63        5493       371721645
VRT64        326        389273252
VRT65        1595       387372006
VRT66        93755      270827182
VRT67        145106     21008965
VRT68        75789      25336814
VRT69        13375      365641119
VRT7         11         393947221
VRT70        20         379347618
VRT71        269        392772876
VRT72        3056       391160250
VRT73        3483       231235844
VRT74        6925       378855996
VRT75        16         388667304
VRT76        16         378559418
VRT77        12         379509384
VRT78        7          285874095
VRT79        12         385137967
VRT8         30744      333424138
VRT80        18         367776429
VRT81        16         386329687
VRT82        229        277860126
VRT83        17         367327734
VRT84        15         385834222
VRT85        7          149460915
VRT86        1          356776219
VRT87        1          350268637
VRT88        1          316334699
VRT89        1          337490635
VRT9         74952      70630383
VRT90        1          252032905
VRT91        1          217689105
VRT92        1          199443007
VRT93        1          198537509
VRT94        2          368166310
VRT95        2          330550494
VRT96        1          146904662
VRT97        3          319096504
VRT98        7          379783228
VRT99        11         374771935

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 257.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:

Entries        Bases   Species

8245290 245304919136   Severe acute respiratory syndrome coronavirus 2
1943569 241122072803   Triticum aestivum
1347504 105141444759   Hordeum vulgare subsp. vulgare
10042239 43633416275   Mus musculus
27739496 28249206619   Homo sapiens
29696    21127951584   Avena sativa
168060   20431191316   Escherichia coli
30616    14117890311   Klebsiella pneumoniae
2242920  13454328699   Bos taurus
2640311  13131691282   Arabidopsis thaliana
1732181  12313145490   Danio rerio
195      11554711366   Sambucus nigra
28752    11286166550   Vicia faba
23124     9981579328   Triticum turgidum subsp. durum
4220197   9521188661   Zea mays
44        7650825801   Meconema thalassinum
1279264   7573998711   Drosophila melanogaster
178       7520561155   Avena longiglumis
125       6924307246   Avena insularis
21583     6750948091   Secale cereale

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting. Also note that this table is limited
to 'traditional', non-set-based (WGS/TSA/TLS) GenBank records.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691
   217   Dec 2016   224973060433   198565475
   218   Feb 2017   228719437638   199341377
   219   Apr 2017   231824951552   200877884
   220   Jun 2017   234997362623   201663568
   221   Aug 2017   240343378258   203180606
   222   Oct 2017   244914705468   203953682
   223   Dec 2017   249722163594   206293625
   224   Feb 2018   253630708098   207040555
   225   Apr 2018   260189141631   208452303
   226   Jun 2018   263957884539   209775348
   227   Aug 2018   260806936411   208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
   228   Oct 2018   279668290132   209656636
   229   Dec 2018   285688542186   211281415
   230   Feb 2019   303709510632   212260377
   231   Apr 2019   321680566570   212775414
   232   Jun 2019   329835282370   213383758
   233   Aug 2019   366733917629   213865349
   234   Oct 2019   386197018538   216763706
   235   Dec 2019   388417258009   215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
   236   Feb 2020   399376854872   216214215
   237   Apr 2020   415770027949   216531829
   238   Jun 2020   427823258901   217122233
   239   Aug 2020   654057069549   218642238
   240   Oct 2020   698688094046   219055207
   241   Dec 2020   723003822007   221467827
   242   Feb 2021   776291211106   226241476
   243   Apr 2021   832400799511   227123201
   244   Jun 2021   866009790959   227888889
   245   Aug 2021   940513260726   231982592
   246   Oct 2021  1014763752113   233642893
   247   Dec 2021  1053275115030   234557297
   248   Feb 2022  1173984081721   236338284
   249   Apr 2022  1266154890918   237520318
   250   Jun 2022  1395628631187   239017893
   251   Aug 2022  1492800704497   239915786
   252   Oct 2022  1562963366851   240539282
   253   Dec 2022  1635594138493   241015745
   254   Feb 2023  1731302248418   241830635
   255   Apr 2023  1826746318813   242554936
   256   Jun 2023  1966479976146   243560863
   257   Aug 2023  2112058517945   246119175
   
