Release Notes For GenBank Release 258
GBREL.TXT Genetic Sequence Data Bank
October 15 2023
NCBI-GenBank Flat File Release 258.0
Distribution Release Notes
247777761 sequences, 2433391164875 bases, for traditional GenBank records
3607196256 sequences, 24310993199448 bases, for set-based (WGS/TSA/TLS) records
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 258.0
1.2 Cutoff Date
1.3 Important Changes in Release 258.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 258.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use Submission Portal or BankIt for
sending sequence data.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
Email: [email protected]
Updates and changes to existing GenBank records:
https://www.ncbi.nlm.nih.gov/genbank/update/
Email: [email protected]
URLs for GenBank's web-based submission tools:
Submission Portal https://submit.ncbi.nlm.nih.gov/
BankIt https://www.ncbi.nlm.nih.gov/WebSub/
See Section 1.5 for additional details about submitting data to GenBank.
*****************************************************************************
GenBank Release 258.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:
ftp://ftp.ncbi.nih.gov/genbank/wgs
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/tsa
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tls
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
See the README files in those areas for more information.
Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:
ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.
1.2 Cutoff Date
This full release, 258.0, incorporates data processed by the INSDC databases
as of Friday October 27 at 9:22PM EDT. For more recent data, users are
advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotide' database (see Section 6.4 of this document).
1.3 Important Changes in Release 258.0
1.3.1 Organizational changes
The total number of sequence data files for traditional GenBank records
(non-WGS/TSA/TLS) increased by 665 with this release:
- the BCT division is now composed of 1045 files (+35)
- the CON division is now composed of 237 files (+1)
- the ENV division is now composed of 80 files (+1)
- the INV division is now composed of 1862 files (+123)
- the MAM division is now composed of 272 files (+37)
- the PAT division is now composed of 261 files (+1)
- the PHG division is now composed of 7 files (+1)
- the PLN division is now composed of 1647 files (+382)
- the ROD division is now composed of 314 files (+8)
- the VRL division is now composed of 1037 files (+15)
- the VRT division is now composed of 484 files (+61)
1.4 Upcoming Changes
1.4.1 New allowed values for the /country and /collection_date qualifiers
The INSDC will begin to mandate inclusion of /country and /collection_date
for sequence submissions, in alignment with its goal of increasing the number
of sequences for which the origin of a sample can be precisely located in
time and space. This requirement is expected to take effect by the end of
December 2024, and further details can be found at:
https://www.insdc.org/news/insdc-spatiotemporal-metadata-minimum-standards-update-03-03-2023/
Because there are valid circumstances in which the country and/or the
collection date for a sequenced sample cannot be provided, the domain
of allowed values for these two source-feature qualifiers will be expanded
to include a variety of "null terms". They are:
missing
not applicable
not collected
not provided
restricted access
missing: control sample
missing: sample group
missing: synthetic construct
missing: lab stock
missing: third party data
missing: data agreement established pre-2023
missing: endangered species
missing: human-identifiable
The timing for introducing these new values is still uncertain, but the
earliest possible date for their appearance is June 15 2023.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank utilizing the tools summarized below.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. General
information for submitting to Genbank is available online:
https://www.ncbi.nlm.nih.gov/genbank/submit/
To assist researchers in entering their own sequence data, GenBank
provides Web-based submission tools: Submission Portal and Bankit.
Submission Portal https://submit.ncbi.nlm.nih.gov/
BankIt https://www.ncbi.nlm.nih.gov/WebSub/
Submission Portal provides an efficient submission pathway for high
frequency submission types (e.g., 16S rRNA, rRNA-ITS, metazoan COX1,
SARS-CoV-2, etc.).
BankIt is an easy-to-use program that enables authors to enter one
or more sequences, annotate, and submit to GenBank. BankIt provides
a simple forms-based approach for submitting your sequence and the
relevant associated metadata to GenBank.
Genbank also provides submission preparation tools which require uploading
via the Submission Portal or email to [email protected] when relevant:
table2asn: https://www.ncbi.nlm.nih.gov/genbank/table2asn/
table2asn is a command-line program that automates the creation of sequence
records for submission to GenBank. It is used primarily for submission of
complete genomes and large batches of sequences and is available by FTP
for use on MAC, PC and Unix platforms:
https://ftp.ncbi.nlm.nih.gov/asn1-converters/by_program/table2asn/
Genome Workbench offers a rich set of integrated tools for studying
and analyzing genetic data. The Submission Wizard allows you to prepare
submissions of single eukaryotic and prokaryotic genomes. You can also
use Genome Workbench to edit and visualize an ASN.1 file created by table2asn.
Genome Workbench: https://www.ncbi.nlm.nih.gov/tools/gbench/
Through the international collaboration of DNA sequence databases,
GenBank submissions are forwarded daily for inclusion in the European
Nucleotide Archive (ENA) and the DNA Databank of Japan (DDBJ).
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
SEQUIN. As of January 2021, Sequin sequence submissions are no longer
accepted by GenBank, and the Sequin application is no longer distributed
by NCBI. See: https://ncbiinsights.ncbi.nlm.nih.gov/tag/sequin/
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] .
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.
2.2 Files
This GenBank flat file release consists of 8414 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct1000.seq - Bacterial sequence entries, part 1000.
5. gbbct1001.seq - Bacterial sequence entries, part 1001.
6. gbbct1002.seq - Bacterial sequence entries, part 1002.
7. gbbct1003.seq - Bacterial sequence entries, part 1003.
8. gbbct1004.seq - Bacterial sequence entries, part 1004.
9. gbbct1005.seq - Bacterial sequence entries, part 1005.
10. gbbct1006.seq - Bacterial sequence entries, part 1006.
11. gbbct1007.seq - Bacterial sequence entries, part 1007.
12. gbbct1008.seq - Bacterial sequence entries, part 1008.
13. gbbct1009.seq - Bacterial sequence entries, part 1009.
14. gbbct101.seq - Bacterial sequence entries, part 101.
15. gbbct1010.seq - Bacterial sequence entries, part 1010.
16. gbbct1011.seq - Bacterial sequence entries, part 1011.
17. gbbct1012.seq - Bacterial sequence entries, part 1012.
18. gbbct1013.seq - Bacterial sequence entries, part 1013.
19. gbbct1014.seq - Bacterial sequence entries, part 1014.
20. gbbct1015.seq - Bacterial sequence entries, part 1015.
21. gbbct1016.seq - Bacterial sequence entries, part 1016.
22. gbbct1017.seq - Bacterial sequence entries, part 1017.
23. gbbct1018.seq - Bacterial sequence entries, part 1018.
24. gbbct1019.seq - Bacterial sequence entries, part 1019.
25. gbbct102.seq - Bacterial sequence entries, part 102.
26. gbbct1020.seq - Bacterial sequence entries, part 1020.
27. gbbct1021.seq - Bacterial sequence entries, part 1021.
28. gbbct1022.seq - Bacterial sequence entries, part 1022.
29. gbbct1023.seq - Bacterial sequence entries, part 1023.
30. gbbct1024.seq - Bacterial sequence entries, part 1024.
31. gbbct1025.seq - Bacterial sequence entries, part 1025.
32. gbbct1026.seq - Bacterial sequence entries, part 1026.
33. gbbct1027.seq - Bacterial sequence entries, part 1027.
34. gbbct1028.seq - Bacterial sequence entries, part 1028.
35. gbbct1029.seq - Bacterial sequence entries, part 1029.
36. gbbct103.seq - Bacterial sequence entries, part 103.
37. gbbct1030.seq - Bacterial sequence entries, part 1030.
38. gbbct1031.seq - Bacterial sequence entries, part 1031.
39. gbbct1032.seq - Bacterial sequence entries, part 1032.
40. gbbct1033.seq - Bacterial sequence entries, part 1033.
41. gbbct1034.seq - Bacterial sequence entries, part 1034.
42. gbbct1035.seq - Bacterial sequence entries, part 1035.
43. gbbct1036.seq - Bacterial sequence entries, part 1036.
44. gbbct1037.seq - Bacterial sequence entries, part 1037.
45. gbbct1038.seq - Bacterial sequence entries, part 1038.
46. gbbct1039.seq - Bacterial sequence entries, part 1039.
47. gbbct104.seq - Bacterial sequence entries, part 104.
48. gbbct1040.seq - Bacterial sequence entries, part 1040.
49. gbbct1041.seq - Bacterial sequence entries, part 1041.
50. gbbct1042.seq - Bacterial sequence entries, part 1042.
51. gbbct1043.seq - Bacterial sequence entries, part 1043.
52. gbbct1044.seq - Bacterial sequence entries, part 1044.
53. gbbct1045.seq - Bacterial sequence entries, part 1045.
54. gbbct105.seq - Bacterial sequence entries, part 105.
55. gbbct106.seq - Bacterial sequence entries, part 106.
56. gbbct107.seq - Bacterial sequence entries, part 107.
57. gbbct108.seq - Bacterial sequence entries, part 108.
58. gbbct109.seq - Bacterial sequence entries, part 109.
59. gbbct11.seq - Bacterial sequence entries, part 11.
60. gbbct110.seq - Bacterial sequence entries, part 110.
61. gbbct111.seq - Bacterial sequence entries, part 111.
62. gbbct112.seq - Bacterial sequence entries, part 112.
63. gbbct113.seq - Bacterial sequence entries, part 113.
64. gbbct114.seq - Bacterial sequence entries, part 114.
65. gbbct115.seq - Bacterial sequence entries, part 115.
66. gbbct116.seq - Bacterial sequence entries, part 116.
67. gbbct117.seq - Bacterial sequence entries, part 117.
68. gbbct118.seq - Bacterial sequence entries, part 118.
69. gbbct119.seq - Bacterial sequence entries, part 119.
70. gbbct12.seq - Bacterial sequence entries, part 12.
71. gbbct120.seq - Bacterial sequence entries, part 120.
72. gbbct121.seq - Bacterial sequence entries, part 121.
73. gbbct122.seq - Bacterial sequence entries, part 122.
74. gbbct123.seq - Bacterial sequence entries, part 123.
75. gbbct124.seq - Bacterial sequence entries, part 124.
76. gbbct125.seq - Bacterial sequence entries, part 125.
77. gbbct126.seq - Bacterial sequence entries, part 126.
78. gbbct127.seq - Bacterial sequence entries, part 127.
79. gbbct128.seq - Bacterial sequence entries, part 128.
80. gbbct129.seq - Bacterial sequence entries, part 129.
81. gbbct13.seq - Bacterial sequence entries, part 13.
82. gbbct130.seq - Bacterial sequence entries, part 130.
83. gbbct131.seq - Bacterial sequence entries, part 131.
84. gbbct132.seq - Bacterial sequence entries, part 132.
85. gbbct133.seq - Bacterial sequence entries, part 133.
86. gbbct134.seq - Bacterial sequence entries, part 134.
87. gbbct135.seq - Bacterial sequence entries, part 135.
88. gbbct136.seq - Bacterial sequence entries, part 136.
89. gbbct137.seq - Bacterial sequence entries, part 137.
90. gbbct138.seq - Bacterial sequence entries, part 138.
91. gbbct139.seq - Bacterial sequence entries, part 139.
92. gbbct14.seq - Bacterial sequence entries, part 14.
93. gbbct140.seq - Bacterial sequence entries, part 140.
94. gbbct141.seq - Bacterial sequence entries, part 141.
95. gbbct142.seq - Bacterial sequence entries, part 142.
96. gbbct143.seq - Bacterial sequence entries, part 143.
97. gbbct144.seq - Bacterial sequence entries, part 144.
98. gbbct145.seq - Bacterial sequence entries, part 145.
99. gbbct146.seq - Bacterial sequence entries, part 146.
100. gbbct147.seq - Bacterial sequence entries, part 147.
101. gbbct148.seq - Bacterial sequence entries, part 148.
102. gbbct149.seq - Bacterial sequence entries, part 149.
103. gbbct15.seq - Bacterial sequence entries, part 15.
104. gbbct150.seq - Bacterial sequence entries, part 150.
105. gbbct151.seq - Bacterial sequence entries, part 151.
106. gbbct152.seq - Bacterial sequence entries, part 152.
107. gbbct153.seq - Bacterial sequence entries, part 153.
108. gbbct154.seq - Bacterial sequence entries, part 154.
109. gbbct155.seq - Bacterial sequence entries, part 155.
110. gbbct156.seq - Bacterial sequence entries, part 156.
111. gbbct157.seq - Bacterial sequence entries, part 157.
112. gbbct158.seq - Bacterial sequence entries, part 158.
113. gbbct159.seq - Bacterial sequence entries, part 159.
114. gbbct16.seq - Bacterial sequence entries, part 16.
115. gbbct160.seq - Bacterial sequence entries, part 160.
116. gbbct161.seq - Bacterial sequence entries, part 161.
117. gbbct162.seq - Bacterial sequence entries, part 162.
118. gbbct163.seq - Bacterial sequence entries, part 163.
119. gbbct164.seq - Bacterial sequence entries, part 164.
120. gbbct165.seq - Bacterial sequence entries, part 165.
121. gbbct166.seq - Bacterial sequence entries, part 166.
122. gbbct167.seq - Bacterial sequence entries, part 167.
123. gbbct168.seq - Bacterial sequence entries, part 168.
124. gbbct169.seq - Bacterial sequence entries, part 169.
125. gbbct17.seq - Bacterial sequence entries, part 17.
126. gbbct170.seq - Bacterial sequence entries, part 170.
127. gbbct171.seq - Bacterial sequence entries, part 171.
128. gbbct172.seq - Bacterial sequence entries, part 172.
129. gbbct173.seq - Bacterial sequence entries, part 173.
130. gbbct174.seq - Bacterial sequence entries, part 174.
131. gbbct175.seq - Bacterial sequence entries, part 175.
132. gbbct176.seq - Bacterial sequence entries, part 176.
133. gbbct177.seq - Bacterial sequence entries, part 177.
134. gbbct178.seq - Bacterial sequence entries, part 178.
135. gbbct179.seq - Bacterial sequence entries, part 179.
136. gbbct18.seq - Bacterial sequence entries, part 18.
137. gbbct180.seq - Bacterial sequence entries, part 180.
138. gbbct181.seq - Bacterial sequence entries, part 181.
139. gbbct182.seq - Bacterial sequence entries, part 182.
140. gbbct183.seq - Bacterial sequence entries, part 183.
141. gbbct184.seq - Bacterial sequence entries, part 184.
142. gbbct185.seq - Bacterial sequence entries, part 185.
143. gbbct186.seq - Bacterial sequence entries, part 186.
144. gbbct187.seq - Bacterial sequence entries, part 187.
145. gbbct188.seq - Bacterial sequence entries, part 188.
146. gbbct189.seq - Bacterial sequence entries, part 189.
147. gbbct19.seq - Bacterial sequence entries, part 19.
148. gbbct190.seq - Bacterial sequence entries, part 190.
149. gbbct191.seq - Bacterial sequence entries, part 191.
150. gbbct192.seq - Bacterial sequence entries, part 192.
151. gbbct193.seq - Bacterial sequence entries, part 193.
152. gbbct194.seq - Bacterial sequence entries, part 194.
153. gbbct195.seq - Bacterial sequence entries, part 195.
154. gbbct196.seq - Bacterial sequence entries, part 196.
155. gbbct197.seq - Bacterial sequence entries, part 197.
156. gbbct198.seq - Bacterial sequence entries, part 198.
157. gbbct199.seq - Bacterial sequence entries, part 199.
158. gbbct2.seq - Bacterial sequence entries, part 2.
159. gbbct20.seq - Bacterial sequence entries, part 20.
160. gbbct200.seq - Bacterial sequence entries, part 200.
161. gbbct201.seq - Bacterial sequence entries, part 201.
162. gbbct202.seq - Bacterial sequence entries, part 202.
163. gbbct203.seq - Bacterial sequence entries, part 203.
164. gbbct204.seq - Bacterial sequence entries, part 204.
165. gbbct205.seq - Bacterial sequence entries, part 205.
166. gbbct206.seq - Bacterial sequence entries, part 206.
167. gbbct207.seq - Bacterial sequence entries, part 207.
168. gbbct208.seq - Bacterial sequence entries, part 208.
169. gbbct209.seq - Bacterial sequence entries, part 209.
170. gbbct21.seq - Bacterial sequence entries, part 21.
171. gbbct210.seq - Bacterial sequence entries, part 210.
172. gbbct211.seq - Bacterial sequence entries, part 211.
173. gbbct212.seq - Bacterial sequence entries, part 212.
174. gbbct213.seq - Bacterial sequence entries, part 213.
175. gbbct214.seq - Bacterial sequence entries, part 214.
176. gbbct215.seq - Bacterial sequence entries, part 215.
177. gbbct216.seq - Bacterial sequence entries, part 216.
178. gbbct217.seq - Bacterial sequence entries, part 217.
179. gbbct218.seq - Bacterial sequence entries, part 218.
180. gbbct219.seq - Bacterial sequence entries, part 219.
181. gbbct22.seq - Bacterial sequence entries, part 22.
182. gbbct220.seq - Bacterial sequence entries, part 220.
183. gbbct221.seq - Bacterial sequence entries, part 221.
184. gbbct222.seq - Bacterial sequence entries, part 222.
185. gbbct223.seq - Bacterial sequence entries, part 223.
186. gbbct224.seq - Bacterial sequence entries, part 224.
187. gbbct225.seq - Bacterial sequence entries, part 225.
188. gbbct226.seq - Bacterial sequence entries, part 226.
189. gbbct227.seq - Bacterial sequence entries, part 227.
190. gbbct228.seq - Bacterial sequence entries, part 228.
191. gbbct229.seq - Bacterial sequence entries, part 229.
192. gbbct23.seq - Bacterial sequence entries, part 23.
193. gbbct230.seq - Bacterial sequence entries, part 230.
194. gbbct231.seq - Bacterial sequence entries, part 231.
195. gbbct232.seq - Bacterial sequence entries, part 232.
196. gbbct233.seq - Bacterial sequence entries, part 233.
197. gbbct234.seq - Bacterial sequence entries, part 234.
198. gbbct235.seq - Bacterial sequence entries, part 235.
199. gbbct236.seq - Bacterial sequence entries, part 236.
200. gbbct237.seq - Bacterial sequence entries, part 237.
201. gbbct238.seq - Bacterial sequence entries, part 238.
202. gbbct239.seq - Bacterial sequence entries, part 239.
203. gbbct24.seq - Bacterial sequence entries, part 24.
204. gbbct240.seq - Bacterial sequence entries, part 240.
205. gbbct241.seq - Bacterial sequence entries, part 241.
206. gbbct242.seq - Bacterial sequence entries, part 242.
207. gbbct243.seq - Bacterial sequence entries, part 243.
208. gbbct244.seq - Bacterial sequence entries, part 244.
209. gbbct245.seq - Bacterial sequence entries, part 245.
210. gbbct246.seq - Bacterial sequence entries, part 246.
211. gbbct247.seq - Bacterial sequence entries, part 247.
212. gbbct248.seq - Bacterial sequence entries, part 248.
213. gbbct249.seq - Bacterial sequence entries, part 249.
214. gbbct25.seq - Bacterial sequence entries, part 25.
215. gbbct250.seq - Bacterial sequence entries, part 250.
216. gbbct251.seq - Bacterial sequence entries, part 251.
217. gbbct252.seq - Bacterial sequence entries, part 252.
218. gbbct253.seq - Bacterial sequence entries, part 253.
219. gbbct254.seq - Bacterial sequence entries, part 254.
220. gbbct255.seq - Bacterial sequence entries, part 255.
221. gbbct256.seq - Bacterial sequence entries, part 256.
222. gbbct257.seq - Bacterial sequence entries, part 257.
223. gbbct258.seq - Bacterial sequence entries, part 258.
224. gbbct259.seq - Bacterial sequence entries, part 259.
225. gbbct26.seq - Bacterial sequence entries, part 26.
226. gbbct260.seq - Bacterial sequence entries, part 260.
227. gbbct261.seq - Bacterial sequence entries, part 261.
228. gbbct262.seq - Bacterial sequence entries, part 262.
229. gbbct263.seq - Bacterial sequence entries, part 263.
230. gbbct264.seq - Bacterial sequence entries, part 264.
231. gbbct265.seq - Bacterial sequence entries, part 265.
232. gbbct266.seq - Bacterial sequence entries, part 266.
233. gbbct267.seq - Bacterial sequence entries, part 267.
234. gbbct268.seq - Bacterial sequence entries, part 268.
235. gbbct269.seq - Bacterial sequence entries, part 269.
236. gbbct27.seq - Bacterial sequence entries, part 27.
237. gbbct270.seq - Bacterial sequence entries, part 270.
238. gbbct271.seq - Bacterial sequence entries, part 271.
239. gbbct272.seq - Bacterial sequence entries, part 272.
240. gbbct273.seq - Bacterial sequence entries, part 273.
241. gbbct274.seq - Bacterial sequence entries, part 274.
242. gbbct275.seq - Bacterial sequence entries, part 275.
243. gbbct276.seq - Bacterial sequence entries, part 276.
244. gbbct277.seq - Bacterial sequence entries, part 277.
245. gbbct278.seq - Bacterial sequence entries, part 278.
246. gbbct279.seq - Bacterial sequence entries, part 279.
247. gbbct28.seq - Bacterial sequence entries, part 28.
248. gbbct280.seq - Bacterial sequence entries, part 280.
249. gbbct281.seq - Bacterial sequence entries, part 281.
250. gbbct282.seq - Bacterial sequence entries, part 282.
251. gbbct283.seq - Bacterial sequence entries, part 283.
252. gbbct284.seq - Bacterial sequence entries, part 284.
253. gbbct285.seq - Bacterial sequence entries, part 285.
254. gbbct286.seq - Bacterial sequence entries, part 286.
255. gbbct287.seq - Bacterial sequence entries, part 287.
256. gbbct288.seq - Bacterial sequence entries, part 288.
257. gbbct289.seq - Bacterial sequence entries, part 289.
258. gbbct29.seq - Bacterial sequence entries, part 29.
259. gbbct290.seq - Bacterial sequence entries, part 290.
260. gbbct291.seq - Bacterial sequence entries, part 291.
261. gbbct292.seq - Bacterial sequence entries, part 292.
262. gbbct293.seq - Bacterial sequence entries, part 293.
263. gbbct294.seq - Bacterial sequence entries, part 294.
264. gbbct295.seq - Bacterial sequence entries, part 295.
265. gbbct296.seq - Bacterial sequence entries, part 296.
266. gbbct297.seq - Bacterial sequence entries, part 297.
267. gbbct298.seq - Bacterial sequence entries, part 298.
268. gbbct299.seq - Bacterial sequence entries, part 299.
269. gbbct3.seq - Bacterial sequence entries, part 3.
270. gbbct30.seq - Bacterial sequence entries, part 30.
271. gbbct300.seq - Bacterial sequence entries, part 300.
272. gbbct301.seq - Bacterial sequence entries, part 301.
273. gbbct302.seq - Bacterial sequence entries, part 302.
274. gbbct303.seq - Bacterial sequence entries, part 303.
275. gbbct304.seq - Bacterial sequence entries, part 304.
276. gbbct305.seq - Bacterial sequence entries, part 305.
277. gbbct306.seq - Bacterial sequence entries, part 306.
278. gbbct307.seq - Bacterial sequence entries, part 307.
279. gbbct308.seq - Bacterial sequence entries, part 308.
280. gbbct309.seq - Bacterial sequence entries, part 309.
281. gbbct31.seq - Bacterial sequence entries, part 31.
282. gbbct310.seq - Bacterial sequence entries, part 310.
283. gbbct311.seq - Bacterial sequence entries, part 311.
284. gbbct312.seq - Bacterial sequence entries, part 312.
285. gbbct313.seq - Bacterial sequence entries, part 313.
286. gbbct314.seq - Bacterial sequence entries, part 314.
287. gbbct315.seq - Bacterial sequence entries, part 315.
288. gbbct316.seq - Bacterial sequence entries, part 316.
289. gbbct317.seq - Bacterial sequence entries, part 317.
290. gbbct318.seq - Bacterial sequence entries, part 318.
291. gbbct319.seq - Bacterial sequence entries, part 319.
292. gbbct32.seq - Bacterial sequence entries, part 32.
293. gbbct320.seq - Bacterial sequence entries, part 320.
294. gbbct321.seq - Bacterial sequence entries, part 321.
295. gbbct322.seq - Bacterial sequence entries, part 322.
296. gbbct323.seq - Bacterial sequence entries, part 323.
297. gbbct324.seq - Bacterial sequence entries, part 324.
298. gbbct325.seq - Bacterial sequence entries, part 325.
299. gbbct326.seq - Bacterial sequence entries, part 326.
300. gbbct327.seq - Bacterial sequence entries, part 327.
301. gbbct328.seq - Bacterial sequence entries, part 328.
302. gbbct329.seq - Bacterial sequence entries, part 329.
303. gbbct33.seq - Bacterial sequence entries, part 33.
304. gbbct330.seq - Bacterial sequence entries, part 330.
305. gbbct331.seq - Bacterial sequence entries, part 331.
306. gbbct332.seq - Bacterial sequence entries, part 332.
307. gbbct333.seq - Bacterial sequence entries, part 333.
308. gbbct334.seq - Bacterial sequence entries, part 334.
309. gbbct335.seq - Bacterial sequence entries, part 335.
310. gbbct336.seq - Bacterial sequence entries, part 336.
311. gbbct337.seq - Bacterial sequence entries, part 337.
312. gbbct338.seq - Bacterial sequence entries, part 338.
313. gbbct339.seq - Bacterial sequence entries, part 339.
314. gbbct34.seq - Bacterial sequence entries, part 34.
315. gbbct340.seq - Bacterial sequence entries, part 340.
316. gbbct341.seq - Bacterial sequence entries, part 341.
317. gbbct342.seq - Bacterial sequence entries, part 342.
318. gbbct343.seq - Bacterial sequence entries, part 343.
319. gbbct344.seq - Bacterial sequence entries, part 344.
320. gbbct345.seq - Bacterial sequence entries, part 345.
321. gbbct346.seq - Bacterial sequence entries, part 346.
322. gbbct347.seq - Bacterial sequence entries, part 347.
323. gbbct348.seq - Bacterial sequence entries, part 348.
324. gbbct349.seq - Bacterial sequence entries, part 349.
325. gbbct35.seq - Bacterial sequence entries, part 35.
326. gbbct350.seq - Bacterial sequence entries, part 350.
327. gbbct351.seq - Bacterial sequence entries, part 351.
328. gbbct352.seq - Bacterial sequence entries, part 352.
329. gbbct353.seq - Bacterial sequence entries, part 353.
330. gbbct354.seq - Bacterial sequence entries, part 354.
331. gbbct355.seq - Bacterial sequence entries, part 355.
332. gbbct356.seq - Bacterial sequence entries, part 356.
333. gbbct357.seq - Bacterial sequence entries, part 357.
334. gbbct358.seq - Bacterial sequence entries, part 358.
335. gbbct359.seq - Bacterial sequence entries, part 359.
336. gbbct36.seq - Bacterial sequence entries, part 36.
337. gbbct360.seq - Bacterial sequence entries, part 360.
338. gbbct361.seq - Bacterial sequence entries, part 361.
339. gbbct362.seq - Bacterial sequence entries, part 362.
340. gbbct363.seq - Bacterial sequence entries, part 363.
341. gbbct364.seq - Bacterial sequence entries, part 364.
342. gbbct365.seq - Bacterial sequence entries, part 365.
343. gbbct366.seq - Bacterial sequence entries, part 366.
344. gbbct367.seq - Bacterial sequence entries, part 367.
345. gbbct368.seq - Bacterial sequence entries, part 368.
346. gbbct369.seq - Bacterial sequence entries, part 369.
347. gbbct37.seq - Bacterial sequence entries, part 37.
348. gbbct370.seq - Bacterial sequence entries, part 370.
349. gbbct371.seq - Bacterial sequence entries, part 371.
350. gbbct372.seq - Bacterial sequence entries, part 372.
351. gbbct373.seq - Bacterial sequence entries, part 373.
352. gbbct374.seq - Bacterial sequence entries, part 374.
353. gbbct375.seq - Bacterial sequence entries, part 375.
354. gbbct376.seq - Bacterial sequence entries, part 376.
355. gbbct377.seq - Bacterial sequence entries, part 377.
356. gbbct378.seq - Bacterial sequence entries, part 378.
357. gbbct379.seq - Bacterial sequence entries, part 379.
358. gbbct38.seq - Bacterial sequence entries, part 38.
359. gbbct380.seq - Bacterial sequence entries, part 380.
360. gbbct381.seq - Bacterial sequence entries, part 381.
361. gbbct382.seq - Bacterial sequence entries, part 382.
362. gbbct383.seq - Bacterial sequence entries, part 383.
363. gbbct384.seq - Bacterial sequence entries, part 384.
364. gbbct385.seq - Bacterial sequence entries, part 385.
365. gbbct386.seq - Bacterial sequence entries, part 386.
366. gbbct387.seq - Bacterial sequence entries, part 387.
367. gbbct388.seq - Bacterial sequence entries, part 388.
368. gbbct389.seq - Bacterial sequence entries, part 389.
369. gbbct39.seq - Bacterial sequence entries, part 39.
370. gbbct390.seq - Bacterial sequence entries, part 390.
371. gbbct391.seq - Bacterial sequence entries, part 391.
372. gbbct392.seq - Bacterial sequence entries, part 392.
373. gbbct393.seq - Bacterial sequence entries, part 393.
374. gbbct394.seq - Bacterial sequence entries, part 394.
375. gbbct395.seq - Bacterial sequence entries, part 395.
376. gbbct396.seq - Bacterial sequence entries, part 396.
377. gbbct397.seq - Bacterial sequence entries, part 397.
378. gbbct398.seq - Bacterial sequence entries, part 398.
379. gbbct399.seq - Bacterial sequence entries, part 399.
380. gbbct4.seq - Bacterial sequence entries, part 4.
381. gbbct40.seq - Bacterial sequence entries, part 40.
382. gbbct400.seq - Bacterial sequence entries, part 400.
383. gbbct401.seq - Bacterial sequence entries, part 401.
384. gbbct402.seq - Bacterial sequence entries, part 402.
385. gbbct403.seq - Bacterial sequence entries, part 403.
386. gbbct404.seq - Bacterial sequence entries, part 404.
387. gbbct405.seq - Bacterial sequence entries, part 405.
388. gbbct406.seq - Bacterial sequence entries, part 406.
389. gbbct407.seq - Bacterial sequence entries, part 407.
390. gbbct408.seq - Bacterial sequence entries, part 408.
391. gbbct409.seq - Bacterial sequence entries, part 409.
392. gbbct41.seq - Bacterial sequence entries, part 41.
393. gbbct410.seq - Bacterial sequence entries, part 410.
394. gbbct411.seq - Bacterial sequence entries, part 411.
395. gbbct412.seq - Bacterial sequence entries, part 412.
396. gbbct413.seq - Bacterial sequence entries, part 413.
397. gbbct414.seq - Bacterial sequence entries, part 414.
398. gbbct415.seq - Bacterial sequence entries, part 415.
399. gbbct416.seq - Bacterial sequence entries, part 416.
400. gbbct417.seq - Bacterial sequence entries, part 417.
401. gbbct418.seq - Bacterial sequence entries, part 418.
402. gbbct419.seq - Bacterial sequence entries, part 419.
403. gbbct42.seq - Bacterial sequence entries, part 42.
404. gbbct420.seq - Bacterial sequence entries, part 420.
405. gbbct421.seq - Bacterial sequence entries, part 421.
406. gbbct422.seq - Bacterial sequence entries, part 422.
407. gbbct423.seq - Bacterial sequence entries, part 423.
408. gbbct424.seq - Bacterial sequence entries, part 424.
409. gbbct425.seq - Bacterial sequence entries, part 425.
410. gbbct426.seq - Bacterial sequence entries, part 426.
411. gbbct427.seq - Bacterial sequence entries, part 427.
412. gbbct428.seq - Bacterial sequence entries, part 428.
413. gbbct429.seq - Bacterial sequence entries, part 429.
414. gbbct43.seq - Bacterial sequence entries, part 43.
415. gbbct430.seq - Bacterial sequence entries, part 430.
416. gbbct431.seq - Bacterial sequence entries, part 431.
417. gbbct432.seq - Bacterial sequence entries, part 432.
418. gbbct433.seq - Bacterial sequence entries, part 433.
419. gbbct434.seq - Bacterial sequence entries, part 434.
420. gbbct435.seq - Bacterial sequence entries, part 435.
421. gbbct436.seq - Bacterial sequence entries, part 436.
422. gbbct437.seq - Bacterial sequence entries, part 437.
423. gbbct438.seq - Bacterial sequence entries, part 438.
424. gbbct439.seq - Bacterial sequence entries, part 439.
425. gbbct44.seq - Bacterial sequence entries, part 44.
426. gbbct440.seq - Bacterial sequence entries, part 440.
427. gbbct441.seq - Bacterial sequence entries, part 441.
428. gbbct442.seq - Bacterial sequence entries, part 442.
429. gbbct443.seq - Bacterial sequence entries, part 443.
430. gbbct444.seq - Bacterial sequence entries, part 444.
431. gbbct445.seq - Bacterial sequence entries, part 445.
432. gbbct446.seq - Bacterial sequence entries, part 446.
433. gbbct447.seq - Bacterial sequence entries, part 447.
434. gbbct448.seq - Bacterial sequence entries, part 448.
435. gbbct449.seq - Bacterial sequence entries, part 449.
436. gbbct45.seq - Bacterial sequence entries, part 45.
437. gbbct450.seq - Bacterial sequence entries, part 450.
438. gbbct451.seq - Bacterial sequence entries, part 451.
439. gbbct452.seq - Bacterial sequence entries, part 452.
440. gbbct453.seq - Bacterial sequence entries, part 453.
441. gbbct454.seq - Bacterial sequence entries, part 454.
442. gbbct455.seq - Bacterial sequence entries, part 455.
443. gbbct456.seq - Bacterial sequence entries, part 456.
444. gbbct457.seq - Bacterial sequence entries, part 457.
445. gbbct458.seq - Bacterial sequence entries, part 458.
446. gbbct459.seq - Bacterial sequence entries, part 459.
447. gbbct46.seq - Bacterial sequence entries, part 46.
448. gbbct460.seq - Bacterial sequence entries, part 460.
449. gbbct461.seq - Bacterial sequence entries, part 461.
450. gbbct462.seq - Bacterial sequence entries, part 462.
451. gbbct463.seq - Bacterial sequence entries, part 463.
452. gbbct464.seq - Bacterial sequence entries, part 464.
453. gbbct465.seq - Bacterial sequence entries, part 465.
454. gbbct466.seq - Bacterial sequence entries, part 466.
455. gbbct467.seq - Bacterial sequence entries, part 467.
456. gbbct468.seq - Bacterial sequence entries, part 468.
457. gbbct469.seq - Bacterial sequence entries, part 469.
458. gbbct47.seq - Bacterial sequence entries, part 47.
459. gbbct470.seq - Bacterial sequence entries, part 470.
460. gbbct471.seq - Bacterial sequence entries, part 471.
461. gbbct472.seq - Bacterial sequence entries, part 472.
462. gbbct473.seq - Bacterial sequence entries, part 473.
463. gbbct474.seq - Bacterial sequence entries, part 474.
464. gbbct475.seq - Bacterial sequence entries, part 475.
465. gbbct476.seq - Bacterial sequence entries, part 476.
466. gbbct477.seq - Bacterial sequence entries, part 477.
467. gbbct478.seq - Bacterial sequence entries, part 478.
468. gbbct479.seq - Bacterial sequence entries, part 479.
469. gbbct48.seq - Bacterial sequence entries, part 48.
470. gbbct480.seq - Bacterial sequence entries, part 480.
471. gbbct481.seq - Bacterial sequence entries, part 481.
472. gbbct482.seq - Bacterial sequence entries, part 482.
473. gbbct483.seq - Bacterial sequence entries, part 483.
474. gbbct484.seq - Bacterial sequence entries, part 484.
475. gbbct485.seq - Bacterial sequence entries, part 485.
476. gbbct486.seq - Bacterial sequence entries, part 486.
477. gbbct487.seq - Bacterial sequence entries, part 487.
478. gbbct488.seq - Bacterial sequence entries, part 488.
479. gbbct489.seq - Bacterial sequence entries, part 489.
480. gbbct49.seq - Bacterial sequence entries, part 49.
481. gbbct490.seq - Bacterial sequence entries, part 490.
482. gbbct491.seq - Bacterial sequence entries, part 491.
483. gbbct492.seq - Bacterial sequence entries, part 492.
484. gbbct493.seq - Bacterial sequence entries, part 493.
485. gbbct494.seq - Bacterial sequence entries, part 494.
486. gbbct495.seq - Bacterial sequence entries, part 495.
487. gbbct496.seq - Bacterial sequence entries, part 496.
488. gbbct497.seq - Bacterial sequence entries, part 497.
489. gbbct498.seq - Bacterial sequence entries, part 498.
490. gbbct499.seq - Bacterial sequence entries, part 499.
491. gbbct5.seq - Bacterial sequence entries, part 5.
492. gbbct50.seq - Bacterial sequence entries, part 50.
493. gbbct500.seq - Bacterial sequence entries, part 500.
494. gbbct501.seq - Bacterial sequence entries, part 501.
495. gbbct502.seq - Bacterial sequence entries, part 502.
496. gbbct503.seq - Bacterial sequence entries, part 503.
497. gbbct504.seq - Bacterial sequence entries, part 504.
498. gbbct505.seq - Bacterial sequence entries, part 505.
499. gbbct506.seq - Bacterial sequence entries, part 506.
500. gbbct507.seq - Bacterial sequence entries, part 507.
501. gbbct508.seq - Bacterial sequence entries, part 508.
502. gbbct509.seq - Bacterial sequence entries, part 509.
503. gbbct51.seq - Bacterial sequence entries, part 51.
504. gbbct510.seq - Bacterial sequence entries, part 510.
505. gbbct511.seq - Bacterial sequence entries, part 511.
506. gbbct512.seq - Bacterial sequence entries, part 512.
507. gbbct513.seq - Bacterial sequence entries, part 513.
508. gbbct514.seq - Bacterial sequence entries, part 514.
509. gbbct515.seq - Bacterial sequence entries, part 515.
510. gbbct516.seq - Bacterial sequence entries, part 516.
511. gbbct517.seq - Bacterial sequence entries, part 517.
512. gbbct518.seq - Bacterial sequence entries, part 518.
513. gbbct519.seq - Bacterial sequence entries, part 519.
514. gbbct52.seq - Bacterial sequence entries, part 52.
515. gbbct520.seq - Bacterial sequence entries, part 520.
516. gbbct521.seq - Bacterial sequence entries, part 521.
517. gbbct522.seq - Bacterial sequence entries, part 522.
518. gbbct523.seq - Bacterial sequence entries, part 523.
519. gbbct524.seq - Bacterial sequence entries, part 524.
520. gbbct525.seq - Bacterial sequence entries, part 525.
521. gbbct526.seq - Bacterial sequence entries, part 526.
522. gbbct527.seq - Bacterial sequence entries, part 527.
523. gbbct528.seq - Bacterial sequence entries, part 528.
524. gbbct529.seq - Bacterial sequence entries, part 529.
525. gbbct53.seq - Bacterial sequence entries, part 53.
526. gbbct530.seq - Bacterial sequence entries, part 530.
527. gbbct531.seq - Bacterial sequence entries, part 531.
528. gbbct532.seq - Bacterial sequence entries, part 532.
529. gbbct533.seq - Bacterial sequence entries, part 533.
530. gbbct534.seq - Bacterial sequence entries, part 534.
531. gbbct535.seq - Bacterial sequence entries, part 535.
532. gbbct536.seq - Bacterial sequence entries, part 536.
533. gbbct537.seq - Bacterial sequence entries, part 537.
534. gbbct538.seq - Bacterial sequence entries, part 538.
535. gbbct539.seq - Bacterial sequence entries, part 539.
536. gbbct54.seq - Bacterial sequence entries, part 54.
537. gbbct540.seq - Bacterial sequence entries, part 540.
538. gbbct541.seq - Bacterial sequence entries, part 541.
539. gbbct542.seq - Bacterial sequence entries, part 542.
540. gbbct543.seq - Bacterial sequence entries, part 543.
541. gbbct544.seq - Bacterial sequence entries, part 544.
542. gbbct545.seq - Bacterial sequence entries, part 545.
543. gbbct546.seq - Bacterial sequence entries, part 546.
544. gbbct547.seq - Bacterial sequence entries, part 547.
545. gbbct548.seq - Bacterial sequence entries, part 548.
546. gbbct549.seq - Bacterial sequence entries, part 549.
547. gbbct55.seq - Bacterial sequence entries, part 55.
548. gbbct550.seq - Bacterial sequence entries, part 550.
549. gbbct551.seq - Bacterial sequence entries, part 551.
550. gbbct552.seq - Bacterial sequence entries, part 552.
551. gbbct553.seq - Bacterial sequence entries, part 553.
552. gbbct554.seq - Bacterial sequence entries, part 554.
553. gbbct555.seq - Bacterial sequence entries, part 555.
554. gbbct556.seq - Bacterial sequence entries, part 556.
555. gbbct557.seq - Bacterial sequence entries, part 557.
556. gbbct558.seq - Bacterial sequence entries, part 558.
557. gbbct559.seq - Bacterial sequence entries, part 559.
558. gbbct56.seq - Bacterial sequence entries, part 56.
559. gbbct560.seq - Bacterial sequence entries, part 560.
560. gbbct561.seq - Bacterial sequence entries, part 561.
561. gbbct562.seq - Bacterial sequence entries, part 562.
562. gbbct563.seq - Bacterial sequence entries, part 563.
563. gbbct564.seq - Bacterial sequence entries, part 564.
564. gbbct565.seq - Bacterial sequence entries, part 565.
565. gbbct566.seq - Bacterial sequence entries, part 566.
566. gbbct567.seq - Bacterial sequence entries, part 567.
567. gbbct568.seq - Bacterial sequence entries, part 568.
568. gbbct569.seq - Bacterial sequence entries, part 569.
569. gbbct57.seq - Bacterial sequence entries, part 57.
570. gbbct570.seq - Bacterial sequence entries, part 570.
571. gbbct571.seq - Bacterial sequence entries, part 571.
572. gbbct572.seq - Bacterial sequence entries, part 572.
573. gbbct573.seq - Bacterial sequence entries, part 573.
574. gbbct574.seq - Bacterial sequence entries, part 574.
575. gbbct575.seq - Bacterial sequence entries, part 575.
576. gbbct576.seq - Bacterial sequence entries, part 576.
577. gbbct577.seq - Bacterial sequence entries, part 577.
578. gbbct578.seq - Bacterial sequence entries, part 578.
579. gbbct579.seq - Bacterial sequence entries, part 579.
580. gbbct58.seq - Bacterial sequence entries, part 58.
581. gbbct580.seq - Bacterial sequence entries, part 580.
582. gbbct581.seq - Bacterial sequence entries, part 581.
583. gbbct582.seq - Bacterial sequence entries, part 582.
584. gbbct583.seq - Bacterial sequence entries, part 583.
585. gbbct584.seq - Bacterial sequence entries, part 584.
586. gbbct585.seq - Bacterial sequence entries, part 585.
587. gbbct586.seq - Bacterial sequence entries, part 586.
588. gbbct587.seq - Bacterial sequence entries, part 587.
589. gbbct588.seq - Bacterial sequence entries, part 588.
590. gbbct589.seq - Bacterial sequence entries, part 589.
591. gbbct59.seq - Bacterial sequence entries, part 59.
592. gbbct590.seq - Bacterial sequence entries, part 590.
593. gbbct591.seq - Bacterial sequence entries, part 591.
594. gbbct592.seq - Bacterial sequence entries, part 592.
595. gbbct593.seq - Bacterial sequence entries, part 593.
596. gbbct594.seq - Bacterial sequence entries, part 594.
597. gbbct595.seq - Bacterial sequence entries, part 595.
598. gbbct596.seq - Bacterial sequence entries, part 596.
599. gbbct597.seq - Bacterial sequence entries, part 597.
600. gbbct598.seq - Bacterial sequence entries, part 598.
601. gbbct599.seq - Bacterial sequence entries, part 599.
602. gbbct6.seq - Bacterial sequence entries, part 6.
603. gbbct60.seq - Bacterial sequence entries, part 60.
604. gbbct600.seq - Bacterial sequence entries, part 600.
605. gbbct601.seq - Bacterial sequence entries, part 601.
606. gbbct602.seq - Bacterial sequence entries, part 602.
607. gbbct603.seq - Bacterial sequence entries, part 603.
608. gbbct604.seq - Bacterial sequence entries, part 604.
609. gbbct605.seq - Bacterial sequence entries, part 605.
610. gbbct606.seq - Bacterial sequence entries, part 606.
611. gbbct607.seq - Bacterial sequence entries, part 607.
612. gbbct608.seq - Bacterial sequence entries, part 608.
613. gbbct609.seq - Bacterial sequence entries, part 609.
614. gbbct61.seq - Bacterial sequence entries, part 61.
615. gbbct610.seq - Bacterial sequence entries, part 610.
616. gbbct611.seq - Bacterial sequence entries, part 611.
617. gbbct612.seq - Bacterial sequence entries, part 612.
618. gbbct613.seq - Bacterial sequence entries, part 613.
619. gbbct614.seq - Bacterial sequence entries, part 614.
620. gbbct615.seq - Bacterial sequence entries, part 615.
621. gbbct616.seq - Bacterial sequence entries, part 616.
622. gbbct617.seq - Bacterial sequence entries, part 617.
623. gbbct618.seq - Bacterial sequence entries, part 618.
624. gbbct619.seq - Bacterial sequence entries, part 619.
625. gbbct62.seq - Bacterial sequence entries, part 62.
626. gbbct620.seq - Bacterial sequence entries, part 620.