  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315
  217    Dec 2016  1817189565845   395301176
  218    Feb 2017  1892966308635   409490397
  219    Apr 2017  2035032639807   451840147
  220    Jun 2017  2164683993369   487891767
  221    Aug 2017  2242294609510   499965722
  222    Oct 2017  2318156361999   508825331
  223    Dec 2017  2466098053327   551063065
  224    Feb 2018  2608532210351   564286852
  225    Apr 2018  2784740996536   621379029
  226    Jun 2018  2944617324086   639804105
  227    Aug 2018  3204855013281   665309765
  228    Oct 2018  3444172142207   722438528
  229    Dec 2018  3656719423096   773773190
  230    Feb 2019  4164513961679   945019312
  231    Apr 2019  4421986382065   993732214
  232    Jun 2019  4847677297950  1022913321
  233    Aug 2019  5585922333160  1075272215
  234    Oct 2019  5985250251028  1097629174
  235    Dec 2019  6277551200690  1127023870
  236    Feb 2020  6968991265752  1206720688
  237    Apr 2020  7788133221338  1267547429
  238    Jun 2020  8114046262158  1302852615
  239    Aug 2020  8841649410652  1408122887
  240    Oct 2020  9215815569509  1432874252
  241    Dec 2020 11830842428018  1517995689
  242    Feb 2021 12270717209612  1563938043
  243    Apr 2021 12732048052023  1590670459
  244    Jun 2021 13442974346437  1632796606
  245    Aug 2021 13888187863722  1653427055
  246    Oct 2021 14599101574547  1721064101
  247    Dec 2021 14922033922302  1734664952
  248    Feb 2022 15428122140820  1750505007
  249    Apr 2022 16071520702170  1781374217
  250    Jun 2022 16710373006600  1796349114
  251    Aug 2022 17511809676629  2024099677
  252    Oct 2022 18231960808828  2167900306
  253    Dec 2022 19086596616569  2241439349
  254    Feb 2023 20116642176263  2337838461
  255    Apr 2023 20926504760221  2440470464
  256    Jun 2023 21791125594114  2611654455
  257    Aug 2023 22294446104543  2631493489

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597
  217    Dec 2016   125328824508   142094337
  218    Feb 2017   133517212104   151431485
  219    Apr 2017   149038907599   165068542
  220    Jun 2017   158112969073   176812130
  221    Aug 2017   167045663417   186777106
  222    Oct 2017   172909268535   192754804
  223    Dec 2017   181394660188   201559502
  224    Feb 2018   193940551226   214324264
  225    Apr 2018   205232396043   227364990
  226    Jun 2018   216556686631   238788334
  227    Aug 2018   225520004678   249295386
  228    Oct 2018   235875573598   259927414
  229    Dec 2018   248592892188   274845473
  230    Feb 2019   263936885705   294772430
  231    Apr 2019   277118019688   311247136
  232    Jun 2019   285390240861   319927264
  233    Aug 2019   294727165179   331347807
  234    Oct 2019   305371891408   342811151
  235    Dec 2019   325433016129   367193844
  236    Feb 2020   340994289065   386644871
  237    Apr 2020   349692751528   396392280
  238    Jun 2020   359947709062   409725050
  239    Aug 2020   366968951160   417524567
  240    Oct 2020   382996662270   435968379
  241    Dec 2020   392206975386   446397378
  242    Feb 2021   407605409948   463151000
  243    Apr 2021   425076483459   481154920
  244    Jun 2021   436594941165   494641358
  245    Aug 2021   440578422611   498305045
  246    Oct 2021   449891016597   508319391
  247    Dec 2021   455870853358   514158576
  248    Feb 2022   465013156502   524464601
  249    Apr 2022   474421076448   534770586
  250    Jun 2022   485056129761   546991572
  251    Aug 2022   497501380386   560196830
  252    Oct 2022   511476787957   574020080
  253    Dec 2022   611850391049   649918843
  254    Feb 2023   630615054587   672261981
  255    Apr 2023   636291358227   678332682
  256    Jun 2023   643127590034   683922756
  257    Aug 2023   646176166908   686271945

  The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.

  Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
	  ftp://ftp.ncbi.nih.gov/genbank/tls

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  217    Dec 2016      584697919     1268690
  218    Feb 2017      636923295     1438349
  219    Apr 2017      636923295     1438349  (unchanged)
  220    Jun 2017      824191338     1628475
  221    Aug 2017      824191338     1628475  (unchanged)
  222    Oct 2017     2993818315     9479460
  223    Dec 2017     4458042616    12695198
  224    Feb 2018     4531966831    12819978
  225    Apr 2018     5612769448    14782654
  226    Jun 2018     5896511468    15393041
  227    Aug 2018     6077824493    15822538
  228    Oct 2018     8435112913    20752288
  229    Dec 2018     8511829281    20924588
  230    Feb 2019     9146836085    23259929
  231    Apr 2019     9623321565    24240761
  232    Jun 2019    10182427815    25530139
  233    Aug 2019    10531800829    26363945
  234    Oct 2019    10848455369    27460978
  235    Dec 2019    11280596614    28227180
  236    Feb 2020    13669678196    34037371
  237    Apr 2020    24615270313    65521132
  238    Jun 2020    27500635128    75063181
  239    Aug 2020    27825059498    75682157
  240    Oct 2020    28814798868    78177358
  241    Dec 2020    33036509446    88039152
  242    Feb 2021    33634122995    90130561
  243    Apr 2021    37998534461   102395753
  244    Jun 2021    38198113354   102662929
  245    Aug 2021    39930167315   106995218
  246    Oct 2021    40168874815   107569935
  247    Dec 2021    41143480750   109379021
  248    Feb 2022    41321107981   109809966
  249    Apr 2022    41324192343   109820387
  250    Jun 2022    41999358847   111142107
  251    Aug 2022    43852280645   115103527
  252    Oct 2022    43860512749   115123306
  253    Dec 2022    44009657455   115552377
  254    Feb 2023    46465508548   121067644
  255    Apr 2023    46567924833   121186672
  256    Jun 2023    47302831210   122798571
  257    Aug 2023    48289699026   124421006

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          August 15 2023

                NCBI-GenBank Flat File Release 257.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

  NOTE : Presentation of GI sequence identifiers in the GenBank
  flatfile format was discontinued as of March 2017.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, possibly 'LINEAGE'. But because changes like this can be
   very disruptive for customers, implementation has not yet been scheduled.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

3.4.4.1 : Important notice about parsing the LOCUS line

  Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.

  Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.

  Consider this LOCUS line for a typical complete bacterial genome:

LOCUS       CP032762             5868661 bp    DNA     circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:

LOCUS       AZZZAA02123456789 9999999999 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:

LOCUS       AZZZAA0212345678910000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:

LOCUS       AZZZAA02123456789 10000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.

3.4.4.2 : Data elements of the LOCUS line

  The data elements of the LOCUS line format and their typical/historical
column positions are as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus Name (usually identical to the Accession Number)
29-29      space
30-40      Sequence Length, right-justified
41-41      space
42-43      'bp'
44-44      space
45-47      Strandedness : spaces (if not known), ss- (single-stranded),
           ds- (double-stranded), or ms- (mixed-stranded)
48-53      Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      Molecule Topology : 'linear' followed by two spaces,
           or 'circular'
64-64      space
65-67      Division Code
68-68      space
69-79      Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.