627. gbbct621.seq - Bacterial sequence entries, part 621.
628. gbbct622.seq - Bacterial sequence entries, part 622.
629. gbbct623.seq - Bacterial sequence entries, part 623.
630. gbbct624.seq - Bacterial sequence entries, part 624.
631. gbbct625.seq - Bacterial sequence entries, part 625.
632. gbbct626.seq - Bacterial sequence entries, part 626.
633. gbbct627.seq - Bacterial sequence entries, part 627.
634. gbbct628.seq - Bacterial sequence entries, part 628.
635. gbbct629.seq - Bacterial sequence entries, part 629.
636. gbbct63.seq - Bacterial sequence entries, part 63.
637. gbbct630.seq - Bacterial sequence entries, part 630.
638. gbbct631.seq - Bacterial sequence entries, part 631.
639. gbbct632.seq - Bacterial sequence entries, part 632.
640. gbbct633.seq - Bacterial sequence entries, part 633.
641. gbbct634.seq - Bacterial sequence entries, part 634.
642. gbbct635.seq - Bacterial sequence entries, part 635.
643. gbbct636.seq - Bacterial sequence entries, part 636.
644. gbbct637.seq - Bacterial sequence entries, part 637.
645. gbbct638.seq - Bacterial sequence entries, part 638.
646. gbbct639.seq - Bacterial sequence entries, part 639.
647. gbbct64.seq - Bacterial sequence entries, part 64.
648. gbbct640.seq - Bacterial sequence entries, part 640.
649. gbbct641.seq - Bacterial sequence entries, part 641.
650. gbbct642.seq - Bacterial sequence entries, part 642.
651. gbbct643.seq - Bacterial sequence entries, part 643.
652. gbbct644.seq - Bacterial sequence entries, part 644.
653. gbbct645.seq - Bacterial sequence entries, part 645.
654. gbbct646.seq - Bacterial sequence entries, part 646.
655. gbbct647.seq - Bacterial sequence entries, part 647.
656. gbbct648.seq - Bacterial sequence entries, part 648.
657. gbbct649.seq - Bacterial sequence entries, part 649.
658. gbbct65.seq - Bacterial sequence entries, part 65.
659. gbbct650.seq - Bacterial sequence entries, part 650.
660. gbbct651.seq - Bacterial sequence entries, part 651.
661. gbbct652.seq - Bacterial sequence entries, part 652.
662. gbbct653.seq - Bacterial sequence entries, part 653.
663. gbbct654.seq - Bacterial sequence entries, part 654.
664. gbbct655.seq - Bacterial sequence entries, part 655.
665. gbbct656.seq - Bacterial sequence entries, part 656.
666. gbbct657.seq - Bacterial sequence entries, part 657.
667. gbbct658.seq - Bacterial sequence entries, part 658.
668. gbbct659.seq - Bacterial sequence entries, part 659.
669. gbbct66.seq - Bacterial sequence entries, part 66.
670. gbbct660.seq - Bacterial sequence entries, part 660.
671. gbbct661.seq - Bacterial sequence entries, part 661.
672. gbbct662.seq - Bacterial sequence entries, part 662.
673. gbbct663.seq - Bacterial sequence entries, part 663.
674. gbbct664.seq - Bacterial sequence entries, part 664.
675. gbbct665.seq - Bacterial sequence entries, part 665.
676. gbbct666.seq - Bacterial sequence entries, part 666.
677. gbbct667.seq - Bacterial sequence entries, part 667.
678. gbbct668.seq - Bacterial sequence entries, part 668.
679. gbbct669.seq - Bacterial sequence entries, part 669.
680. gbbct67.seq - Bacterial sequence entries, part 67.
681. gbbct670.seq - Bacterial sequence entries, part 670.
682. gbbct671.seq - Bacterial sequence entries, part 671.
683. gbbct672.seq - Bacterial sequence entries, part 672.
684. gbbct673.seq - Bacterial sequence entries, part 673.
685. gbbct674.seq - Bacterial sequence entries, part 674.
686. gbbct675.seq - Bacterial sequence entries, part 675.
687. gbbct676.seq - Bacterial sequence entries, part 676.
688. gbbct677.seq - Bacterial sequence entries, part 677.
689. gbbct678.seq - Bacterial sequence entries, part 678.
690. gbbct679.seq - Bacterial sequence entries, part 679.
691. gbbct68.seq - Bacterial sequence entries, part 68.
692. gbbct680.seq - Bacterial sequence entries, part 680.
693. gbbct681.seq - Bacterial sequence entries, part 681.
694. gbbct682.seq - Bacterial sequence entries, part 682.
695. gbbct683.seq - Bacterial sequence entries, part 683.
696. gbbct684.seq - Bacterial sequence entries, part 684.
697. gbbct685.seq - Bacterial sequence entries, part 685.
698. gbbct686.seq - Bacterial sequence entries, part 686.
699. gbbct687.seq - Bacterial sequence entries, part 687.
700. gbbct688.seq - Bacterial sequence entries, part 688.
701. gbbct689.seq - Bacterial sequence entries, part 689.
702. gbbct69.seq - Bacterial sequence entries, part 69.
703. gbbct690.seq - Bacterial sequence entries, part 690.
704. gbbct691.seq - Bacterial sequence entries, part 691.
705. gbbct692.seq - Bacterial sequence entries, part 692.
706. gbbct693.seq - Bacterial sequence entries, part 693.
707. gbbct694.seq - Bacterial sequence entries, part 694.
708. gbbct695.seq - Bacterial sequence entries, part 695.
709. gbbct696.seq - Bacterial sequence entries, part 696.
710. gbbct697.seq - Bacterial sequence entries, part 697.
711. gbbct698.seq - Bacterial sequence entries, part 698.
712. gbbct699.seq - Bacterial sequence entries, part 699.
713. gbbct7.seq - Bacterial sequence entries, part 7.
714. gbbct70.seq - Bacterial sequence entries, part 70.
715. gbbct700.seq - Bacterial sequence entries, part 700.
716. gbbct701.seq - Bacterial sequence entries, part 701.
717. gbbct702.seq - Bacterial sequence entries, part 702.
718. gbbct703.seq - Bacterial sequence entries, part 703.
719. gbbct704.seq - Bacterial sequence entries, part 704.
720. gbbct705.seq - Bacterial sequence entries, part 705.
721. gbbct706.seq - Bacterial sequence entries, part 706.
722. gbbct707.seq - Bacterial sequence entries, part 707.
723. gbbct708.seq - Bacterial sequence entries, part 708.
724. gbbct709.seq - Bacterial sequence entries, part 709.
725. gbbct71.seq - Bacterial sequence entries, part 71.
726. gbbct710.seq - Bacterial sequence entries, part 710.
727. gbbct711.seq - Bacterial sequence entries, part 711.
728. gbbct712.seq - Bacterial sequence entries, part 712.
729. gbbct713.seq - Bacterial sequence entries, part 713.
730. gbbct714.seq - Bacterial sequence entries, part 714.
731. gbbct715.seq - Bacterial sequence entries, part 715.
732. gbbct716.seq - Bacterial sequence entries, part 716.
733. gbbct717.seq - Bacterial sequence entries, part 717.
734. gbbct718.seq - Bacterial sequence entries, part 718.
735. gbbct719.seq - Bacterial sequence entries, part 719.
736. gbbct72.seq - Bacterial sequence entries, part 72.
737. gbbct720.seq - Bacterial sequence entries, part 720.
738. gbbct721.seq - Bacterial sequence entries, part 721.
739. gbbct722.seq - Bacterial sequence entries, part 722.
740. gbbct723.seq - Bacterial sequence entries, part 723.
741. gbbct724.seq - Bacterial sequence entries, part 724.
742. gbbct725.seq - Bacterial sequence entries, part 725.
743. gbbct726.seq - Bacterial sequence entries, part 726.
744. gbbct727.seq - Bacterial sequence entries, part 727.
745. gbbct728.seq - Bacterial sequence entries, part 728.
746. gbbct729.seq - Bacterial sequence entries, part 729.
747. gbbct73.seq - Bacterial sequence entries, part 73.
748. gbbct730.seq - Bacterial sequence entries, part 730.
749. gbbct731.seq - Bacterial sequence entries, part 731.
750. gbbct732.seq - Bacterial sequence entries, part 732.
751. gbbct733.seq - Bacterial sequence entries, part 733.
752. gbbct734.seq - Bacterial sequence entries, part 734.
753. gbbct735.seq - Bacterial sequence entries, part 735.
754. gbbct736.seq - Bacterial sequence entries, part 736.
755. gbbct737.seq - Bacterial sequence entries, part 737.
756. gbbct738.seq - Bacterial sequence entries, part 738.
757. gbbct739.seq - Bacterial sequence entries, part 739.
758. gbbct74.seq - Bacterial sequence entries, part 74.
759. gbbct740.seq - Bacterial sequence entries, part 740.
760. gbbct741.seq - Bacterial sequence entries, part 741.
761. gbbct742.seq - Bacterial sequence entries, part 742.
762. gbbct743.seq - Bacterial sequence entries, part 743.
763. gbbct744.seq - Bacterial sequence entries, part 744.
764. gbbct745.seq - Bacterial sequence entries, part 745.
765. gbbct746.seq - Bacterial sequence entries, part 746.
766. gbbct747.seq - Bacterial sequence entries, part 747.
767. gbbct748.seq - Bacterial sequence entries, part 748.
768. gbbct749.seq - Bacterial sequence entries, part 749.
769. gbbct75.seq - Bacterial sequence entries, part 75.
770. gbbct750.seq - Bacterial sequence entries, part 750.
771. gbbct751.seq - Bacterial sequence entries, part 751.
772. gbbct752.seq - Bacterial sequence entries, part 752.
773. gbbct753.seq - Bacterial sequence entries, part 753.
774. gbbct754.seq - Bacterial sequence entries, part 754.
775. gbbct755.seq - Bacterial sequence entries, part 755.
776. gbbct756.seq - Bacterial sequence entries, part 756.
777. gbbct757.seq - Bacterial sequence entries, part 757.
778. gbbct758.seq - Bacterial sequence entries, part 758.
779. gbbct759.seq - Bacterial sequence entries, part 759.
780. gbbct76.seq - Bacterial sequence entries, part 76.
781. gbbct760.seq - Bacterial sequence entries, part 760.
782. gbbct761.seq - Bacterial sequence entries, part 761.
783. gbbct762.seq - Bacterial sequence entries, part 762.
784. gbbct763.seq - Bacterial sequence entries, part 763.
785. gbbct764.seq - Bacterial sequence entries, part 764.
786. gbbct765.seq - Bacterial sequence entries, part 765.
787. gbbct766.seq - Bacterial sequence entries, part 766.
788. gbbct767.seq - Bacterial sequence entries, part 767.
789. gbbct768.seq - Bacterial sequence entries, part 768.
790. gbbct769.seq - Bacterial sequence entries, part 769.
791. gbbct77.seq - Bacterial sequence entries, part 77.
792. gbbct770.seq - Bacterial sequence entries, part 770.
793. gbbct771.seq - Bacterial sequence entries, part 771.
794. gbbct772.seq - Bacterial sequence entries, part 772.
795. gbbct773.seq - Bacterial sequence entries, part 773.
796. gbbct774.seq - Bacterial sequence entries, part 774.
797. gbbct775.seq - Bacterial sequence entries, part 775.
798. gbbct776.seq - Bacterial sequence entries, part 776.
799. gbbct777.seq - Bacterial sequence entries, part 777.
800. gbbct778.seq - Bacterial sequence entries, part 778.
801. gbbct779.seq - Bacterial sequence entries, part 779.
802. gbbct78.seq - Bacterial sequence entries, part 78.
803. gbbct780.seq - Bacterial sequence entries, part 780.
804. gbbct781.seq - Bacterial sequence entries, part 781.
805. gbbct782.seq - Bacterial sequence entries, part 782.
806. gbbct783.seq - Bacterial sequence entries, part 783.
807. gbbct784.seq - Bacterial sequence entries, part 784.
808. gbbct785.seq - Bacterial sequence entries, part 785.
809. gbbct786.seq - Bacterial sequence entries, part 786.
810. gbbct787.seq - Bacterial sequence entries, part 787.
811. gbbct788.seq - Bacterial sequence entries, part 788.
812. gbbct789.seq - Bacterial sequence entries, part 789.
813. gbbct79.seq - Bacterial sequence entries, part 79.
814. gbbct790.seq - Bacterial sequence entries, part 790.
815. gbbct791.seq - Bacterial sequence entries, part 791.
816. gbbct792.seq - Bacterial sequence entries, part 792.
817. gbbct793.seq - Bacterial sequence entries, part 793.
818. gbbct794.seq - Bacterial sequence entries, part 794.
819. gbbct795.seq - Bacterial sequence entries, part 795.
820. gbbct796.seq - Bacterial sequence entries, part 796.
821. gbbct797.seq - Bacterial sequence entries, part 797.
822. gbbct798.seq - Bacterial sequence entries, part 798.
823. gbbct799.seq - Bacterial sequence entries, part 799.
824. gbbct8.seq - Bacterial sequence entries, part 8.
825. gbbct80.seq - Bacterial sequence entries, part 80.
826. gbbct800.seq - Bacterial sequence entries, part 800.
827. gbbct801.seq - Bacterial sequence entries, part 801.
828. gbbct802.seq - Bacterial sequence entries, part 802.
829. gbbct803.seq - Bacterial sequence entries, part 803.
830. gbbct804.seq - Bacterial sequence entries, part 804.
831. gbbct805.seq - Bacterial sequence entries, part 805.
832. gbbct806.seq - Bacterial sequence entries, part 806.
833. gbbct807.seq - Bacterial sequence entries, part 807.
834. gbbct808.seq - Bacterial sequence entries, part 808.
835. gbbct809.seq - Bacterial sequence entries, part 809.
836. gbbct81.seq - Bacterial sequence entries, part 81.
837. gbbct810.seq - Bacterial sequence entries, part 810.
838. gbbct811.seq - Bacterial sequence entries, part 811.
839. gbbct812.seq - Bacterial sequence entries, part 812.
840. gbbct813.seq - Bacterial sequence entries, part 813.
841. gbbct814.seq - Bacterial sequence entries, part 814.
842. gbbct815.seq - Bacterial sequence entries, part 815.
843. gbbct816.seq - Bacterial sequence entries, part 816.
844. gbbct817.seq - Bacterial sequence entries, part 817.
845. gbbct818.seq - Bacterial sequence entries, part 818.
846. gbbct819.seq - Bacterial sequence entries, part 819.
847. gbbct82.seq - Bacterial sequence entries, part 82.
848. gbbct820.seq - Bacterial sequence entries, part 820.
849. gbbct821.seq - Bacterial sequence entries, part 821.
850. gbbct822.seq - Bacterial sequence entries, part 822.
851. gbbct823.seq - Bacterial sequence entries, part 823.
852. gbbct824.seq - Bacterial sequence entries, part 824.
853. gbbct825.seq - Bacterial sequence entries, part 825.
854. gbbct826.seq - Bacterial sequence entries, part 826.
855. gbbct827.seq - Bacterial sequence entries, part 827.
856. gbbct828.seq - Bacterial sequence entries, part 828.
857. gbbct829.seq - Bacterial sequence entries, part 829.
858. gbbct83.seq - Bacterial sequence entries, part 83.
859. gbbct830.seq - Bacterial sequence entries, part 830.
860. gbbct831.seq - Bacterial sequence entries, part 831.
861. gbbct832.seq - Bacterial sequence entries, part 832.
862. gbbct833.seq - Bacterial sequence entries, part 833.
863. gbbct834.seq - Bacterial sequence entries, part 834.
864. gbbct835.seq - Bacterial sequence entries, part 835.
865. gbbct836.seq - Bacterial sequence entries, part 836.
866. gbbct837.seq - Bacterial sequence entries, part 837.
867. gbbct838.seq - Bacterial sequence entries, part 838.
868. gbbct839.seq - Bacterial sequence entries, part 839.
869. gbbct84.seq - Bacterial sequence entries, part 84.
870. gbbct840.seq - Bacterial sequence entries, part 840.
871. gbbct841.seq - Bacterial sequence entries, part 841.
872. gbbct842.seq - Bacterial sequence entries, part 842.
873. gbbct843.seq - Bacterial sequence entries, part 843.
874. gbbct844.seq - Bacterial sequence entries, part 844.
875. gbbct845.seq - Bacterial sequence entries, part 845.
876. gbbct846.seq - Bacterial sequence entries, part 846.
877. gbbct847.seq - Bacterial sequence entries, part 847.
878. gbbct848.seq - Bacterial sequence entries, part 848.
879. gbbct849.seq - Bacterial sequence entries, part 849.
880. gbbct85.seq - Bacterial sequence entries, part 85.
881. gbbct850.seq - Bacterial sequence entries, part 850.
882. gbbct851.seq - Bacterial sequence entries, part 851.
883. gbbct852.seq - Bacterial sequence entries, part 852.
884. gbbct853.seq - Bacterial sequence entries, part 853.
885. gbbct854.seq - Bacterial sequence entries, part 854.
886. gbbct855.seq - Bacterial sequence entries, part 855.
887. gbbct856.seq - Bacterial sequence entries, part 856.
888. gbbct857.seq - Bacterial sequence entries, part 857.
889. gbbct858.seq - Bacterial sequence entries, part 858.
890. gbbct859.seq - Bacterial sequence entries, part 859.
891. gbbct86.seq - Bacterial sequence entries, part 86.
892. gbbct860.seq - Bacterial sequence entries, part 860.
893. gbbct861.seq - Bacterial sequence entries, part 861.
894. gbbct862.seq - Bacterial sequence entries, part 862.
895. gbbct863.seq - Bacterial sequence entries, part 863.
896. gbbct864.seq - Bacterial sequence entries, part 864.
897. gbbct865.seq - Bacterial sequence entries, part 865.
898. gbbct866.seq - Bacterial sequence entries, part 866.
899. gbbct867.seq - Bacterial sequence entries, part 867.
900. gbbct868.seq - Bacterial sequence entries, part 868.
901. gbbct869.seq - Bacterial sequence entries, part 869.
902. gbbct87.seq - Bacterial sequence entries, part 87.
903. gbbct870.seq - Bacterial sequence entries, part 870.
904. gbbct871.seq - Bacterial sequence entries, part 871.
905. gbbct872.seq - Bacterial sequence entries, part 872.
906. gbbct873.seq - Bacterial sequence entries, part 873.
907. gbbct874.seq - Bacterial sequence entries, part 874.
908. gbbct875.seq - Bacterial sequence entries, part 875.
909. gbbct876.seq - Bacterial sequence entries, part 876.
910. gbbct877.seq - Bacterial sequence entries, part 877.
911. gbbct878.seq - Bacterial sequence entries, part 878.
912. gbbct879.seq - Bacterial sequence entries, part 879.
913. gbbct88.seq - Bacterial sequence entries, part 88.
914. gbbct880.seq - Bacterial sequence entries, part 880.
915. gbbct881.seq - Bacterial sequence entries, part 881.
916. gbbct882.seq - Bacterial sequence entries, part 882.
917. gbbct883.seq - Bacterial sequence entries, part 883.
918. gbbct884.seq - Bacterial sequence entries, part 884.
919. gbbct885.seq - Bacterial sequence entries, part 885.
920. gbbct886.seq - Bacterial sequence entries, part 886.
921. gbbct887.seq - Bacterial sequence entries, part 887.
922. gbbct888.seq - Bacterial sequence entries, part 888.
923. gbbct889.seq - Bacterial sequence entries, part 889.
924. gbbct89.seq - Bacterial sequence entries, part 89.
925. gbbct890.seq - Bacterial sequence entries, part 890.
926. gbbct891.seq - Bacterial sequence entries, part 891.
927. gbbct892.seq - Bacterial sequence entries, part 892.
928. gbbct893.seq - Bacterial sequence entries, part 893.
929. gbbct894.seq - Bacterial sequence entries, part 894.
930. gbbct895.seq - Bacterial sequence entries, part 895.
931. gbbct896.seq - Bacterial sequence entries, part 896.
932. gbbct897.seq - Bacterial sequence entries, part 897.
933. gbbct898.seq - Bacterial sequence entries, part 898.
934. gbbct899.seq - Bacterial sequence entries, part 899.
935. gbbct9.seq - Bacterial sequence entries, part 9.
936. gbbct90.seq - Bacterial sequence entries, part 90.
937. gbbct900.seq - Bacterial sequence entries, part 900.
938. gbbct901.seq - Bacterial sequence entries, part 901.
939. gbbct902.seq - Bacterial sequence entries, part 902.
940. gbbct903.seq - Bacterial sequence entries, part 903.
941. gbbct904.seq - Bacterial sequence entries, part 904.
942. gbbct905.seq - Bacterial sequence entries, part 905.
943. gbbct906.seq - Bacterial sequence entries, part 906.
944. gbbct907.seq - Bacterial sequence entries, part 907.
945. gbbct908.seq - Bacterial sequence entries, part 908.
946. gbbct909.seq - Bacterial sequence entries, part 909.
947. gbbct91.seq - Bacterial sequence entries, part 91.
948. gbbct910.seq - Bacterial sequence entries, part 910.
949. gbbct911.seq - Bacterial sequence entries, part 911.
950. gbbct912.seq - Bacterial sequence entries, part 912.
951. gbbct913.seq - Bacterial sequence entries, part 913.
952. gbbct914.seq - Bacterial sequence entries, part 914.
953. gbbct915.seq - Bacterial sequence entries, part 915.
954. gbbct916.seq - Bacterial sequence entries, part 916.
955. gbbct917.seq - Bacterial sequence entries, part 917.
956. gbbct918.seq - Bacterial sequence entries, part 918.
957. gbbct919.seq - Bacterial sequence entries, part 919.
958. gbbct92.seq - Bacterial sequence entries, part 92.
959. gbbct920.seq - Bacterial sequence entries, part 920.
960. gbbct921.seq - Bacterial sequence entries, part 921.
961. gbbct922.seq - Bacterial sequence entries, part 922.
962. gbbct923.seq - Bacterial sequence entries, part 923.
963. gbbct924.seq - Bacterial sequence entries, part 924.
964. gbbct925.seq - Bacterial sequence entries, part 925.
965. gbbct926.seq - Bacterial sequence entries, part 926.
966. gbbct927.seq - Bacterial sequence entries, part 927.
967. gbbct928.seq - Bacterial sequence entries, part 928.
968. gbbct929.seq - Bacterial sequence entries, part 929.
969. gbbct93.seq - Bacterial sequence entries, part 93.
970. gbbct930.seq - Bacterial sequence entries, part 930.
971. gbbct931.seq - Bacterial sequence entries, part 931.
972. gbbct932.seq - Bacterial sequence entries, part 932.
973. gbbct933.seq - Bacterial sequence entries, part 933.
974. gbbct934.seq - Bacterial sequence entries, part 934.
975. gbbct935.seq - Bacterial sequence entries, part 935.
976. gbbct936.seq - Bacterial sequence entries, part 936.
977. gbbct937.seq - Bacterial sequence entries, part 937.
978. gbbct938.seq - Bacterial sequence entries, part 938.
979. gbbct939.seq - Bacterial sequence entries, part 939.
980. gbbct94.seq - Bacterial sequence entries, part 94.
981. gbbct940.seq - Bacterial sequence entries, part 940.
982. gbbct941.seq - Bacterial sequence entries, part 941.
983. gbbct942.seq - Bacterial sequence entries, part 942.
984. gbbct943.seq - Bacterial sequence entries, part 943.
985. gbbct944.seq - Bacterial sequence entries, part 944.
986. gbbct945.seq - Bacterial sequence entries, part 945.
987. gbbct946.seq - Bacterial sequence entries, part 946.
988. gbbct947.seq - Bacterial sequence entries, part 947.
989. gbbct948.seq - Bacterial sequence entries, part 948.
990. gbbct949.seq - Bacterial sequence entries, part 949.
991. gbbct95.seq - Bacterial sequence entries, part 95.
992. gbbct950.seq - Bacterial sequence entries, part 950.
993. gbbct951.seq - Bacterial sequence entries, part 951.
994. gbbct952.seq - Bacterial sequence entries, part 952.
995. gbbct953.seq - Bacterial sequence entries, part 953.
996. gbbct954.seq - Bacterial sequence entries, part 954.
997. gbbct955.seq - Bacterial sequence entries, part 955.
998. gbbct956.seq - Bacterial sequence entries, part 956.
999. gbbct957.seq - Bacterial sequence entries, part 957.
1000. gbbct958.seq - Bacterial sequence entries, part 958.
1001. gbbct959.seq - Bacterial sequence entries, part 959.
1002. gbbct96.seq - Bacterial sequence entries, part 96.
1003. gbbct960.seq - Bacterial sequence entries, part 960.
1004. gbbct961.seq - Bacterial sequence entries, part 961.
1005. gbbct962.seq - Bacterial sequence entries, part 962.
1006. gbbct963.seq - Bacterial sequence entries, part 963.
1007. gbbct964.seq - Bacterial sequence entries, part 964.
1008. gbbct965.seq - Bacterial sequence entries, part 965.
1009. gbbct966.seq - Bacterial sequence entries, part 966.
1010. gbbct967.seq - Bacterial sequence entries, part 967.
1011. gbbct968.seq - Bacterial sequence entries, part 968.
1012. gbbct969.seq - Bacterial sequence entries, part 969.
1013. gbbct97.seq - Bacterial sequence entries, part 97.
1014. gbbct970.seq - Bacterial sequence entries, part 970.
1015. gbbct971.seq - Bacterial sequence entries, part 971.
1016. gbbct972.seq - Bacterial sequence entries, part 972.
1017. gbbct973.seq - Bacterial sequence entries, part 973.
1018. gbbct974.seq - Bacterial sequence entries, part 974.
1019. gbbct975.seq - Bacterial sequence entries, part 975.
1020. gbbct976.seq - Bacterial sequence entries, part 976.
1021. gbbct977.seq - Bacterial sequence entries, part 977.
1022. gbbct978.seq - Bacterial sequence entries, part 978.
1023. gbbct979.seq - Bacterial sequence entries, part 979.
1024. gbbct98.seq - Bacterial sequence entries, part 98.
1025. gbbct980.seq - Bacterial sequence entries, part 980.
1026. gbbct981.seq - Bacterial sequence entries, part 981.
1027. gbbct982.seq - Bacterial sequence entries, part 982.
1028. gbbct983.seq - Bacterial sequence entries, part 983.
1029. gbbct984.seq - Bacterial sequence entries, part 984.
1030. gbbct985.seq - Bacterial sequence entries, part 985.
1031. gbbct986.seq - Bacterial sequence entries, part 986.
1032. gbbct987.seq - Bacterial sequence entries, part 987.
1033. gbbct988.seq - Bacterial sequence entries, part 988.
1034. gbbct989.seq - Bacterial sequence entries, part 989.
1035. gbbct99.seq - Bacterial sequence entries, part 99.
1036. gbbct990.seq - Bacterial sequence entries, part 990.
1037. gbbct991.seq - Bacterial sequence entries, part 991.
1038. gbbct992.seq - Bacterial sequence entries, part 992.
1039. gbbct993.seq - Bacterial sequence entries, part 993.
1040. gbbct994.seq - Bacterial sequence entries, part 994.
1041. gbbct995.seq - Bacterial sequence entries, part 995.
1042. gbbct996.seq - Bacterial sequence entries, part 996.
1043. gbbct997.seq - Bacterial sequence entries, part 997.
1044. gbbct998.seq - Bacterial sequence entries, part 998.
1045. gbbct999.seq - Bacterial sequence entries, part 999.
1046. gbchg.txt - Accession numbers of entries updated since the previous release.
1047. gbcon1.seq - Constructed sequence entries, part 1.
1048. gbcon10.seq - Constructed sequence entries, part 10.
1049. gbcon100.seq - Constructed sequence entries, part 100.
1050. gbcon101.seq - Constructed sequence entries, part 101.
1051. gbcon102.seq - Constructed sequence entries, part 102.
1052. gbcon103.seq - Constructed sequence entries, part 103.
1053. gbcon104.seq - Constructed sequence entries, part 104.
1054. gbcon105.seq - Constructed sequence entries, part 105.
1055. gbcon106.seq - Constructed sequence entries, part 106.
1056. gbcon107.seq - Constructed sequence entries, part 107.
1057. gbcon108.seq - Constructed sequence entries, part 108.
1058. gbcon109.seq - Constructed sequence entries, part 109.
1059. gbcon11.seq - Constructed sequence entries, part 11.
1060. gbcon110.seq - Constructed sequence entries, part 110.
1061. gbcon111.seq - Constructed sequence entries, part 111.
1062. gbcon112.seq - Constructed sequence entries, part 112.
1063. gbcon113.seq - Constructed sequence entries, part 113.
1064. gbcon114.seq - Constructed sequence entries, part 114.
1065. gbcon115.seq - Constructed sequence entries, part 115.
1066. gbcon116.seq - Constructed sequence entries, part 116.
1067. gbcon117.seq - Constructed sequence entries, part 117.
1068. gbcon118.seq - Constructed sequence entries, part 118.
1069. gbcon119.seq - Constructed sequence entries, part 119.
1070. gbcon12.seq - Constructed sequence entries, part 12.
1071. gbcon120.seq - Constructed sequence entries, part 120.
1072. gbcon121.seq - Constructed sequence entries, part 121.
1073. gbcon122.seq - Constructed sequence entries, part 122.
1074. gbcon123.seq - Constructed sequence entries, part 123.
1075. gbcon124.seq - Constructed sequence entries, part 124.
1076. gbcon125.seq - Constructed sequence entries, part 125.
1077. gbcon126.seq - Constructed sequence entries, part 126.
1078. gbcon127.seq - Constructed sequence entries, part 127.
1079. gbcon128.seq - Constructed sequence entries, part 128.
1080. gbcon129.seq - Constructed sequence entries, part 129.
1081. gbcon13.seq - Constructed sequence entries, part 13.
1082. gbcon130.seq - Constructed sequence entries, part 130.
1083. gbcon131.seq - Constructed sequence entries, part 131.
1084. gbcon132.seq - Constructed sequence entries, part 132.
1085. gbcon133.seq - Constructed sequence entries, part 133.
1086. gbcon134.seq - Constructed sequence entries, part 134.
1087. gbcon135.seq - Constructed sequence entries, part 135.
1088. gbcon136.seq - Constructed sequence entries, part 136.
1089. gbcon137.seq - Constructed sequence entries, part 137.
1090. gbcon138.seq - Constructed sequence entries, part 138.
1091. gbcon139.seq - Constructed sequence entries, part 139.
1092. gbcon14.seq - Constructed sequence entries, part 14.
1093. gbcon140.seq - Constructed sequence entries, part 140.
1094. gbcon141.seq - Constructed sequence entries, part 141.
1095. gbcon142.seq - Constructed sequence entries, part 142.
1096. gbcon143.seq - Constructed sequence entries, part 143.
1097. gbcon144.seq - Constructed sequence entries, part 144.
1098. gbcon145.seq - Constructed sequence entries, part 145.
1099. gbcon146.seq - Constructed sequence entries, part 146.
1100. gbcon147.seq - Constructed sequence entries, part 147.
1101. gbcon148.seq - Constructed sequence entries, part 148.
1102. gbcon149.seq - Constructed sequence entries, part 149.
1103. gbcon15.seq - Constructed sequence entries, part 15.
1104. gbcon150.seq - Constructed sequence entries, part 150.
1105. gbcon151.seq - Constructed sequence entries, part 151.
1106. gbcon152.seq - Constructed sequence entries, part 152.
1107. gbcon153.seq - Constructed sequence entries, part 153.
1108. gbcon154.seq - Constructed sequence entries, part 154.
1109. gbcon155.seq - Constructed sequence entries, part 155.
1110. gbcon156.seq - Constructed sequence entries, part 156.
1111. gbcon157.seq - Constructed sequence entries, part 157.
1112. gbcon158.seq - Constructed sequence entries, part 158.
1113. gbcon159.seq - Constructed sequence entries, part 159.
1114. gbcon16.seq - Constructed sequence entries, part 16.
1115. gbcon160.seq - Constructed sequence entries, part 160.
1116. gbcon161.seq - Constructed sequence entries, part 161.
1117. gbcon162.seq - Constructed sequence entries, part 162.
1118. gbcon163.seq - Constructed sequence entries, part 163.
1119. gbcon164.seq - Constructed sequence entries, part 164.
1120. gbcon165.seq - Constructed sequence entries, part 165.
1121. gbcon166.seq - Constructed sequence entries, part 166.
1122. gbcon167.seq - Constructed sequence entries, part 167.
1123. gbcon168.seq - Constructed sequence entries, part 168.
1124. gbcon169.seq - Constructed sequence entries, part 169.
1125. gbcon17.seq - Constructed sequence entries, part 17.
1126. gbcon170.seq - Constructed sequence entries, part 170.
1127. gbcon171.seq - Constructed sequence entries, part 171.
1128. gbcon172.seq - Constructed sequence entries, part 172.
1129. gbcon173.seq - Constructed sequence entries, part 173.
1130. gbcon174.seq - Constructed sequence entries, part 174.
1131. gbcon175.seq - Constructed sequence entries, part 175.
1132. gbcon176.seq - Constructed sequence entries, part 176.
1133. gbcon177.seq - Constructed sequence entries, part 177.
1134. gbcon178.seq - Constructed sequence entries, part 178.
1135. gbcon179.seq - Constructed sequence entries, part 179.
1136. gbcon18.seq - Constructed sequence entries, part 18.
1137. gbcon180.seq - Constructed sequence entries, part 180.
1138. gbcon181.seq - Constructed sequence entries, part 181.
1139. gbcon182.seq - Constructed sequence entries, part 182.
1140. gbcon183.seq - Constructed sequence entries, part 183.
1141. gbcon184.seq - Constructed sequence entries, part 184.
1142. gbcon185.seq - Constructed sequence entries, part 185.
1143. gbcon186.seq - Constructed sequence entries, part 186.
1144. gbcon187.seq - Constructed sequence entries, part 187.
1145. gbcon188.seq - Constructed sequence entries, part 188.
1146. gbcon189.seq - Constructed sequence entries, part 189.
1147. gbcon19.seq - Constructed sequence entries, part 19.
1148. gbcon190.seq - Constructed sequence entries, part 190.
1149. gbcon191.seq - Constructed sequence entries, part 191.
1150. gbcon192.seq - Constructed sequence entries, part 192.
1151. gbcon193.seq - Constructed sequence entries, part 193.
1152. gbcon194.seq - Constructed sequence entries, part 194.
1153. gbcon195.seq - Constructed sequence entries, part 195.
1154. gbcon196.seq - Constructed sequence entries, part 196.
1155. gbcon197.seq - Constructed sequence entries, part 197.
1156. gbcon198.seq - Constructed sequence entries, part 198.
1157. gbcon199.seq - Constructed sequence entries, part 199.
1158. gbcon2.seq - Constructed sequence entries, part 2.
1159. gbcon20.seq - Constructed sequence entries, part 20.
1160. gbcon200.seq - Constructed sequence entries, part 200.
1161. gbcon201.seq - Constructed sequence entries, part 201.
1162. gbcon202.seq - Constructed sequence entries, part 202.
1163. gbcon203.seq - Constructed sequence entries, part 203.
1164. gbcon204.seq - Constructed sequence entries, part 204.
1165. gbcon205.seq - Constructed sequence entries, part 205.
1166. gbcon206.seq - Constructed sequence entries, part 206.
1167. gbcon207.seq - Constructed sequence entries, part 207.
1168. gbcon208.seq - Constructed sequence entries, part 208.
1169. gbcon209.seq - Constructed sequence entries, part 209.
1170. gbcon21.seq - Constructed sequence entries, part 21.
1171. gbcon210.seq - Constructed sequence entries, part 210.
1172. gbcon211.seq - Constructed sequence entries, part 211.
1173. gbcon212.seq - Constructed sequence entries, part 212.
1174. gbcon213.seq - Constructed sequence entries, part 213.
1175. gbcon214.seq - Constructed sequence entries, part 214.
1176. gbcon215.seq - Constructed sequence entries, part 215.
1177. gbcon216.seq - Constructed sequence entries, part 216.
1178. gbcon217.seq - Constructed sequence entries, part 217.
1179. gbcon218.seq - Constructed sequence entries, part 218.
1180. gbcon219.seq - Constructed sequence entries, part 219.
1181. gbcon22.seq - Constructed sequence entries, part 22.
1182. gbcon220.seq - Constructed sequence entries, part 220.
1183. gbcon221.seq - Constructed sequence entries, part 221.
1184. gbcon222.seq - Constructed sequence entries, part 222.
1185. gbcon223.seq - Constructed sequence entries, part 223.
1186. gbcon224.seq - Constructed sequence entries, part 224.
1187. gbcon225.seq - Constructed sequence entries, part 225.
1188. gbcon226.seq - Constructed sequence entries, part 226.
1189. gbcon227.seq - Constructed sequence entries, part 227.
1190. gbcon228.seq - Constructed sequence entries, part 228.
1191. gbcon229.seq - Constructed sequence entries, part 229.
1192. gbcon23.seq - Constructed sequence entries, part 23.
1193. gbcon230.seq - Constructed sequence entries, part 230.
1194. gbcon231.seq - Constructed sequence entries, part 231.
1195. gbcon232.seq - Constructed sequence entries, part 232.
1196. gbcon233.seq - Constructed sequence entries, part 233.
1197. gbcon234.seq - Constructed sequence entries, part 234.
1198. gbcon235.seq - Constructed sequence entries, part 235.
1199. gbcon236.seq - Constructed sequence entries, part 236.
1200. gbcon237.seq - Constructed sequence entries, part 237.
1201. gbcon24.seq - Constructed sequence entries, part 24.
1202. gbcon25.seq - Constructed sequence entries, part 25.
1203. gbcon26.seq - Constructed sequence entries, part 26.
1204. gbcon27.seq - Constructed sequence entries, part 27.
1205. gbcon28.seq - Constructed sequence entries, part 28.
1206. gbcon29.seq - Constructed sequence entries, part 29.
1207. gbcon3.seq - Constructed sequence entries, part 3.
1208. gbcon30.seq - Constructed sequence entries, part 30.
1209. gbcon31.seq - Constructed sequence entries, part 31.
1210. gbcon32.seq - Constructed sequence entries, part 32.
1211. gbcon33.seq - Constructed sequence entries, part 33.
1212. gbcon34.seq - Constructed sequence entries, part 34.
1213. gbcon35.seq - Constructed sequence entries, part 35.
1214. gbcon36.seq - Constructed sequence entries, part 36.
1215. gbcon37.seq - Constructed sequence entries, part 37.
1216. gbcon38.seq - Constructed sequence entries, part 38.
1217. gbcon39.seq - Constructed sequence entries, part 39.
1218. gbcon4.seq - Constructed sequence entries, part 4.
1219. gbcon40.seq - Constructed sequence entries, part 40.
1220. gbcon41.seq - Constructed sequence entries, part 41.
1221. gbcon42.seq - Constructed sequence entries, part 42.
1222. gbcon43.seq - Constructed sequence entries, part 43.
1223. gbcon44.seq - Constructed sequence entries, part 44.
1224. gbcon45.seq - Constructed sequence entries, part 45.
1225. gbcon46.seq - Constructed sequence entries, part 46.
1226. gbcon47.seq - Constructed sequence entries, part 47.
1227. gbcon48.seq - Constructed sequence entries, part 48.
1228. gbcon49.seq - Constructed sequence entries, part 49.
1229. gbcon5.seq - Constructed sequence entries, part 5.
1230. gbcon50.seq - Constructed sequence entries, part 50.
1231. gbcon51.seq - Constructed sequence entries, part 51.
1232. gbcon52.seq - Constructed sequence entries, part 52.
1233. gbcon53.seq - Constructed sequence entries, part 53.
1234. gbcon54.seq - Constructed sequence entries, part 54.
1235. gbcon55.seq - Constructed sequence entries, part 55.
1236. gbcon56.seq - Constructed sequence entries, part 56.
1237. gbcon57.seq - Constructed sequence entries, part 57.
1238. gbcon58.seq - Constructed sequence entries, part 58.
1239. gbcon59.seq - Constructed sequence entries, part 59.
1240. gbcon6.seq - Constructed sequence entries, part 6.
1241. gbcon60.seq - Constructed sequence entries, part 60.
1242. gbcon61.seq - Constructed sequence entries, part 61.
1243. gbcon62.seq - Constructed sequence entries, part 62.
1244. gbcon63.seq - Constructed sequence entries, part 63.
1245. gbcon64.seq - Constructed sequence entries, part 64.
1246. gbcon65.seq - Constructed sequence entries, part 65.
1247. gbcon66.seq - Constructed sequence entries, part 66.
1248. gbcon67.seq - Constructed sequence entries, part 67.
1249. gbcon68.seq - Constructed sequence entries, part 68.
1250. gbcon69.seq - Constructed sequence entries, part 69.
1251. gbcon7.seq - Constructed sequence entries, part 7.
1252. gbcon70.seq - Constructed sequence entries, part 70.
1253. gbcon71.seq - Constructed sequence entries, part 71.
1254. gbcon72.seq - Constructed sequence entries, part 72.
1255. gbcon73.seq - Constructed sequence entries, part 73.
1256. gbcon74.seq - Constructed sequence entries, part 74.
1257. gbcon75.seq - Constructed sequence entries, part 75.
1258. gbcon76.seq - Constructed sequence entries, part 76.
1259. gbcon77.seq - Constructed sequence entries, part 77.
1260. gbcon78.seq - Constructed sequence entries, part 78.
1261. gbcon79.seq - Constructed sequence entries, part 79.
1262. gbcon8.seq - Constructed sequence entries, part 8.
1263. gbcon80.seq - Constructed sequence entries, part 80.
1264. gbcon81.seq - Constructed sequence entries, part 81.
1265. gbcon82.seq - Constructed sequence entries, part 82.
1266. gbcon83.seq - Constructed sequence entries, part 83.
1267. gbcon84.seq - Constructed sequence entries, part 84.
1268. gbcon85.seq - Constructed sequence entries, part 85.
1269. gbcon86.seq - Constructed sequence entries, part 86.
1270. gbcon87.seq - Constructed sequence entries, part 87.
1271. gbcon88.seq - Constructed sequence entries, part 88.
1272. gbcon89.seq - Constructed sequence entries, part 89.
1273. gbcon9.seq - Constructed sequence entries, part 9.
1274. gbcon90.seq - Constructed sequence entries, part 90.
1275. gbcon91.seq - Constructed sequence entries, part 91.
1276. gbcon92.seq - Constructed sequence entries, part 92.
1277. gbcon93.seq - Constructed sequence entries, part 93.
1278. gbcon94.seq - Constructed sequence entries, part 94.
1279. gbcon95.seq - Constructed sequence entries, part 95.
1280. gbcon96.seq - Constructed sequence entries, part 96.
1281. gbcon97.seq - Constructed sequence entries, part 97.
1282. gbcon98.seq - Constructed sequence entries, part 98.
1283. gbcon99.seq - Constructed sequence entries, part 99.
1284. gbdel.txt - Accession numbers of entries deleted since the previous release.
1285. gbenv1.seq - Environmental sampling sequence entries, part 1.
1286. gbenv10.seq - Environmental sampling sequence entries, part 10.
1287. gbenv11.seq - Environmental sampling sequence entries, part 11.
1288. gbenv12.seq - Environmental sampling sequence entries, part 12.
1289. gbenv13.seq - Environmental sampling sequence entries, part 13.
1290. gbenv14.seq - Environmental sampling sequence entries, part 14.
1291. gbenv15.seq - Environmental sampling sequence entries, part 15.
1292. gbenv16.seq - Environmental sampling sequence entries, part 16.
1293. gbenv17.seq - Environmental sampling sequence entries, part 17.
1294. gbenv18.seq - Environmental sampling sequence entries, part 18.
1295. gbenv19.seq - Environmental sampling sequence entries, part 19.
1296. gbenv2.seq - Environmental sampling sequence entries, part 2.
1297. gbenv20.seq - Environmental sampling sequence entries, part 20.
1298. gbenv21.seq - Environmental sampling sequence entries, part 21.
1299. gbenv22.seq - Environmental sampling sequence entries, part 22.
1300. gbenv23.seq - Environmental sampling sequence entries, part 23.
1301. gbenv24.seq - Environmental sampling sequence entries, part 24.
1302. gbenv25.seq - Environmental sampling sequence entries, part 25.
1303. gbenv26.seq - Environmental sampling sequence entries, part 26.
1304. gbenv27.seq - Environmental sampling sequence entries, part 27.
1305. gbenv28.seq - Environmental sampling sequence entries, part 28.
1306. gbenv29.seq - Environmental sampling sequence entries, part 29.
1307. gbenv3.seq - Environmental sampling sequence entries, part 3.
1308. gbenv30.seq - Environmental sampling sequence entries, part 30.
1309. gbenv31.seq - Environmental sampling sequence entries, part 31.
1310. gbenv32.seq - Environmental sampling sequence entries, part 32.
1311. gbenv33.seq - Environmental sampling sequence entries, part 33.
1312. gbenv34.seq - Environmental sampling sequence entries, part 34.
1313. gbenv35.seq - Environmental sampling sequence entries, part 35.
1314. gbenv36.seq - Environmental sampling sequence entries, part 36.
1315. gbenv37.seq - Environmental sampling sequence entries, part 37.
1316. gbenv38.seq - Environmental sampling sequence entries, part 38.
1317. gbenv39.seq - Environmental sampling sequence entries, part 39.
1318. gbenv4.seq - Environmental sampling sequence entries, part 4.
1319. gbenv40.seq - Environmental sampling sequence entries, part 40.
1320. gbenv41.seq - Environmental sampling sequence entries, part 41.
1321. gbenv42.seq - Environmental sampling sequence entries, part 42.
1322. gbenv43.seq - Environmental sampling sequence entries, part 43.
1323. gbenv44.seq - Environmental sampling sequence entries, part 44.