  The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :

LOCUS       HUMPDNRC                 273 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S125 polymorphic dinucleotide repeat.
ACCESSION   L10620

LOCUS       HUMPDNRG                 169 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S114 polymorphic dinucleotide repeat.
ACCESSION   L10624

  But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:

LOCUS       AF035771                1357 bp    mRNA    linear   PRI 30-JUN-1998
DEFINITION  Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
            complete cds.
ACCESSION   AF035771
	    
  The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1
            ^^^^^^^^^^
            Compound  
            Accession.Version
            Number

  A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.

  GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://www.ncbi.nlm.nih.gov/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://www.ncbi.nlm.nih.gov/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://www.ncbi.nlm.nih.gov/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://www.ncbi.nlm.nih.gov/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:

	http://www.insdc.org/documents/feature-table

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.2

3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

  The list of valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.3

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, as of June 2022 the `/exception' qualifier has only four
allowed values: 'RNA editing', 'reasons given in citation', 'rearrangement
required for product', and 'annotated by transcript or proteomic data'.
These are known as controlled vocabulary qualifier values. Controlled
qualifier values are case sensitive.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       KZ271580              141308 bp    DNA     linear   CON 17-AUG-2017
DEFINITION  Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
            O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION   KZ271580 LQNL01000000
VERSION     KZ271580.1
DBLINK      BioProject: PRJNA230512
            BioSample: SAMN04226856
KEYWORDS    WGS; HIGH_QUALITY_DRAFT.
...
     mRNA            complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /product="hypothetical protein"
     CDS             complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="OZC04795.1"
                     /db_xref="GI:1233056989"
                     /translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
                     SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
                     ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
                     TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
                     LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
                     HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
                     LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
                     IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
                     YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
                     AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
                     IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG      join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
            gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Scaffold/CON-division join() sequence


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              [email protected]

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.

  The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address: [email protected] .

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

   Sayers E, Cavanaugh M, Clark K, Ostell J, Pruitt K,
   Karsch-Mizrachi I, "GenBank", Nucleic Acids Research,
   Volume 47, Issue D1, January 2019, pp. D94-D99

   PMID:  30365038
   PMCID: PMC6323954
   DOI:   10.1093/nar/gky989

  The following statement is an example of how one might cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'

  (1) Sayers, E. et al, Nucleic Acids Res. 47(D1):D94-D99 (2019)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: Simply direct your web browser of choice to:

	 http://www.ncbi.nlm.nih.gov/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] .

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Genome Workbench can be used to submit revisions to
previous submissions.  In addition, suggestions and corrections can
be sent by electronic mail to:  [email protected].  Please be
certain to indicate the primary accession number of the entry to which
your comments apply; it is helpful if you also give the entry name and
the current contents of any data field for which you are recommending
a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Andreina Castillo Siri, Larry Chlumsky, Karen Clark,
	Scott Durkin, Michel Eschenbrenner, Michael Fetchko, Linda Frisse,
	Andrea Gocke, Anjanette Johnston, Erica Lam,
	Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Augustus Tilley,
	Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
	Sergiy Gotvyanskyy, Eugene Gribov, Sergei Kalashnikov, Jonathan Kans,
	Leonid Khotomliansky, Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh,
	Alex Kotliarov, Frank Ludwig, Vasuki Palanigobu, Anton Perkov,
	Andriy Petrow, Sergey Petrunin, Dmitrii Saprykin, Wenyao Shi, Denis Sinyakov,
	Thomas Smith, Vladimir Soussov, Vitaly Stakhovsky, Elena Starchenko,
	Hanzhen Sun, Andrei Vereshchagin, Jewen Xiao, Liwei Zhou

Database Administration
	Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
	Benjamin Slade, Constantin Vasilyev

Customer Support
	David Brodsky, Hanguan Liu, Cooper Park, Monica Romiti, Eric Sayers,
	Majda Valjavec-Gratian

Project Direction
	Steve Sherry     : Director, NCBI
	Kim Pruitt       : Branch Chief, NCBI/IEB
	Eugene Yaschenko : Chief Technology Officer, NCBI/IRB

Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894