1324. gbenv45.seq - Environmental sampling sequence entries, part 45.
1325. gbenv46.seq - Environmental sampling sequence entries, part 46.
1326. gbenv47.seq - Environmental sampling sequence entries, part 47.
1327. gbenv48.seq - Environmental sampling sequence entries, part 48.
1328. gbenv49.seq - Environmental sampling sequence entries, part 49.
1329. gbenv5.seq - Environmental sampling sequence entries, part 5.
1330. gbenv50.seq - Environmental sampling sequence entries, part 50.
1331. gbenv51.seq - Environmental sampling sequence entries, part 51.
1332. gbenv52.seq - Environmental sampling sequence entries, part 52.
1333. gbenv53.seq - Environmental sampling sequence entries, part 53.
1334. gbenv54.seq - Environmental sampling sequence entries, part 54.
1335. gbenv55.seq - Environmental sampling sequence entries, part 55.
1336. gbenv56.seq - Environmental sampling sequence entries, part 56.
1337. gbenv57.seq - Environmental sampling sequence entries, part 57.
1338. gbenv58.seq - Environmental sampling sequence entries, part 58.
1339. gbenv59.seq - Environmental sampling sequence entries, part 59.
1340. gbenv6.seq - Environmental sampling sequence entries, part 6.
1341. gbenv60.seq - Environmental sampling sequence entries, part 60.
1342. gbenv61.seq - Environmental sampling sequence entries, part 61.
1343. gbenv62.seq - Environmental sampling sequence entries, part 62.
1344. gbenv63.seq - Environmental sampling sequence entries, part 63.
1345. gbenv64.seq - Environmental sampling sequence entries, part 64.
1346. gbenv65.seq - Environmental sampling sequence entries, part 65.
1347. gbenv66.seq - Environmental sampling sequence entries, part 66.
1348. gbenv67.seq - Environmental sampling sequence entries, part 67.
1349. gbenv68.seq - Environmental sampling sequence entries, part 68.
1350. gbenv69.seq - Environmental sampling sequence entries, part 69.
1351. gbenv7.seq - Environmental sampling sequence entries, part 7.
1352. gbenv70.seq - Environmental sampling sequence entries, part 70.
1353. gbenv71.seq - Environmental sampling sequence entries, part 71.
1354. gbenv72.seq - Environmental sampling sequence entries, part 72.
1355. gbenv73.seq - Environmental sampling sequence entries, part 73.
1356. gbenv74.seq - Environmental sampling sequence entries, part 74.
1357. gbenv75.seq - Environmental sampling sequence entries, part 75.
1358. gbenv76.seq - Environmental sampling sequence entries, part 76.
1359. gbenv77.seq - Environmental sampling sequence entries, part 77.
1360. gbenv78.seq - Environmental sampling sequence entries, part 78.
1361. gbenv79.seq - Environmental sampling sequence entries, part 79.
1362. gbenv8.seq - Environmental sampling sequence entries, part 8.
1363. gbenv80.seq - Environmental sampling sequence entries, part 80.
1364. gbenv9.seq - Environmental sampling sequence entries, part 9.
1365. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
1366. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
1367. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
1368. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
1369. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
1370. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
1371. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
1372. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
1373. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
1374. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
1375. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
1376. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
1377. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
1378. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
1379. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
1380. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
1381. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
1382. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
1383. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
1384. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
1385. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
1386. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
1387. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
1388. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
1389. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
1390. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
1391. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
1392. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
1393. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
1394. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
1395. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
1396. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
1397. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
1398. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
1399. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
1400. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
1401. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
1402. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
1403. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
1404. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
1405. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
1406. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
1407. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
1408. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
1409. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
1410. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
1411. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
1412. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
1413. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
1414. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
1415. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
1416. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
1417. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
1418. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
1419. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
1420. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
1421. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
1422. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
1423. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
1424. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
1425. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
1426. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
1427. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
1428. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
1429. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
1430. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
1431. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
1432. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
1433. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
1434. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
1435. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
1436. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
1437. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
1438. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
1439. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
1440. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
1441. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
1442. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
1443. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
1444. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
1445. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
1446. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
1447. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
1448. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
1449. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
1450. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
1451. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
1452. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
1453. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
1454. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
1455. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
1456. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
1457. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
1458. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
1459. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
1460. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
1461. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
1462. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
1463. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
1464. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
1465. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
1466. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
1467. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
1468. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
1469. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
1470. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
1471. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
1472. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
1473. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
1474. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
1475. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
1476. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
1477. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
1478. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
1479. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
1480. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
1481. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
1482. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
1483. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
1484. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
1485. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
1486. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
1487. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
1488. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
1489. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
1490. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
1491. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
1492. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
1493. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
1494. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
1495. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
1496. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
1497. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
1498. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
1499. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
1500. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
1501. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
1502. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
1503. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
1504. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
1505. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
1506. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
1507. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
1508. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
1509. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
1510. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
1511. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
1512. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
1513. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
1514. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
1515. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
1516. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
1517. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
1518. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
1519. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
1520. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
1521. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
1522. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
1523. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
1524. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
1525. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
1526. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
1527. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
1528. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
1529. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
1530. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
1531. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
1532. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
1533. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
1534. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
1535. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
1536. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
1537. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
1538. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
1539. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
1540. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
1541. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
1542. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
1543. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
1544. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
1545. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
1546. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
1547. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
1548. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
1549. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
1550. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
1551. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
1552. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
1553. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
1554. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
1555. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
1556. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
1557. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
1558. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
1559. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
1560. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
1561. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
1562. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
1563. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
1564. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
1565. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
1566. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
1567. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
1568. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
1569. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
1570. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
1571. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
1572. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
1573. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
1574. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
1575. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
1576. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
1577. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
1578. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
1579. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
1580. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
1581. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
1582. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
1583. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
1584. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
1585. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
1586. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
1587. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
1588. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
1589. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
1590. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
1591. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
1592. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1593. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1594. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1595. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1596. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1597. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1598. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1599. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1600. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1601. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1602. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1603. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1604. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1605. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1606. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1607. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1608. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1609. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1610. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1611. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1612. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1613. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1614. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1615. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1616. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1617. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1618. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1619. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1620. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1621. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1622. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1623. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1624. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1625. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1626. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1627. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1628. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1629. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1630. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1631. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1632. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1633. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1634. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1635. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1636. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1637. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1638. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1639. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1640. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1641. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1642. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1643. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1644. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1645. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1646. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1647. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1648. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1649. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1650. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1651. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1652. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1653. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1654. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1655. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1656. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1657. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1658. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1659. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1660. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1661. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1662. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1663. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1664. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1665. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1666. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1667. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1668. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1669. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1670. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1671. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1672. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1673. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1674. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1675. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1676. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1677. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1678. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1679. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1680. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1681. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1682. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1683. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1684. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1685. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1686. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1687. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1688. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1689. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1690. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1691. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1692. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1693. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1694. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1695. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1696. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1697. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1698. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1699. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1700. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1701. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1702. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1703. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1704. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1705. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1706. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1707. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1708. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1709. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1710. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1711. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1712. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1713. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1714. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1715. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1716. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1717. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1718. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1719. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1720. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1721. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1722. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1723. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1724. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1725. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1726. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1727. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1728. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1729. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1730. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1731. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1732. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1733. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1734. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1735. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1736. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1737. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1738. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1739. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1740. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1741. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1742. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1743. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1744. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1745. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1746. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1747. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1748. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1749. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1750. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1751. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1752. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1753. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1754. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1755. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1756. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1757. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1758. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1759. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1760. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1761. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1762. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1763. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1764. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1765. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1766. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1767. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1768. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1769. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1770. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1771. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1772. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1773. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1774. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1775. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1776. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1777. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1778. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1779. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1780. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1781. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1782. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1783. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1784. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1785. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1786. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1787. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1788. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1789. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1790. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1791. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1792. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
1793. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
1794. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
1795. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
1796. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
1797. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
1798. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1799. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
1800. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
1801. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
1802. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
1803. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
1804. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
1805. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
1806. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
1807. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
1808. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
1809. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1810. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1811. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
1812. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
1813. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
1814. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
1815. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
1816. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
1817. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
1818. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
1819. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
1820. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
1821. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1822. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
1823. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
1824. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
1825. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
1826. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
1827. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
1828. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
1829. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
1830. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
1831. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
1832. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1833. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
1834. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
1835. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
1836. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
1837. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
1838. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
1839. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
1840. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
1841. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
1842. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
1843. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1844. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
1845. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
1846. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
1847. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
1848. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
1849. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
1850. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
1851. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
1852. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
1853. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
1854. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1855. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
1856. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
1857. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
1858. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
1859. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
1860. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
1861. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
1862. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
1863. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
1864. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
1865. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1866. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
1867. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
1868. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
1869. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
1870. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
1871. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
1872. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
1873. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
1874. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
1875. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
1876. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1877. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
1878. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
1879. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
1880. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
1881. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
1882. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
1883. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
1884. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
1885. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
1886. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
1887. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1888. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
1889. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
1890. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
1891. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
1892. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
1893. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
1894. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
1895. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
1896. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
1897. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1898. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1899. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1900. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1901. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1902. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1903. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1904. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1905. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1906. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1907. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1908. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1909. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1910. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1911. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1912. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1913. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1914. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1915. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1916. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1917. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1918. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1919. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1920. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1921. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1922. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1923. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1924. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1925. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1926. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1927. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1928. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1929. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1930. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1931. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1932. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1933. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1934. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1935. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1936. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1937. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1938. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1939. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1940. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1941. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1942. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1943. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1944. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1945. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1946. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1947. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1948. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1949. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1950. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1951. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1952. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1953. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1954. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1955. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1956. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1957. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1958. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1959. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1960. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1961. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1962. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1963. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1964. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1965. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1966. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1967. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1968. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1969. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1970. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1971. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1972. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1973. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1974. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1975. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1976. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1977. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1978. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1979. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1980. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1981. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1982. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1983. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1984. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1985. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1986. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1987. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1988. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1989. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1990. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1991. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1992. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1993. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1994. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1995. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1996. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1997. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1998. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1999. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
2000. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
2001. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
2002. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
2003. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
2004. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
2005. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
2006. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
2007. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
2008. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
2009. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
2010. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
2011. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
2012. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
2013. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
2014. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
2015. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
2016. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
2017. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
2018. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
2019. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
2020. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
2021. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
2022. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
2023. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
2024. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
2025. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
2026. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
2027. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
2028. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
2029. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
2030. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
2031. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
2032. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
2033. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
2034. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
2035. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
2036. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
2037. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
2038. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
2039. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
2040. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
2041. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
2042. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
2043. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
2044. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
2045. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
2046. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
2047. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
2048. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
2049. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
2050. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
2051. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
2052. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
2053. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
2054. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
2055. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
2056. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
2057. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
2058. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
2059. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
2060. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
2061. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
2062. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
2063. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
2064. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
2065. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
2066. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
2067. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
2068. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
2069. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
2070. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
2071. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
2072. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
2073. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
2074. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
2075. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
2076. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
2077. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
2078. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
2079. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
2080. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
2081. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
2082. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
2083. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
2084. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
2085. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
2086. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
2087. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
2088. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
2089. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
2090. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
2091. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
2092. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
2093. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
2094. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
2095. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
2096. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
2097. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
2098. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
2099. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
2100. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
2101. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
2102. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
2103. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
2104. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
2105. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
2106. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
2107. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
2108. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
2109. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
2110. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
2111. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
2112. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
2113. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
2114. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
2115. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
2116. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
2117. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
2118. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
2119. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
2120. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
2121. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
2122. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
2123. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
2124. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
2125. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
2126. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
2127. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
2128. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
2129. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
2130. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
2131. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
2132. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
2133. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
2134. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
2135. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
2136. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
2137. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
2138. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
2139. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
2140. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
2141. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
2142. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
2143. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
2144. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
2145. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
2146. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
2147. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
2148. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
2149. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
2150. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
2151. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
2152. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
2153. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
2154. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
2155. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
2156. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
2157. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
2158. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
2159. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
2160. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
2161. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
2162. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
2163. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
2164. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
2165. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
2166. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
2167. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
2168. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
2169. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
2170. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
2171. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
2172. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
2173. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
2174. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
2175. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
2176. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
2177. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
2178. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
2179. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
2180. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
2181. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
2182. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
2183. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
2184. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
2185. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
2186. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
2187. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
2188. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
2189. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
2190. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
2191. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
2192. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
2193. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
2194. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
2195. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
2196. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
2197. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
2198. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
2199. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
2200. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
2201. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
2202. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
2203. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
2204. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
2205. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
2206. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
2207. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
2208. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
2209. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
2210. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
2211. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
2212. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
2213. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
2214. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
2215. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
2216. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
2217. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
2218. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
2219. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
2220. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
2221. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
2222. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
2223. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
2224. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
2225. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
2226. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
2227. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
2228. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
2229. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
2230. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
2231. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
2232. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
2233. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
2234. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
2235. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
2236. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
2237. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
2238. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
2239. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
2240. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
2241. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
2242. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
2243. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
2244. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
2245. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
2246. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
2247. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
2248. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
2249. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
2250. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
2251. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
2252. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
2253. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
2254. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
2255. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
2256. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
2257. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
2258. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
2259. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
2260. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
2261. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
2262. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
2263. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
2264. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
2265. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
2266. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
2267. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
2268. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
2269. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
2270. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
2271. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
2272. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
2273. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
2274. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
2275. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
2276. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
2277. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
2278. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
2279. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
2280. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
2281. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
2282. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
2283. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
2284. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
2285. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
2286. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
2287. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
2288. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
2289. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
2290. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
2291. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
2292. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
2293. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
2294. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
2295. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
2296. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
2297. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
2298. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
2299. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
2300. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
2301. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
2302. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
2303. gbinv1.seq - Invertebrate sequence entries, part 1.
2304. gbinv10.seq - Invertebrate sequence entries, part 10.
2305. gbinv100.seq - Invertebrate sequence entries, part 100.
2306. gbinv1000.seq - Invertebrate sequence entries, part 1000.
2307. gbinv1001.seq - Invertebrate sequence entries, part 1001.
2308. gbinv1002.seq - Invertebrate sequence entries, part 1002.
2309. gbinv1003.seq - Invertebrate sequence entries, part 1003.
2310. gbinv1004.seq - Invertebrate sequence entries, part 1004.
2311. gbinv1005.seq - Invertebrate sequence entries, part 1005.
2312. gbinv1006.seq - Invertebrate sequence entries, part 1006.
2313. gbinv1007.seq - Invertebrate sequence entries, part 1007.
2314. gbinv1008.seq - Invertebrate sequence entries, part 1008.
2315. gbinv1009.seq - Invertebrate sequence entries, part 1009.
2316. gbinv101.seq - Invertebrate sequence entries, part 101.
2317. gbinv1010.seq - Invertebrate sequence entries, part 1010.
2318. gbinv1011.seq - Invertebrate sequence entries, part 1011.
2319. gbinv1012.seq - Invertebrate sequence entries, part 1012.
2320. gbinv1013.seq - Invertebrate sequence entries, part 1013.
2321. gbinv1014.seq - Invertebrate sequence entries, part 1014.
2322. gbinv1015.seq - Invertebrate sequence entries, part 1015.
2323. gbinv1016.seq - Invertebrate sequence entries, part 1016.
2324. gbinv1017.seq - Invertebrate sequence entries, part 1017.
2325. gbinv1018.seq - Invertebrate sequence entries, part 1018.
2326. gbinv1019.seq - Invertebrate sequence entries, part 1019.
2327. gbinv102.seq - Invertebrate sequence entries, part 102.
2328. gbinv1020.seq - Invertebrate sequence entries, part 1020.
2329. gbinv1021.seq - Invertebrate sequence entries, part 1021.
2330. gbinv1022.seq - Invertebrate sequence entries, part 1022.
2331. gbinv1023.seq - Invertebrate sequence entries, part 1023.
2332. gbinv1024.seq - Invertebrate sequence entries, part 1024.
2333. gbinv1025.seq - Invertebrate sequence entries, part 1025.
2334. gbinv1026.seq - Invertebrate sequence entries, part 1026.
2335. gbinv1027.seq - Invertebrate sequence entries, part 1027.
2336. gbinv1028.seq - Invertebrate sequence entries, part 1028.
2337. gbinv1029.seq - Invertebrate sequence entries, part 1029.
2338. gbinv103.seq - Invertebrate sequence entries, part 103.
2339. gbinv1030.seq - Invertebrate sequence entries, part 1030.
2340. gbinv1031.seq - Invertebrate sequence entries, part 1031.
2341. gbinv1032.seq - Invertebrate sequence entries, part 1032.
2342. gbinv1033.seq - Invertebrate sequence entries, part 1033.
2343. gbinv1034.seq - Invertebrate sequence entries, part 1034.
2344. gbinv1035.seq - Invertebrate sequence entries, part 1035.
2345. gbinv1036.seq - Invertebrate sequence entries, part 1036.
2346. gbinv1037.seq - Invertebrate sequence entries, part 1037.
2347. gbinv1038.seq - Invertebrate sequence entries, part 1038.
2348. gbinv1039.seq - Invertebrate sequence entries, part 1039.
2349. gbinv104.seq - Invertebrate sequence entries, part 104.
2350. gbinv1040.seq - Invertebrate sequence entries, part 1040.
2351. gbinv1041.seq - Invertebrate sequence entries, part 1041.
2352. gbinv1042.seq - Invertebrate sequence entries, part 1042.
2353. gbinv1043.seq - Invertebrate sequence entries, part 1043.
2354. gbinv1044.seq - Invertebrate sequence entries, part 1044.
2355. gbinv1045.seq - Invertebrate sequence entries, part 1045.
2356. gbinv1046.seq - Invertebrate sequence entries, part 1046.
2357. gbinv1047.seq - Invertebrate sequence entries, part 1047.
2358. gbinv1048.seq - Invertebrate sequence entries, part 1048.
2359. gbinv1049.seq - Invertebrate sequence entries, part 1049.
2360. gbinv105.seq - Invertebrate sequence entries, part 105.
2361. gbinv1050.seq - Invertebrate sequence entries, part 1050.
2362. gbinv1051.seq - Invertebrate sequence entries, part 1051.
2363. gbinv1052.seq - Invertebrate sequence entries, part 1052.
2364. gbinv1053.seq - Invertebrate sequence entries, part 1053.
2365. gbinv1054.seq - Invertebrate sequence entries, part 1054.
2366. gbinv1055.seq - Invertebrate sequence entries, part 1055.
2367. gbinv1056.seq - Invertebrate sequence entries, part 1056.
2368. gbinv1057.seq - Invertebrate sequence entries, part 1057.
2369. gbinv1058.seq - Invertebrate sequence entries, part 1058.
2370. gbinv1059.seq - Invertebrate sequence entries, part 1059.
2371. gbinv106.seq - Invertebrate sequence entries, part 106.
2372. gbinv1060.seq - Invertebrate sequence entries, part 1060.
2373. gbinv1061.seq - Invertebrate sequence entries, part 1061.
2374. gbinv1062.seq - Invertebrate sequence entries, part 1062.
2375. gbinv1063.seq - Invertebrate sequence entries, part 1063.
2376. gbinv1064.seq - Invertebrate sequence entries, part 1064.
2377. gbinv1065.seq - Invertebrate sequence entries, part 1065.
2378. gbinv1066.seq - Invertebrate sequence entries, part 1066.
2379. gbinv1067.seq - Invertebrate sequence entries, part 1067.
2380. gbinv1068.seq - Invertebrate sequence entries, part 1068.
2381. gbinv1069.seq - Invertebrate sequence entries, part 1069.
2382. gbinv107.seq - Invertebrate sequence entries, part 107.
2383. gbinv1070.seq - Invertebrate sequence entries, part 1070.
2384. gbinv1071.seq - Invertebrate sequence entries, part 1071.
2385. gbinv1072.seq - Invertebrate sequence entries, part 1072.
2386. gbinv1073.seq - Invertebrate sequence entries, part 1073.
2387. gbinv1074.seq - Invertebrate sequence entries, part 1074.
2388. gbinv1075.seq - Invertebrate sequence entries, part 1075.
2389. gbinv1076.seq - Invertebrate sequence entries, part 1076.
2390. gbinv1077.seq - Invertebrate sequence entries, part 1077.
2391. gbinv1078.seq - Invertebrate sequence entries, part 1078.
2392. gbinv1079.seq - Invertebrate sequence entries, part 1079.
2393. gbinv108.seq - Invertebrate sequence entries, part 108.
2394. gbinv1080.seq - Invertebrate sequence entries, part 1080.
2395. gbinv1081.seq - Invertebrate sequence entries, part 1081.
2396. gbinv1082.seq - Invertebrate sequence entries, part 1082.
2397. gbinv1083.seq - Invertebrate sequence entries, part 1083.
2398. gbinv1084.seq - Invertebrate sequence entries, part 1084.
2399. gbinv1085.seq - Invertebrate sequence entries, part 1085.
2400. gbinv1086.seq - Invertebrate sequence entries, part 1086.
2401. gbinv1087.seq - Invertebrate sequence entries, part 1087.
2402. gbinv1088.seq - Invertebrate sequence entries, part 1088.
2403. gbinv1089.seq - Invertebrate sequence entries, part 1089.
2404. gbinv109.seq - Invertebrate sequence entries, part 109.
2405. gbinv1090.seq - Invertebrate sequence entries, part 1090.
2406. gbinv1091.seq - Invertebrate sequence entries, part 1091.
2407. gbinv1092.seq - Invertebrate sequence entries, part 1092.
2408. gbinv1093.seq - Invertebrate sequence entries, part 1093.
2409. gbinv1094.seq - Invertebrate sequence entries, part 1094.
2410. gbinv1095.seq - Invertebrate sequence entries, part 1095.
2411. gbinv1096.seq - Invertebrate sequence entries, part 1096.
2412. gbinv1097.seq - Invertebrate sequence entries, part 1097.
2413. gbinv1098.seq - Invertebrate sequence entries, part 1098.
2414. gbinv1099.seq - Invertebrate sequence entries, part 1099.
2415. gbinv11.seq - Invertebrate sequence entries, part 11.
2416. gbinv110.seq - Invertebrate sequence entries, part 110.
2417. gbinv1100.seq - Invertebrate sequence entries, part 1100.
2418. gbinv1101.seq - Invertebrate sequence entries, part 1101.
2419. gbinv1102.seq - Invertebrate sequence entries, part 1102.
2420. gbinv1103.seq - Invertebrate sequence entries, part 1103.
2421. gbinv1104.seq - Invertebrate sequence entries, part 1104.
2422. gbinv1105.seq - Invertebrate sequence entries, part 1105.
2423. gbinv1106.seq - Invertebrate sequence entries, part 1106.
2424. gbinv1107.seq - Invertebrate sequence entries, part 1107.
2425. gbinv1108.seq - Invertebrate sequence entries, part 1108.
2426. gbinv1109.seq - Invertebrate sequence entries, part 1109.
2427. gbinv111.seq - Invertebrate sequence entries, part 111.
2428. gbinv1110.seq - Invertebrate sequence entries, part 1110.
2429. gbinv1111.seq - Invertebrate sequence entries, part 1111.
2430. gbinv1112.seq - Invertebrate sequence entries, part 1112.
2431. gbinv1113.seq - Invertebrate sequence entries, part 1113.
2432. gbinv1114.seq - Invertebrate sequence entries, part 1114.
2433. gbinv1115.seq - Invertebrate sequence entries, part 1115.
2434. gbinv1116.seq - Invertebrate sequence entries, part 1116.
2435. gbinv1117.seq - Invertebrate sequence entries, part 1117.
2436. gbinv1118.seq - Invertebrate sequence entries, part 1118.
2437. gbinv1119.seq - Invertebrate sequence entries, part 1119.
2438. gbinv112.seq - Invertebrate sequence entries, part 112.
2439. gbinv1120.seq - Invertebrate sequence entries, part 1120.
2440. gbinv1121.seq - Invertebrate sequence entries, part 1121.
2441. gbinv1122.seq - Invertebrate sequence entries, part 1122.
2442. gbinv1123.seq - Invertebrate sequence entries, part 1123.
2443. gbinv1124.seq - Invertebrate sequence entries, part 1124.
2444. gbinv1125.seq - Invertebrate sequence entries, part 1125.
2445. gbinv1126.seq - Invertebrate sequence entries, part 1126.
2446. gbinv1127.seq - Invertebrate sequence entries, part 1127.
2447. gbinv1128.seq - Invertebrate sequence entries, part 1128.
2448. gbinv1129.seq - Invertebrate sequence entries, part 1129.
2449. gbinv113.seq - Invertebrate sequence entries, part 113.
2450. gbinv1130.seq - Invertebrate sequence entries, part 1130.
2451. gbinv1131.seq - Invertebrate sequence entries, part 1131.
2452. gbinv1132.seq - Invertebrate sequence entries, part 1132.
2453. gbinv1133.seq - Invertebrate sequence entries, part 1133.
2454. gbinv1134.seq - Invertebrate sequence entries, part 1134.
2455. gbinv1135.seq - Invertebrate sequence entries, part 1135.
2456. gbinv1136.seq - Invertebrate sequence entries, part 1136.
2457. gbinv1137.seq - Invertebrate sequence entries, part 1137.
2458. gbinv1138.seq - Invertebrate sequence entries, part 1138.
2459. gbinv1139.seq - Invertebrate sequence entries, part 1139.
2460. gbinv114.seq - Invertebrate sequence entries, part 114.
2461. gbinv1140.seq - Invertebrate sequence entries, part 1140.
2462. gbinv1141.seq - Invertebrate sequence entries, part 1141.
2463. gbinv1142.seq - Invertebrate sequence entries, part 1142.
2464. gbinv1143.seq - Invertebrate sequence entries, part 1143.
2465. gbinv1144.seq - Invertebrate sequence entries, part 1144.
2466. gbinv1145.seq - Invertebrate sequence entries, part 1145.
2467. gbinv1146.seq - Invertebrate sequence entries, part 1146.
2468. gbinv1147.seq - Invertebrate sequence entries, part 1147.
2469. gbinv1148.seq - Invertebrate sequence entries, part 1148.
2470. gbinv1149.seq - Invertebrate sequence entries, part 1149.
2471. gbinv115.seq - Invertebrate sequence entries, part 115.
2472. gbinv1150.seq - Invertebrate sequence entries, part 1150.
2473. gbinv1151.seq - Invertebrate sequence entries, part 1151.
2474. gbinv1152.seq - Invertebrate sequence entries, part 1152.
2475. gbinv1153.seq - Invertebrate sequence entries, part 1153.
2476. gbinv1154.seq - Invertebrate sequence entries, part 1154.
2477. gbinv1155.seq - Invertebrate sequence entries, part 1155.
2478. gbinv1156.seq - Invertebrate sequence entries, part 1156.
2479. gbinv1157.seq - Invertebrate sequence entries, part 1157.
2480. gbinv1158.seq - Invertebrate sequence entries, part 1158.
2481. gbinv1159.seq - Invertebrate sequence entries, part 1159.
2482. gbinv116.seq - Invertebrate sequence entries, part 116.
2483. gbinv1160.seq - Invertebrate sequence entries, part 1160.
2484. gbinv1161.seq - Invertebrate sequence entries, part 1161.
2485. gbinv1162.seq - Invertebrate sequence entries, part 1162.
2486. gbinv1163.seq - Invertebrate sequence entries, part 1163.
2487. gbinv1164.seq - Invertebrate sequence entries, part 1164.
2488. gbinv1165.seq - Invertebrate sequence entries, part 1165.
2489. gbinv1166.seq - Invertebrate sequence entries, part 1166.
2490. gbinv1167.seq - Invertebrate sequence entries, part 1167.
2491. gbinv1168.seq - Invertebrate sequence entries, part 1168.
2492. gbinv1169.seq - Invertebrate sequence entries, part 1169.
2493. gbinv117.seq - Invertebrate sequence entries, part 117.
2494. gbinv1170.seq - Invertebrate sequence entries, part 1170.
2495. gbinv1171.seq - Invertebrate sequence entries, part 1171.
2496. gbinv1172.seq - Invertebrate sequence entries, part 1172.
2497. gbinv1173.seq - Invertebrate sequence entries, part 1173.
2498. gbinv1174.seq - Invertebrate sequence entries, part 1174.
2499. gbinv1175.seq - Invertebrate sequence entries, part 1175.
2500. gbinv1176.seq - Invertebrate sequence entries, part 1176.
2501. gbinv1177.seq - Invertebrate sequence entries, part 1177.
2502. gbinv1178.seq - Invertebrate sequence entries, part 1178.
2503. gbinv1179.seq - Invertebrate sequence entries, part 1179.
2504. gbinv118.seq - Invertebrate sequence entries, part 118.
2505. gbinv1180.seq - Invertebrate sequence entries, part 1180.
2506. gbinv1181.seq - Invertebrate sequence entries, part 1181.
2507. gbinv1182.seq - Invertebrate sequence entries, part 1182.
2508. gbinv1183.seq - Invertebrate sequence entries, part 1183.
2509. gbinv1184.seq - Invertebrate sequence entries, part 1184.
2510. gbinv1185.seq - Invertebrate sequence entries, part 1185.
2511. gbinv1186.seq - Invertebrate sequence entries, part 1186.
2512. gbinv1187.seq - Invertebrate sequence entries, part 1187.
2513. gbinv1188.seq - Invertebrate sequence entries, part 1188.
2514. gbinv1189.seq - Invertebrate sequence entries, part 1189.
2515. gbinv119.seq - Invertebrate sequence entries, part 119.
2516. gbinv1190.seq - Invertebrate sequence entries, part 1190.
2517. gbinv1191.seq - Invertebrate sequence entries, part 1191.
2518. gbinv1192.seq - Invertebrate sequence entries, part 1192.
2519. gbinv1193.seq - Invertebrate sequence entries, part 1193.
2520. gbinv1194.seq - Invertebrate sequence entries, part 1194.
2521. gbinv1195.seq - Invertebrate sequence entries, part 1195.
2522. gbinv1196.seq - Invertebrate sequence entries, part 1196.
2523. gbinv1197.seq - Invertebrate sequence entries, part 1197.
2524. gbinv1198.seq - Invertebrate sequence entries, part 1198.
2525. gbinv1199.seq - Invertebrate sequence entries, part 1199.
2526. gbinv12.seq - Invertebrate sequence entries, part 12.
2527. gbinv120.seq - Invertebrate sequence entries, part 120.
2528. gbinv1200.seq - Invertebrate sequence entries, part 1200.
2529. gbinv1201.seq - Invertebrate sequence entries, part 1201.
2530. gbinv1202.seq - Invertebrate sequence entries, part 1202.
2531. gbinv1203.seq - Invertebrate sequence entries, part 1203.
2532. gbinv1204.seq - Invertebrate sequence entries, part 1204.
2533. gbinv1205.seq - Invertebrate sequence entries, part 1205.
2534. gbinv1206.seq - Invertebrate sequence entries, part 1206.
2535. gbinv1207.seq - Invertebrate sequence entries, part 1207.
2536. gbinv1208.seq - Invertebrate sequence entries, part 1208.
2537. gbinv1209.seq - Invertebrate sequence entries, part 1209.
2538. gbinv121.seq - Invertebrate sequence entries, part 121.
2539. gbinv1210.seq - Invertebrate sequence entries, part 1210.
2540. gbinv1211.seq - Invertebrate sequence entries, part 1211.
2541. gbinv1212.seq - Invertebrate sequence entries, part 1212.
2542. gbinv1213.seq - Invertebrate sequence entries, part 1213.
2543. gbinv1214.seq - Invertebrate sequence entries, part 1214.
2544. gbinv1215.seq - Invertebrate sequence entries, part 1215.
2545. gbinv1216.seq - Invertebrate sequence entries, part 1216.
2546. gbinv1217.seq - Invertebrate sequence entries, part 1217.
2547. gbinv1218.seq - Invertebrate sequence entries, part 1218.
2548. gbinv1219.seq - Invertebrate sequence entries, part 1219.
2549. gbinv122.seq - Invertebrate sequence entries, part 122.
2550. gbinv1220.seq - Invertebrate sequence entries, part 1220.
2551. gbinv1221.seq - Invertebrate sequence entries, part 1221.
2552. gbinv1222.seq - Invertebrate sequence entries, part 1222.
2553. gbinv1223.seq - Invertebrate sequence entries, part 1223.
2554. gbinv1224.seq - Invertebrate sequence entries, part 1224.
2555. gbinv1225.seq - Invertebrate sequence entries, part 1225.
2556. gbinv1226.seq - Invertebrate sequence entries, part 1226.
2557. gbinv1227.seq - Invertebrate sequence entries, part 1227.
2558. gbinv1228.seq - Invertebrate sequence entries, part 1228.
2559. gbinv1229.seq - Invertebrate sequence entries, part 1229.
2560. gbinv123.seq - Invertebrate sequence entries, part 123.
2561. gbinv1230.seq - Invertebrate sequence entries, part 1230.
2562. gbinv1231.seq - Invertebrate sequence entries, part 1231.
2563. gbinv1232.seq - Invertebrate sequence entries, part 1232.
2564. gbinv1233.seq - Invertebrate sequence entries, part 1233.
2565. gbinv1234.seq - Invertebrate sequence entries, part 1234.
2566. gbinv1235.seq - Invertebrate sequence entries, part 1235.
2567. gbinv1236.seq - Invertebrate sequence entries, part 1236.
2568. gbinv1237.seq - Invertebrate sequence entries, part 1237.
2569. gbinv1238.seq - Invertebrate sequence entries, part 1238.
2570. gbinv1239.seq - Invertebrate sequence entries, part 1239.
2571. gbinv124.seq - Invertebrate sequence entries, part 124.
2572. gbinv1240.seq - Invertebrate sequence entries, part 1240.
2573. gbinv1241.seq - Invertebrate sequence entries, part 1241.
2574. gbinv1242.seq - Invertebrate sequence entries, part 1242.
2575. gbinv1243.seq - Invertebrate sequence entries, part 1243.
2576. gbinv1244.seq - Invertebrate sequence entries, part 1244.
2577. gbinv1245.seq - Invertebrate sequence entries, part 1245.
2578. gbinv1246.seq - Invertebrate sequence entries, part 1246.
2579. gbinv1247.seq - Invertebrate sequence entries, part 1247.
2580. gbinv1248.seq - Invertebrate sequence entries, part 1248.
2581. gbinv1249.seq - Invertebrate sequence entries, part 1249.
2582. gbinv125.seq - Invertebrate sequence entries, part 125.
2583. gbinv1250.seq - Invertebrate sequence entries, part 1250.
2584. gbinv1251.seq - Invertebrate sequence entries, part 1251.
2585. gbinv1252.seq - Invertebrate sequence entries, part 1252.
2586. gbinv1253.seq - Invertebrate sequence entries, part 1253.
2587. gbinv1254.seq - Invertebrate sequence entries, part 1254.
2588. gbinv1255.seq - Invertebrate sequence entries, part 1255.
2589. gbinv1256.seq - Invertebrate sequence entries, part 1256.
2590. gbinv1257.seq - Invertebrate sequence entries, part 1257.
2591. gbinv1258.seq - Invertebrate sequence entries, part 1258.
2592. gbinv1259.seq - Invertebrate sequence entries, part 1259.
2593. gbinv126.seq - Invertebrate sequence entries, part 126.
2594. gbinv1260.seq - Invertebrate sequence entries, part 1260.
2595. gbinv1261.seq - Invertebrate sequence entries, part 1261.
2596. gbinv1262.seq - Invertebrate sequence entries, part 1262.
2597. gbinv1263.seq - Invertebrate sequence entries, part 1263.
2598. gbinv1264.seq - Invertebrate sequence entries, part 1264.
2599. gbinv1265.seq - Invertebrate sequence entries, part 1265.
2600. gbinv1266.seq - Invertebrate sequence entries, part 1266.
2601. gbinv1267.seq - Invertebrate sequence entries, part 1267.
2602. gbinv1268.seq - Invertebrate sequence entries, part 1268.
2603. gbinv1269.seq - Invertebrate sequence entries, part 1269.
2604. gbinv127.seq - Invertebrate sequence entries, part 127.
2605. gbinv1270.seq - Invertebrate sequence entries, part 1270.
2606. gbinv1271.seq - Invertebrate sequence entries, part 1271.
2607. gbinv1272.seq - Invertebrate sequence entries, part 1272.
2608. gbinv1273.seq - Invertebrate sequence entries, part 1273.
2609. gbinv1274.seq - Invertebrate sequence entries, part 1274.
2610. gbinv1275.seq - Invertebrate sequence entries, part 1275.
2611. gbinv1276.seq - Invertebrate sequence entries, part 1276.
2612. gbinv1277.seq - Invertebrate sequence entries, part 1277.
2613. gbinv1278.seq - Invertebrate sequence entries, part 1278.
2614. gbinv1279.seq - Invertebrate sequence entries, part 1279.
2615. gbinv128.seq - Invertebrate sequence entries, part 128.
2616. gbinv1280.seq - Invertebrate sequence entries, part 1280.
2617. gbinv1281.seq - Invertebrate sequence entries, part 1281.
2618. gbinv1282.seq - Invertebrate sequence entries, part 1282.
2619. gbinv1283.seq - Invertebrate sequence entries, part 1283.
2620. gbinv1284.seq - Invertebrate sequence entries, part 1284.
2621. gbinv1285.seq - Invertebrate sequence entries, part 1285.
2622. gbinv1286.seq - Invertebrate sequence entries, part 1286.
2623. gbinv1287.seq - Invertebrate sequence entries, part 1287.
2624. gbinv1288.seq - Invertebrate sequence entries, part 1288.
2625. gbinv1289.seq - Invertebrate sequence entries, part 1289.
2626. gbinv129.seq - Invertebrate sequence entries, part 129.
2627. gbinv1290.seq - Invertebrate sequence entries, part 1290.
2628. gbinv1291.seq - Invertebrate sequence entries, part 1291.
2629. gbinv1292.seq - Invertebrate sequence entries, part 1292.
2630. gbinv1293.seq - Invertebrate sequence entries, part 1293.
2631. gbinv1294.seq - Invertebrate sequence entries, part 1294.
2632. gbinv1295.seq - Invertebrate sequence entries, part 1295.
2633. gbinv1296.seq - Invertebrate sequence entries, part 1296.
2634. gbinv1297.seq - Invertebrate sequence entries, part 1297.
2635. gbinv1298.seq - Invertebrate sequence entries, part 1298.
2636. gbinv1299.seq - Invertebrate sequence entries, part 1299.
2637. gbinv13.seq - Invertebrate sequence entries, part 13.
2638. gbinv130.seq - Invertebrate sequence entries, part 130.
2639. gbinv1300.seq - Invertebrate sequence entries, part 1300.
2640. gbinv1301.seq - Invertebrate sequence entries, part 1301.
2641. gbinv1302.seq - Invertebrate sequence entries, part 1302.
2642. gbinv1303.seq - Invertebrate sequence entries, part 1303.
2643. gbinv1304.seq - Invertebrate sequence entries, part 1304.
2644. gbinv1305.seq - Invertebrate sequence entries, part 1305.
2645. gbinv1306.seq - Invertebrate sequence entries, part 1306.
2646. gbinv1307.seq - Invertebrate sequence entries, part 1307.
2647. gbinv1308.seq - Invertebrate sequence entries, part 1308.
2648. gbinv1309.seq - Invertebrate sequence entries, part 1309.
2649. gbinv131.seq - Invertebrate sequence entries, part 131.
2650. gbinv1310.seq - Invertebrate sequence entries, part 1310.
2651. gbinv1311.seq - Invertebrate sequence entries, part 1311.
2652. gbinv1312.seq - Invertebrate sequence entries, part 1312.
2653. gbinv1313.seq - Invertebrate sequence entries, part 1313.
2654. gbinv1314.seq - Invertebrate sequence entries, part 1314.
2655. gbinv1315.seq - Invertebrate sequence entries, part 1315.
2656. gbinv1316.seq - Invertebrate sequence entries, part 1316.
2657. gbinv1317.seq - Invertebrate sequence entries, part 1317.
2658. gbinv1318.seq - Invertebrate sequence entries, part 1318.
2659. gbinv1319.seq - Invertebrate sequence entries, part 1319.
2660. gbinv132.seq - Invertebrate sequence entries, part 132.
2661. gbinv1320.seq - Invertebrate sequence entries, part 1320.
2662. gbinv1321.seq - Invertebrate sequence entries, part 1321.
2663. gbinv1322.seq - Invertebrate sequence entries, part 1322.
2664. gbinv1323.seq - Invertebrate sequence entries, part 1323.
2665. gbinv1324.seq - Invertebrate sequence entries, part 1324.
2666. gbinv1325.seq - Invertebrate sequence entries, part 1325.
2667. gbinv1326.seq - Invertebrate sequence entries, part 1326.
2668. gbinv1327.seq - Invertebrate sequence entries, part 1327.
2669. gbinv1328.seq - Invertebrate sequence entries, part 1328.
2670. gbinv1329.seq - Invertebrate sequence entries, part 1329.
2671. gbinv133.seq - Invertebrate sequence entries, part 133.
2672. gbinv1330.seq - Invertebrate sequence entries, part 1330.
2673. gbinv1331.seq - Invertebrate sequence entries, part 1331.
2674. gbinv1332.seq - Invertebrate sequence entries, part 1332.
2675. gbinv1333.seq - Invertebrate sequence entries, part 1333.
2676. gbinv1334.seq - Invertebrate sequence entries, part 1334.
2677. gbinv1335.seq - Invertebrate sequence entries, part 1335.
2678. gbinv1336.seq - Invertebrate sequence entries, part 1336.
2679. gbinv1337.seq - Invertebrate sequence entries, part 1337.
2680. gbinv1338.seq - Invertebrate sequence entries, part 1338.
2681. gbinv1339.seq - Invertebrate sequence entries, part 1339.
2682. gbinv134.seq - Invertebrate sequence entries, part 134.
2683. gbinv1340.seq - Invertebrate sequence entries, part 1340.
2684. gbinv1341.seq - Invertebrate sequence entries, part 1341.
2685. gbinv1342.seq - Invertebrate sequence entries, part 1342.
2686. gbinv1343.seq - Invertebrate sequence entries, part 1343.
2687. gbinv1344.seq - Invertebrate sequence entries, part 1344.
2688. gbinv1345.seq - Invertebrate sequence entries, part 1345.
2689. gbinv1346.seq - Invertebrate sequence entries, part 1346.
2690. gbinv1347.seq - Invertebrate sequence entries, part 1347.
2691. gbinv1348.seq - Invertebrate sequence entries, part 1348.
2692. gbinv1349.seq - Invertebrate sequence entries, part 1349.
2693. gbinv135.seq - Invertebrate sequence entries, part 135.
2694. gbinv1350.seq - Invertebrate sequence entries, part 1350.
2695. gbinv1351.seq - Invertebrate sequence entries, part 1351.
2696. gbinv1352.seq - Invertebrate sequence entries, part 1352.
2697. gbinv1353.seq - Invertebrate sequence entries, part 1353.
2698. gbinv1354.seq - Invertebrate sequence entries, part 1354.
2699. gbinv1355.seq - Invertebrate sequence entries, part 1355.
2700. gbinv1356.seq - Invertebrate sequence entries, part 1356.
2701. gbinv1357.seq - Invertebrate sequence entries, part 1357.
2702. gbinv1358.seq - Invertebrate sequence entries, part 1358.
2703. gbinv1359.seq - Invertebrate sequence entries, part 1359.
2704. gbinv136.seq - Invertebrate sequence entries, part 136.
2705. gbinv1360.seq - Invertebrate sequence entries, part 1360.
2706. gbinv1361.seq - Invertebrate sequence entries, part 1361.
2707. gbinv1362.seq - Invertebrate sequence entries, part 1362.
2708. gbinv1363.seq - Invertebrate sequence entries, part 1363.
2709. gbinv1364.seq - Invertebrate sequence entries, part 1364.
2710. gbinv1365.seq - Invertebrate sequence entries, part 1365.
2711. gbinv1366.seq - Invertebrate sequence entries, part 1366.
2712. gbinv1367.seq - Invertebrate sequence entries, part 1367.
2713. gbinv1368.seq - Invertebrate sequence entries, part 1368.
2714. gbinv1369.seq - Invertebrate sequence entries, part 1369.
2715. gbinv137.seq - Invertebrate sequence entries, part 137.
2716. gbinv1370.seq - Invertebrate sequence entries, part 1370.
2717. gbinv1371.seq - Invertebrate sequence entries, part 1371.
2718. gbinv1372.seq - Invertebrate sequence entries, part 1372.
2719. gbinv1373.seq - Invertebrate sequence entries, part 1373.
2720. gbinv1374.seq - Invertebrate sequence entries, part 1374.
2721. gbinv1375.seq - Invertebrate sequence entries, part 1375.
2722. gbinv1376.seq - Invertebrate sequence entries, part 1376.
2723. gbinv1377.seq - Invertebrate sequence entries, part 1377.
2724. gbinv1378.seq - Invertebrate sequence entries, part 1378.
2725. gbinv1379.seq - Invertebrate sequence entries, part 1379.
2726. gbinv138.seq - Invertebrate sequence entries, part 138.
2727. gbinv1380.seq - Invertebrate sequence entries, part 1380.
2728. gbinv1381.seq - Invertebrate sequence entries, part 1381.
2729. gbinv1382.seq - Invertebrate sequence entries, part 1382.
2730. gbinv1383.seq - Invertebrate sequence entries, part 1383.
2731. gbinv1384.seq - Invertebrate sequence entries, part 1384.
2732. gbinv1385.seq - Invertebrate sequence entries, part 1385.
2733. gbinv1386.seq - Invertebrate sequence entries, part 1386.
2734. gbinv1387.seq - Invertebrate sequence entries, part 1387.
2735. gbinv1388.seq - Invertebrate sequence entries, part 1388.
2736. gbinv1389.seq - Invertebrate sequence entries, part 1389.
2737. gbinv139.seq - Invertebrate sequence entries, part 139.
2738. gbinv1390.seq - Invertebrate sequence entries, part 1390.
2739. gbinv1391.seq - Invertebrate sequence entries, part 1391.
2740. gbinv1392.seq - Invertebrate sequence entries, part 1392.
2741. gbinv1393.seq - Invertebrate sequence entries, part 1393.
2742. gbinv1394.seq - Invertebrate sequence entries, part 1394.
2743. gbinv1395.seq - Invertebrate sequence entries, part 1395.
2744. gbinv1396.seq - Invertebrate sequence entries, part 1396.
2745. gbinv1397.seq - Invertebrate sequence entries, part 1397.
2746. gbinv1398.seq - Invertebrate sequence entries, part 1398.
2747. gbinv1399.seq - Invertebrate sequence entries, part 1399.
2748. gbinv14.seq - Invertebrate sequence entries, part 14.
2749. gbinv140.seq - Invertebrate sequence entries, part 140.
2750. gbinv1400.seq - Invertebrate sequence entries, part 1400.
2751. gbinv1401.seq - Invertebrate sequence entries, part 1401.
2752. gbinv1402.seq - Invertebrate sequence entries, part 1402.
2753. gbinv1403.seq - Invertebrate sequence entries, part 1403.
2754. gbinv1404.seq - Invertebrate sequence entries, part 1404.
2755. gbinv1405.seq - Invertebrate sequence entries, part 1405.
2756. gbinv1406.seq - Invertebrate sequence entries, part 1406.
2757. gbinv1407.seq - Invertebrate sequence entries, part 1407.
2758. gbinv1408.seq - Invertebrate sequence entries, part 1408.
2759. gbinv1409.seq - Invertebrate sequence entries, part 1409.
2760. gbinv141.seq - Invertebrate sequence entries, part 141.
2761. gbinv1410.seq - Invertebrate sequence entries, part 1410.
2762. gbinv1411.seq - Invertebrate sequence entries, part 1411.
2763. gbinv1412.seq - Invertebrate sequence entries, part 1412.
2764. gbinv1413.seq - Invertebrate sequence entries, part 1413.
2765. gbinv1414.seq - Invertebrate sequence entries, part 1414.
2766. gbinv1415.seq - Invertebrate sequence entries, part 1415.
2767. gbinv1416.seq - Invertebrate sequence entries, part 1416.
2768. gbinv1417.seq - Invertebrate sequence entries, part 1417.
2769. gbinv1418.seq - Invertebrate sequence entries, part 1418.
2770. gbinv1419.seq - Invertebrate sequence entries, part 1419.
2771. gbinv142.seq - Invertebrate sequence entries, part 142.
2772. gbinv1420.seq - Invertebrate sequence entries, part 1420.
2773. gbinv1421.seq - Invertebrate sequence entries, part 1421.
2774. gbinv1422.seq - Invertebrate sequence entries, part 1422.
2775. gbinv1423.seq - Invertebrate sequence entries, part 1423.
2776. gbinv1424.seq - Invertebrate sequence entries, part 1424.
2777. gbinv1425.seq - Invertebrate sequence entries, part 1425.
2778. gbinv1426.seq - Invertebrate sequence entries, part 1426.
2779. gbinv1427.seq - Invertebrate sequence entries, part 1427.
2780. gbinv1428.seq - Invertebrate sequence entries, part 1428.
2781. gbinv1429.seq - Invertebrate sequence entries, part 1429.
2782. gbinv143.seq - Invertebrate sequence entries, part 143.
2783. gbinv1430.seq - Invertebrate sequence entries, part 1430.
2784. gbinv1431.seq - Invertebrate sequence entries, part 1431.
2785. gbinv1432.seq - Invertebrate sequence entries, part 1432.
2786. gbinv1433.seq - Invertebrate sequence entries, part 1433.
2787. gbinv1434.seq - Invertebrate sequence entries, part 1434.
2788. gbinv1435.seq - Invertebrate sequence entries, part 1435.
2789. gbinv1436.seq - Invertebrate sequence entries, part 1436.
2790. gbinv1437.seq - Invertebrate sequence entries, part 1437.
2791. gbinv1438.seq - Invertebrate sequence entries, part 1438.
2792. gbinv1439.seq - Invertebrate sequence entries, part 1439.
2793. gbinv144.seq - Invertebrate sequence entries, part 144.
2794. gbinv1440.seq - Invertebrate sequence entries, part 1440.
2795. gbinv1441.seq - Invertebrate sequence entries, part 1441.
2796. gbinv1442.seq - Invertebrate sequence entries, part 1442.
2797. gbinv1443.seq - Invertebrate sequence entries, part 1443.
2798. gbinv1444.seq - Invertebrate sequence entries, part 1444.
2799. gbinv1445.seq - Invertebrate sequence entries, part 1445.
2800. gbinv1446.seq - Invertebrate sequence entries, part 1446.
2801. gbinv1447.seq - Invertebrate sequence entries, part 1447.
2802. gbinv1448.seq - Invertebrate sequence entries, part 1448.
2803. gbinv1449.seq - Invertebrate sequence entries, part 1449.
2804. gbinv145.seq - Invertebrate sequence entries, part 145.
2805. gbinv1450.seq - Invertebrate sequence entries, part 1450.
2806. gbinv1451.seq - Invertebrate sequence entries, part 1451.
2807. gbinv1452.seq - Invertebrate sequence entries, part 1452.
2808. gbinv1453.seq - Invertebrate sequence entries, part 1453.
2809. gbinv1454.seq - Invertebrate sequence entries, part 1454.
2810. gbinv1455.seq - Invertebrate sequence entries, part 1455.
2811. gbinv1456.seq - Invertebrate sequence entries, part 1456.
2812. gbinv1457.seq - Invertebrate sequence entries, part 1457.
2813. gbinv1458.seq - Invertebrate sequence entries, part 1458.
2814. gbinv1459.seq - Invertebrate sequence entries, part 1459.
2815. gbinv146.seq - Invertebrate sequence entries, part 146.
2816. gbinv1460.seq - Invertebrate sequence entries, part 1460.
2817. gbinv1461.seq - Invertebrate sequence entries, part 1461.
2818. gbinv1462.seq - Invertebrate sequence entries, part 1462.
2819. gbinv1463.seq - Invertebrate sequence entries, part 1463.
2820. gbinv1464.seq - Invertebrate sequence entries, part 1464.
2821. gbinv1465.seq - Invertebrate sequence entries, part 1465.
2822. gbinv1466.seq - Invertebrate sequence entries, part 1466.
2823. gbinv1467.seq - Invertebrate sequence entries, part 1467.
2824. gbinv1468.seq - Invertebrate sequence entries, part 1468.
2825. gbinv1469.seq - Invertebrate sequence entries, part 1469.
2826. gbinv147.seq - Invertebrate sequence entries, part 147.
2827. gbinv1470.seq - Invertebrate sequence entries, part 1470.
2828. gbinv1471.seq - Invertebrate sequence entries, part 1471.
2829. gbinv1472.seq - Invertebrate sequence entries, part 1472.
2830. gbinv1473.seq - Invertebrate sequence entries, part 1473.
2831. gbinv1474.seq - Invertebrate sequence entries, part 1474.
2832. gbinv1475.seq - Invertebrate sequence entries, part 1475.
2833. gbinv1476.seq - Invertebrate sequence entries, part 1476.
2834. gbinv1477.seq - Invertebrate sequence entries, part 1477.
2835. gbinv1478.seq - Invertebrate sequence entries, part 1478.
2836. gbinv1479.seq - Invertebrate sequence entries, part 1479.
2837. gbinv148.seq - Invertebrate sequence entries, part 148.
2838. gbinv1480.seq - Invertebrate sequence entries, part 1480.
2839. gbinv1481.seq - Invertebrate sequence entries, part 1481.
2840. gbinv1482.seq - Invertebrate sequence entries, part 1482.
2841. gbinv1483.seq - Invertebrate sequence entries, part 1483.
2842. gbinv1484.seq - Invertebrate sequence entries, part 1484.
2843. gbinv1485.seq - Invertebrate sequence entries, part 1485.
2844. gbinv1486.seq - Invertebrate sequence entries, part 1486.
2845. gbinv1487.seq - Invertebrate sequence entries, part 1487.
2846. gbinv1488.seq - Invertebrate sequence entries, part 1488.
2847. gbinv1489.seq - Invertebrate sequence entries, part 1489.
2848. gbinv149.seq - Invertebrate sequence entries, part 149.
2849. gbinv1490.seq - Invertebrate sequence entries, part 1490.
2850. gbinv1491.seq - Invertebrate sequence entries, part 1491.
2851. gbinv1492.seq - Invertebrate sequence entries, part 1492.
2852. gbinv1493.seq - Invertebrate sequence entries, part 1493.
2853. gbinv1494.seq - Invertebrate sequence entries, part 1494.
2854. gbinv1495.seq - Invertebrate sequence entries, part 1495.
2855. gbinv1496.seq - Invertebrate sequence entries, part 1496.
2856. gbinv1497.seq - Invertebrate sequence entries, part 1497.
2857. gbinv1498.seq - Invertebrate sequence entries, part 1498.
2858. gbinv1499.seq - Invertebrate sequence entries, part 1499.
2859. gbinv15.seq - Invertebrate sequence entries, part 15.
2860. gbinv150.seq - Invertebrate sequence entries, part 150.
2861. gbinv1500.seq - Invertebrate sequence entries, part 1500.
2862. gbinv1501.seq - Invertebrate sequence entries, part 1501.
2863. gbinv1502.seq - Invertebrate sequence entries, part 1502.
2864. gbinv1503.seq - Invertebrate sequence entries, part 1503.
2865. gbinv1504.seq - Invertebrate sequence entries, part 1504.
2866. gbinv1505.seq - Invertebrate sequence entries, part 1505.
2867. gbinv1506.seq - Invertebrate sequence entries, part 1506.
2868. gbinv1507.seq - Invertebrate sequence entries, part 1507.
2869. gbinv1508.seq - Invertebrate sequence entries, part 1508.
2870. gbinv1509.seq - Invertebrate sequence entries, part 1509.
2871. gbinv151.seq - Invertebrate sequence entries, part 151.
2872. gbinv1510.seq - Invertebrate sequence entries, part 1510.
2873. gbinv1511.seq - Invertebrate sequence entries, part 1511.
2874. gbinv1512.seq - Invertebrate sequence entries, part 1512.
2875. gbinv1513.seq - Invertebrate sequence entries, part 1513.
2876. gbinv1514.seq - Invertebrate sequence entries, part 1514.
2877. gbinv1515.seq - Invertebrate sequence entries, part 1515.
2878. gbinv1516.seq - Invertebrate sequence entries, part 1516.
2879. gbinv1517.seq - Invertebrate sequence entries, part 1517.
2880. gbinv1518.seq - Invertebrate sequence entries, part 1518.
2881. gbinv1519.seq - Invertebrate sequence entries, part 1519.
2882. gbinv152.seq - Invertebrate sequence entries, part 152.
2883. gbinv1520.seq - Invertebrate sequence entries, part 1520.
2884. gbinv1521.seq - Invertebrate sequence entries, part 1521.
2885. gbinv1522.seq - Invertebrate sequence entries, part 1522.
2886. gbinv1523.seq - Invertebrate sequence entries, part 1523.
2887. gbinv1524.seq - Invertebrate sequence entries, part 1524.
2888. gbinv1525.seq - Invertebrate sequence entries, part 1525.
2889. gbinv1526.seq - Invertebrate sequence entries, part 1526.
2890. gbinv1527.seq - Invertebrate sequence entries, part 1527.
2891. gbinv1528.seq - Invertebrate sequence entries, part 1528.
2892. gbinv1529.seq - Invertebrate sequence entries, part 1529.
2893. gbinv153.seq - Invertebrate sequence entries, part 153.
2894. gbinv1530.seq - Invertebrate sequence entries, part 1530.
2895. gbinv1531.seq - Invertebrate sequence entries, part 1531.
2896. gbinv1532.seq - Invertebrate sequence entries, part 1532.
2897. gbinv1533.seq - Invertebrate sequence entries, part 1533.
2898. gbinv1534.seq - Invertebrate sequence entries, part 1534.
2899. gbinv1535.seq - Invertebrate sequence entries, part 1535.
2900. gbinv1536.seq - Invertebrate sequence entries, part 1536.
2901. gbinv1537.seq - Invertebrate sequence entries, part 1537.
2902. gbinv1538.seq - Invertebrate sequence entries, part 1538.
2903. gbinv1539.seq - Invertebrate sequence entries, part 1539.
2904. gbinv154.seq - Invertebrate sequence entries, part 154.
2905. gbinv1540.seq - Invertebrate sequence entries, part 1540.
2906. gbinv1541.seq - Invertebrate sequence entries, part 1541.
2907. gbinv1542.seq - Invertebrate sequence entries, part 1542.
2908. gbinv1543.seq - Invertebrate sequence entries, part 1543.
2909. gbinv1544.seq - Invertebrate sequence entries, part 1544.
2910. gbinv1545.seq - Invertebrate sequence entries, part 1545.
2911. gbinv1546.seq - Invertebrate sequence entries, part 1546.
2912. gbinv1547.seq - Invertebrate sequence entries, part 1547.
2913. gbinv1548.seq - Invertebrate sequence entries, part 1548.
2914. gbinv1549.seq - Invertebrate sequence entries, part 1549.
2915. gbinv155.seq - Invertebrate sequence entries, part 155.
2916. gbinv1550.seq - Invertebrate sequence entries, part 1550.
2917. gbinv1551.seq - Invertebrate sequence entries, part 1551.
2918. gbinv1552.seq - Invertebrate sequence entries, part 1552.
2919. gbinv1553.seq - Invertebrate sequence entries, part 1553.
2920. gbinv1554.seq - Invertebrate sequence entries, part 1554.
2921. gbinv1555.seq - Invertebrate sequence entries, part 1555.
2922. gbinv1556.seq - Invertebrate sequence entries, part 1556.
2923. gbinv1557.seq - Invertebrate sequence entries, part 1557.
2924. gbinv1558.seq - Invertebrate sequence entries, part 1558.
2925. gbinv1559.seq - Invertebrate sequence entries, part 1559.
2926. gbinv156.seq - Invertebrate sequence entries, part 156.
2927. gbinv1560.seq - Invertebrate sequence entries, part 1560.
2928. gbinv1561.seq - Invertebrate sequence entries, part 1561.
2929. gbinv1562.seq - Invertebrate sequence entries, part 1562.
2930. gbinv1563.seq - Invertebrate sequence entries, part 1563.
2931. gbinv1564.seq - Invertebrate sequence entries, part 1564.
2932. gbinv1565.seq - Invertebrate sequence entries, part 1565.
2933. gbinv1566.seq - Invertebrate sequence entries, part 1566.
2934. gbinv1567.seq - Invertebrate sequence entries, part 1567.
2935. gbinv1568.seq - Invertebrate sequence entries, part 1568.
2936. gbinv1569.seq - Invertebrate sequence entries, part 1569.
2937. gbinv157.seq - Invertebrate sequence entries, part 157.
2938. gbinv1570.seq - Invertebrate sequence entries, part 1570.
2939. gbinv1571.seq - Invertebrate sequence entries, part 1571.
2940. gbinv1572.seq - Invertebrate sequence entries, part 1572.
2941. gbinv1573.seq - Invertebrate sequence entries, part 1573.
2942. gbinv1574.seq - Invertebrate sequence entries, part 1574.
2943. gbinv1575.seq - Invertebrate sequence entries, part 1575.
2944. gbinv1576.seq - Invertebrate sequence entries, part 1576.
2945. gbinv1577.seq - Invertebrate sequence entries, part 1577.
2946. gbinv1578.seq - Invertebrate sequence entries, part 1578.
2947. gbinv1579.seq - Invertebrate sequence entries, part 1579.
2948. gbinv158.seq - Invertebrate sequence entries, part 158.
2949. gbinv1580.seq - Invertebrate sequence entries, part 1580.
2950. gbinv1581.seq - Invertebrate sequence entries, part 1581.
2951. gbinv1582.seq - Invertebrate sequence entries, part 1582.
2952. gbinv1583.seq - Invertebrate sequence entries, part 1583.
2953. gbinv1584.seq - Invertebrate sequence entries, part 1584.
2954. gbinv1585.seq - Invertebrate sequence entries, part 1585.
2955. gbinv1586.seq - Invertebrate sequence entries, part 1586.
2956. gbinv1587.seq - Invertebrate sequence entries, part 1587.
2957. gbinv1588.seq - Invertebrate sequence entries, part 1588.
2958. gbinv1589.seq - Invertebrate sequence entries, part 1589.
2959. gbinv159.seq - Invertebrate sequence entries, part 159.
2960. gbinv1590.seq - Invertebrate sequence entries, part 1590.
2961. gbinv1591.seq - Invertebrate sequence entries, part 1591.
2962. gbinv1592.seq - Invertebrate sequence entries, part 1592.
2963. gbinv1593.seq - Invertebrate sequence entries, part 1593.
2964. gbinv1594.seq - Invertebrate sequence entries, part 1594.
2965. gbinv1595.seq - Invertebrate sequence entries, part 1595.
2966. gbinv1596.seq - Invertebrate sequence entries, part 1596.
2967. gbinv1597.seq - Invertebrate sequence entries, part 1597.
2968. gbinv1598.seq - Invertebrate sequence entries, part 1598.
2969. gbinv1599.seq - Invertebrate sequence entries, part 1599.
2970. gbinv16.seq - Invertebrate sequence entries, part 16.
2971. gbinv160.seq - Invertebrate sequence entries, part 160.
2972. gbinv1600.seq - Invertebrate sequence entries, part 1600.
2973. gbinv1601.seq - Invertebrate sequence entries, part 1601.
2974. gbinv1602.seq - Invertebrate sequence entries, part 1602.
2975. gbinv1603.seq - Invertebrate sequence entries, part 1603.
2976. gbinv1604.seq - Invertebrate sequence entries, part 1604.
2977. gbinv1605.seq - Invertebrate sequence entries, part 1605.
2978. gbinv1606.seq - Invertebrate sequence entries, part 1606.
2979. gbinv1607.seq - Invertebrate sequence entries, part 1607.
2980. gbinv1608.seq - Invertebrate sequence entries, part 1608.
2981. gbinv1609.seq - Invertebrate sequence entries, part 1609.
2982. gbinv161.seq - Invertebrate sequence entries, part 161.
2983. gbinv1610.seq - Invertebrate sequence entries, part 1610.
2984. gbinv1611.seq - Invertebrate sequence entries, part 1611.
2985. gbinv1612.seq - Invertebrate sequence entries, part 1612.
2986. gbinv1613.seq - Invertebrate sequence entries, part 1613.
2987. gbinv1614.seq - Invertebrate sequence entries, part 1614.
2988. gbinv1615.seq - Invertebrate sequence entries, part 1615.
2989. gbinv1616.seq - Invertebrate sequence entries, part 1616.
2990. gbinv1617.seq - Invertebrate sequence entries, part 1617.
2991. gbinv1618.seq - Invertebrate sequence entries, part 1618.
2992. gbinv1619.seq - Invertebrate sequence entries, part 1619.
2993. gbinv162.seq - Invertebrate sequence entries, part 162.
2994. gbinv1620.seq - Invertebrate sequence entries, part 1620.
2995. gbinv1621.seq - Invertebrate sequence entries, part 1621.
2996. gbinv1622.seq - Invertebrate sequence entries, part 1622.
2997. gbinv1623.seq - Invertebrate sequence entries, part 1623.
2998. gbinv1624.seq - Invertebrate sequence entries, part 1624.
2999. gbinv1625.seq - Invertebrate sequence entries, part 1625.
3000. gbinv1626.seq - Invertebrate sequence entries, part 1626.
3001. gbinv1627.seq - Invertebrate sequence entries, part 1627.
3002. gbinv1628.seq - Invertebrate sequence entries, part 1628.
3003. gbinv1629.seq - Invertebrate sequence entries, part 1629.
3004. gbinv163.seq - Invertebrate sequence entries, part 163.
3005. gbinv1630.seq - Invertebrate sequence entries, part 1630.
3006. gbinv1631.seq - Invertebrate sequence entries, part 1631.
3007. gbinv1632.seq - Invertebrate sequence entries, part 1632.
3008. gbinv1633.seq - Invertebrate sequence entries, part 1633.
3009. gbinv1634.seq - Invertebrate sequence entries, part 1634.
3010. gbinv1635.seq - Invertebrate sequence entries, part 1635.
3011. gbinv1636.seq - Invertebrate sequence entries, part 1636.
3012. gbinv1637.seq - Invertebrate sequence entries, part 1637.
3013. gbinv1638.seq - Invertebrate sequence entries, part 1638.
3014. gbinv1639.seq - Invertebrate sequence entries, part 1639.
3015. gbinv164.seq - Invertebrate sequence entries, part 164.
3016. gbinv1640.seq - Invertebrate sequence entries, part 1640.
3017. gbinv1641.seq - Invertebrate sequence entries, part 1641.
3018. gbinv1642.seq - Invertebrate sequence entries, part 1642.
3019. gbinv1643.seq - Invertebrate sequence entries, part 1643.
3020. gbinv1644.seq - Invertebrate sequence entries, part 1644.
3021. gbinv1645.seq - Invertebrate sequence entries, part 1645.
3022. gbinv1646.seq - Invertebrate sequence entries, part 1646.
3023. gbinv1647.seq - Invertebrate sequence entries, part 1647.
3024. gbinv1648.seq - Invertebrate sequence entries, part 1648.
3025. gbinv1649.seq - Invertebrate sequence entries, part 1649.
3026. gbinv165.seq - Invertebrate sequence entries, part 165.
3027. gbinv1650.seq - Invertebrate sequence entries, part 1650.
3028. gbinv1651.seq - Invertebrate sequence entries, part 1651.
3029. gbinv1652.seq - Invertebrate sequence entries, part 1652.
3030. gbinv1653.seq - Invertebrate sequence entries, part 1653.
3031. gbinv1654.seq - Invertebrate sequence entries, part 1654.
3032. gbinv1655.seq - Invertebrate sequence entries, part 1655.
3033. gbinv1656.seq - Invertebrate sequence entries, part 1656.
3034. gbinv1657.seq - Invertebrate sequence entries, part 1657.
3035. gbinv1658.seq - Invertebrate sequence entries, part 1658.
3036. gbinv1659.seq - Invertebrate sequence entries, part 1659.
3037. gbinv166.seq - Invertebrate sequence entries, part 166.
3038. gbinv1660.seq - Invertebrate sequence entries, part 1660.
3039. gbinv1661.seq - Invertebrate sequence entries, part 1661.
3040. gbinv1662.seq - Invertebrate sequence entries, part 1662.
3041. gbinv1663.seq - Invertebrate sequence entries, part 1663.
3042. gbinv1664.seq - Invertebrate sequence entries, part 1664.
3043. gbinv1665.seq - Invertebrate sequence entries, part 1665.
3044. gbinv1666.seq - Invertebrate sequence entries, part 1666.
3045. gbinv1667.seq - Invertebrate sequence entries, part 1667.
3046. gbinv1668.seq - Invertebrate sequence entries, part 1668.
3047. gbinv1669.seq - Invertebrate sequence entries, part 1669.
3048. gbinv167.seq - Invertebrate sequence entries, part 167.
3049. gbinv1670.seq - Invertebrate sequence entries, part 1670.
3050. gbinv1671.seq - Invertebrate sequence entries, part 1671.
3051. gbinv1672.seq - Invertebrate sequence entries, part 1672.
3052. gbinv1673.seq - Invertebrate sequence entries, part 1673.
3053. gbinv1674.seq - Invertebrate sequence entries, part 1674.
3054. gbinv1675.seq - Invertebrate sequence entries, part 1675.
3055. gbinv1676.seq - Invertebrate sequence entries, part 1676.
3056. gbinv1677.seq - Invertebrate sequence entries, part 1677.
3057. gbinv1678.seq - Invertebrate sequence entries, part 1678.
3058. gbinv1679.seq - Invertebrate sequence entries, part 1679.
3059. gbinv168.seq - Invertebrate sequence entries, part 168.
3060. gbinv1680.seq - Invertebrate sequence entries, part 1680.
3061. gbinv1681.seq - Invertebrate sequence entries, part 1681.
3062. gbinv1682.seq - Invertebrate sequence entries, part 1682.
3063. gbinv1683.seq - Invertebrate sequence entries, part 1683.
3064. gbinv1684.seq - Invertebrate sequence entries, part 1684.
3065. gbinv1685.seq - Invertebrate sequence entries, part 1685.
3066. gbinv1686.seq - Invertebrate sequence entries, part 1686.
3067. gbinv1687.seq - Invertebrate sequence entries, part 1687.
3068. gbinv1688.seq - Invertebrate sequence entries, part 1688.
3069. gbinv1689.seq - Invertebrate sequence entries, part 1689.
3070. gbinv169.seq - Invertebrate sequence entries, part 169.
3071. gbinv1690.seq - Invertebrate sequence entries, part 1690.
3072. gbinv1691.seq - Invertebrate sequence entries, part 1691.
3073. gbinv1692.seq - Invertebrate sequence entries, part 1692.
3074. gbinv1693.seq - Invertebrate sequence entries, part 1693.
3075. gbinv1694.seq - Invertebrate sequence entries, part 1694.
3076. gbinv1695.seq - Invertebrate sequence entries, part 1695.
3077. gbinv1696.seq - Invertebrate sequence entries, part 1696.
3078. gbinv1697.seq - Invertebrate sequence entries, part 1697.
3079. gbinv1698.seq - Invertebrate sequence entries, part 1698.
3080. gbinv1699.seq - Invertebrate sequence entries, part 1699.
3081. gbinv17.seq - Invertebrate sequence entries, part 17.
3082. gbinv170.seq - Invertebrate sequence entries, part 170.
3083. gbinv1700.seq - Invertebrate sequence entries, part 1700.
3084. gbinv1701.seq - Invertebrate sequence entries, part 1701.
3085. gbinv1702.seq - Invertebrate sequence entries, part 1702.
3086. gbinv1703.seq - Invertebrate sequence entries, part 1703.
3087. gbinv1704.seq - Invertebrate sequence entries, part 1704.
3088. gbinv1705.seq - Invertebrate sequence entries, part 1705.
3089. gbinv1706.seq - Invertebrate sequence entries, part 1706.
3090. gbinv1707.seq - Invertebrate sequence entries, part 1707.
3091. gbinv1708.seq - Invertebrate sequence entries, part 1708.
3092. gbinv1709.seq - Invertebrate sequence entries, part 1709.
3093. gbinv171.seq - Invertebrate sequence entries, part 171.
3094. gbinv1710.seq - Invertebrate sequence entries, part 1710.
3095. gbinv1711.seq - Invertebrate sequence entries, part 1711.
3096. gbinv1712.seq - Invertebrate sequence entries, part 1712.
3097. gbinv1713.seq - Invertebrate sequence entries, part 1713.
3098. gbinv1714.seq - Invertebrate sequence entries, part 1714.
3099. gbinv1715.seq - Invertebrate sequence entries, part 1715.
3100. gbinv1716.seq - Invertebrate sequence entries, part 1716.
3101. gbinv1717.seq - Invertebrate sequence entries, part 1717.
3102. gbinv1718.seq - Invertebrate sequence entries, part 1718.
3103. gbinv1719.seq - Invertebrate sequence entries, part 1719.
3104. gbinv172.seq - Invertebrate sequence entries, part 172.
3105. gbinv1720.seq - Invertebrate sequence entries, part 1720.
3106. gbinv1721.seq - Invertebrate sequence entries, part 1721.
3107. gbinv1722.seq - Invertebrate sequence entries, part 1722.
3108. gbinv1723.seq - Invertebrate sequence entries, part 1723.
3109. gbinv1724.seq - Invertebrate sequence entries, part 1724.
3110. gbinv1725.seq - Invertebrate sequence entries, part 1725.
3111. gbinv1726.seq - Invertebrate sequence entries, part 1726.
3112. gbinv1727.seq - Invertebrate sequence entries, part 1727.
3113. gbinv1728.seq - Invertebrate sequence entries, part 1728.
3114. gbinv1729.seq - Invertebrate sequence entries, part 1729.
3115. gbinv173.seq - Invertebrate sequence entries, part 173.
3116. gbinv1730.seq - Invertebrate sequence entries, part 1730.
3117. gbinv1731.seq - Invertebrate sequence entries, part 1731.
3118. gbinv1732.seq - Invertebrate sequence entries, part 1732.
3119. gbinv1733.seq - Invertebrate sequence entries, part 1733.
3120. gbinv1734.seq - Invertebrate sequence entries, part 1734.
3121. gbinv1735.seq - Invertebrate sequence entries, part 1735.
3122. gbinv1736.seq - Invertebrate sequence entries, part 1736.
3123. gbinv1737.seq - Invertebrate sequence entries, part 1737.
3124. gbinv1738.seq - Invertebrate sequence entries, part 1738.
3125. gbinv1739.seq - Invertebrate sequence entries, part 1739.
3126. gbinv174.seq - Invertebrate sequence entries, part 174.
3127. gbinv1740.seq - Invertebrate sequence entries, part 1740.
3128. gbinv1741.seq - Invertebrate sequence entries, part 1741.
3129. gbinv1742.seq - Invertebrate sequence entries, part 1742.
3130. gbinv1743.seq - Invertebrate sequence entries, part 1743.
3131. gbinv1744.seq - Invertebrate sequence entries, part 1744.
3132. gbinv1745.seq - Invertebrate sequence entries, part 1745.
3133. gbinv1746.seq - Invertebrate sequence entries, part 1746.
3134. gbinv1747.seq - Invertebrate sequence entries, part 1747.
3135. gbinv1748.seq - Invertebrate sequence entries, part 1748.
3136. gbinv1749.seq - Invertebrate sequence entries, part 1749.
3137. gbinv175.seq - Invertebrate sequence entries, part 175.
3138. gbinv1750.seq - Invertebrate sequence entries, part 1750.
3139. gbinv1751.seq - Invertebrate sequence entries, part 1751.
3140. gbinv1752.seq - Invertebrate sequence entries, part 1752.
3141. gbinv1753.seq - Invertebrate sequence entries, part 1753.
3142. gbinv1754.seq - Invertebrate sequence entries, part 1754.
3143. gbinv1755.seq - Invertebrate sequence entries, part 1755.
3144. gbinv1756.seq - Invertebrate sequence entries, part 1756.
3145. gbinv1757.seq - Invertebrate sequence entries, part 1757.
3146. gbinv1758.seq - Invertebrate sequence entries, part 1758.
3147. gbinv1759.seq - Invertebrate sequence entries, part 1759.
3148. gbinv176.seq - Invertebrate sequence entries, part 176.
3149. gbinv1760.seq - Invertebrate sequence entries, part 1760.
3150. gbinv1761.seq - Invertebrate sequence entries, part 1761.
3151. gbinv1762.seq - Invertebrate sequence entries, part 1762.
3152. gbinv1763.seq - Invertebrate sequence entries, part 1763.
3153. gbinv1764.seq - Invertebrate sequence entries, part 1764.
3154. gbinv1765.seq - Invertebrate sequence entries, part 1765.
3155. gbinv1766.seq - Invertebrate sequence entries, part 1766.
3156. gbinv1767.seq - Invertebrate sequence entries, part 1767.
3157. gbinv1768.seq - Invertebrate sequence entries, part 1768.
3158. gbinv1769.seq - Invertebrate sequence entries, part 1769.
3159. gbinv177.seq - Invertebrate sequence entries, part 177.
3160. gbinv1770.seq - Invertebrate sequence entries, part 1770.
3161. gbinv1771.seq - Invertebrate sequence entries, part 1771.
3162. gbinv1772.seq - Invertebrate sequence entries, part 1772.
3163. gbinv1773.seq - Invertebrate sequence entries, part 1773.
3164. gbinv1774.seq - Invertebrate sequence entries, part 1774.
3165. gbinv1775.seq - Invertebrate sequence entries, part 1775.
3166. gbinv1776.seq - Invertebrate sequence entries, part 1776.
3167. gbinv1777.seq - Invertebrate sequence entries, part 1777.
3168. gbinv1778.seq - Invertebrate sequence entries, part 1778.
3169. gbinv1779.seq - Invertebrate sequence entries, part 1779.
3170. gbinv178.seq - Invertebrate sequence entries, part 178.
3171. gbinv1780.seq - Invertebrate sequence entries, part 1780.
3172. gbinv1781.seq - Invertebrate sequence entries, part 1781.
3173. gbinv1782.seq - Invertebrate sequence entries, part 1782.
3174. gbinv1783.seq - Invertebrate sequence entries, part 1783.
3175. gbinv1784.seq - Invertebrate sequence entries, part 1784.
3176. gbinv1785.seq - Invertebrate sequence entries, part 1785.
3177. gbinv1786.seq - Invertebrate sequence entries, part 1786.
3178. gbinv1787.seq - Invertebrate sequence entries, part 1787.
3179. gbinv1788.seq - Invertebrate sequence entries, part 1788.
3180. gbinv1789.seq - Invertebrate sequence entries, part 1789.
3181. gbinv179.seq - Invertebrate sequence entries, part 179.
3182. gbinv1790.seq - Invertebrate sequence entries, part 1790.
3183. gbinv1791.seq - Invertebrate sequence entries, part 1791.
3184. gbinv1792.seq - Invertebrate sequence entries, part 1792.
3185. gbinv1793.seq - Invertebrate sequence entries, part 1793.
3186. gbinv1794.seq - Invertebrate sequence entries, part 1794.
3187. gbinv1795.seq - Invertebrate sequence entries, part 1795.
3188. gbinv1796.seq - Invertebrate sequence entries, part 1796.
3189. gbinv1797.seq - Invertebrate sequence entries, part 1797.
3190. gbinv1798.seq - Invertebrate sequence entries, part 1798.
3191. gbinv1799.seq - Invertebrate sequence entries, part 1799.
3192. gbinv18.seq - Invertebrate sequence entries, part 18.
3193. gbinv180.seq - Invertebrate sequence entries, part 180.
3194. gbinv1800.seq - Invertebrate sequence entries, part 1800.
3195. gbinv1801.seq - Invertebrate sequence entries, part 1801.
3196. gbinv1802.seq - Invertebrate sequence entries, part 1802.
3197. gbinv1803.seq - Invertebrate sequence entries, part 1803.
3198. gbinv1804.seq - Invertebrate sequence entries, part 1804.
3199. gbinv1805.seq - Invertebrate sequence entries, part 1805.
3200. gbinv1806.seq - Invertebrate sequence entries, part 1806.
3201. gbinv1807.seq - Invertebrate sequence entries, part 1807.
3202. gbinv1808.seq - Invertebrate sequence entries, part 1808.
3203. gbinv1809.seq - Invertebrate sequence entries, part 1809.
3204. gbinv181.seq - Invertebrate sequence entries, part 181.
3205. gbinv1810.seq - Invertebrate sequence entries, part 1810.
3206. gbinv1811.seq - Invertebrate sequence entries, part 1811.
3207. gbinv1812.seq - Invertebrate sequence entries, part 1812.
3208. gbinv1813.seq - Invertebrate sequence entries, part 1813.
3209. gbinv1814.seq - Invertebrate sequence entries, part 1814.
3210. gbinv1815.seq - Invertebrate sequence entries, part 1815.
3211. gbinv1816.seq - Invertebrate sequence entries, part 1816.
3212. gbinv1817.seq - Invertebrate sequence entries, part 1817.
3213. gbinv1818.seq - Invertebrate sequence entries, part 1818.
3214. gbinv1819.seq - Invertebrate sequence entries, part 1819.
3215. gbinv182.seq - Invertebrate sequence entries, part 182.
3216. gbinv1820.seq - Invertebrate sequence entries, part 1820.
3217. gbinv1821.seq - Invertebrate sequence entries, part 1821.
3218. gbinv1822.seq - Invertebrate sequence entries, part 1822.
3219. gbinv1823.seq - Invertebrate sequence entries, part 1823.
3220. gbinv1824.seq - Invertebrate sequence entries, part 1824.
3221. gbinv1825.seq - Invertebrate sequence entries, part 1825.
3222. gbinv1826.seq - Invertebrate sequence entries, part 1826.
3223. gbinv1827.seq - Invertebrate sequence entries, part 1827.
3224. gbinv1828.seq - Invertebrate sequence entries, part 1828.
3225. gbinv1829.seq - Invertebrate sequence entries, part 1829.
3226. gbinv183.seq - Invertebrate sequence entries, part 183.
3227. gbinv1830.seq - Invertebrate sequence entries, part 1830.
3228. gbinv1831.seq - Invertebrate sequence entries, part 1831.
3229. gbinv1832.seq - Invertebrate sequence entries, part 1832.
3230. gbinv1833.seq - Invertebrate sequence entries, part 1833.
3231. gbinv1834.seq - Invertebrate sequence entries, part 1834.
3232. gbinv1835.seq - Invertebrate sequence entries, part 1835.
3233. gbinv1836.seq - Invertebrate sequence entries, part 1836.
3234. gbinv1837.seq - Invertebrate sequence entries, part 1837.
3235. gbinv1838.seq - Invertebrate sequence entries, part 1838.
3236. gbinv1839.seq - Invertebrate sequence entries, part 1839.
3237. gbinv184.seq - Invertebrate sequence entries, part 184.
3238. gbinv1840.seq - Invertebrate sequence entries, part 1840.
3239. gbinv1841.seq - Invertebrate sequence entries, part 1841.
3240. gbinv1842.seq - Invertebrate sequence entries, part 1842.
3241. gbinv1843.seq - Invertebrate sequence entries, part 1843.
3242. gbinv1844.seq - Invertebrate sequence entries, part 1844.
3243. gbinv1845.seq - Invertebrate sequence entries, part 1845.
3244. gbinv1846.seq - Invertebrate sequence entries, part 1846.
3245. gbinv1847.seq - Invertebrate sequence entries, part 1847.
3246. gbinv1848.seq - Invertebrate sequence entries, part 1848.
3247. gbinv1849.seq - Invertebrate sequence entries, part 1849.
3248. gbinv185.seq - Invertebrate sequence entries, part 185.
3249. gbinv1850.seq - Invertebrate sequence entries, part 1850.
3250. gbinv1851.seq - Invertebrate sequence entries, part 1851.
3251. gbinv1852.seq - Invertebrate sequence entries, part 1852.
3252. gbinv1853.seq - Invertebrate sequence entries, part 1853.
3253. gbinv1854.seq - Invertebrate sequence entries, part 1854.
3254. gbinv1855.seq - Invertebrate sequence entries, part 1855.
3255. gbinv1856.seq - Invertebrate sequence entries, part 1856.
3256. gbinv1857.seq - Invertebrate sequence entries, part 1857.
3257. gbinv1858.seq - Invertebrate sequence entries, part 1858.
3258. gbinv1859.seq - Invertebrate sequence entries, part 1859.
3259. gbinv186.seq - Invertebrate sequence entries, part 186.
3260. gbinv1860.seq - Invertebrate sequence entries, part 1860.
3261. gbinv1861.seq - Invertebrate sequence entries, part 1861.
3262. gbinv1862.seq - Invertebrate sequence entries, part 1862.
3263. gbinv187.seq - Invertebrate sequence entries, part 187.
3264. gbinv188.seq - Invertebrate sequence entries, part 188.
3265. gbinv189.seq - Invertebrate sequence entries, part 189.
3266. gbinv19.seq - Invertebrate sequence entries, part 19.
3267. gbinv190.seq - Invertebrate sequence entries, part 190.
3268. gbinv191.seq - Invertebrate sequence entries, part 191.
3269. gbinv192.seq - Invertebrate sequence entries, part 192.
3270. gbinv193.seq - Invertebrate sequence entries, part 193.
3271. gbinv194.seq - Invertebrate sequence entries, part 194.
3272. gbinv195.seq - Invertebrate sequence entries, part 195.
3273. gbinv196.seq - Invertebrate sequence entries, part 196.
3274. gbinv197.seq - Invertebrate sequence entries, part 197.
3275. gbinv198.seq - Invertebrate sequence entries, part 198.
3276. gbinv199.seq - Invertebrate sequence entries, part 199.
3277. gbinv2.seq - Invertebrate sequence entries, part 2.
3278. gbinv20.seq - Invertebrate sequence entries, part 20.
3279. gbinv200.seq - Invertebrate sequence entries, part 200.
3280. gbinv201.seq - Invertebrate sequence entries, part 201.
3281. gbinv202.seq - Invertebrate sequence entries, part 202.
3282. gbinv203.seq - Invertebrate sequence entries, part 203.
3283. gbinv204.seq - Invertebrate sequence entries, part 204.
3284. gbinv205.seq - Invertebrate sequence entries, part 205.
3285. gbinv206.seq - Invertebrate sequence entries, part 206.
3286. gbinv207.seq - Invertebrate sequence entries, part 207.
3287. gbinv208.seq - Invertebrate sequence entries, part 208.
3288. gbinv209.seq - Invertebrate sequence entries, part 209.
3289. gbinv21.seq - Invertebrate sequence entries, part 21.
3290. gbinv210.seq - Invertebrate sequence entries, part 210.
3291. gbinv211.seq - Invertebrate sequence entries, part 211.
3292. gbinv212.seq - Invertebrate sequence entries, part 212.
3293. gbinv213.seq - Invertebrate sequence entries, part 213.
3294. gbinv214.seq - Invertebrate sequence entries, part 214.
3295. gbinv215.seq - Invertebrate sequence entries, part 215.
3296. gbinv216.seq - Invertebrate sequence entries, part 216.
3297. gbinv217.seq - Invertebrate sequence entries, part 217.
3298. gbinv218.seq - Invertebrate sequence entries, part 218.
3299. gbinv219.seq - Invertebrate sequence entries, part 219.
3300. gbinv22.seq - Invertebrate sequence entries, part 22.
3301. gbinv220.seq - Invertebrate sequence entries, part 220.
3302. gbinv221.seq - Invertebrate sequence entries, part 221.
3303. gbinv222.seq - Invertebrate sequence entries, part 222.
3304. gbinv223.seq - Invertebrate sequence entries, part 223.
3305. gbinv224.seq - Invertebrate sequence entries, part 224.
3306. gbinv225.seq - Invertebrate sequence entries, part 225.
3307. gbinv226.seq - Invertebrate sequence entries, part 226.
3308. gbinv227.seq - Invertebrate sequence entries, part 227.
3309. gbinv228.seq - Invertebrate sequence entries, part 228.
3310. gbinv229.seq - Invertebrate sequence entries, part 229.
3311. gbinv23.seq - Invertebrate sequence entries, part 23.
3312. gbinv230.seq - Invertebrate sequence entries, part 230.
3313. gbinv231.seq - Invertebrate sequence entries, part 231.
3314. gbinv232.seq - Invertebrate sequence entries, part 232.
3315. gbinv233.seq - Invertebrate sequence entries, part 233.
3316. gbinv234.seq - Invertebrate sequence entries, part 234.
3317. gbinv235.seq - Invertebrate sequence entries, part 235.
3318. gbinv236.seq - Invertebrate sequence entries, part 236.
3319. gbinv237.seq - Invertebrate sequence entries, part 237.
3320. gbinv238.seq - Invertebrate sequence entries, part 238.
3321. gbinv239.seq - Invertebrate sequence entries, part 239.
3322. gbinv24.seq - Invertebrate sequence entries, part 24.
3323. gbinv240.seq - Invertebrate sequence entries, part 240.
3324. gbinv241.seq - Invertebrate sequence entries, part 241.
3325. gbinv242.seq - Invertebrate sequence entries, part 242.
3326. gbinv243.seq - Invertebrate sequence entries, part 243.
3327. gbinv244.seq - Invertebrate sequence entries, part 244.
3328. gbinv245.seq - Invertebrate sequence entries, part 245.
3329. gbinv246.seq - Invertebrate sequence entries, part 246.
3330. gbinv247.seq - Invertebrate sequence entries, part 247.
3331. gbinv248.seq - Invertebrate sequence entries, part 248.
3332. gbinv249.seq - Invertebrate sequence entries, part 249.
3333. gbinv25.seq - Invertebrate sequence entries, part 25.
3334. gbinv250.seq - Invertebrate sequence entries, part 250.
3335. gbinv251.seq - Invertebrate sequence entries, part 251.
3336. gbinv252.seq - Invertebrate sequence entries, part 252.
3337. gbinv253.seq - Invertebrate sequence entries, part 253.
3338. gbinv254.seq - Invertebrate sequence entries, part 254.
3339. gbinv255.seq - Invertebrate sequence entries, part 255.
3340. gbinv256.seq - Invertebrate sequence entries, part 256.
3341. gbinv257.seq - Invertebrate sequence entries, part 257.
3342. gbinv258.seq - Invertebrate sequence entries, part 258.
3343. gbinv259.seq - Invertebrate sequence entries, part 259.
3344. gbinv26.seq - Invertebrate sequence entries, part 26.
3345. gbinv260.seq - Invertebrate sequence entries, part 260.
3346. gbinv261.seq - Invertebrate sequence entries, part 261.
3347. gbinv262.seq - Invertebrate sequence entries, part 262.
3348. gbinv263.seq - Invertebrate sequence entries, part 263.
3349. gbinv264.seq - Invertebrate sequence entries, part 264.
3350. gbinv265.seq - Invertebrate sequence entries, part 265.
3351. gbinv266.seq - Invertebrate sequence entries, part 266.
3352. gbinv267.seq - Invertebrate sequence entries, part 267.
3353. gbinv268.seq - Invertebrate sequence entries, part 268.
3354. gbinv269.seq - Invertebrate sequence entries, part 269.
3355. gbinv27.seq - Invertebrate sequence entries, part 27.
3356. gbinv270.seq - Invertebrate sequence entries, part 270.
3357. gbinv271.seq - Invertebrate sequence entries, part 271.
3358. gbinv272.seq - Invertebrate sequence entries, part 272.
3359. gbinv273.seq - Invertebrate sequence entries, part 273.
3360. gbinv274.seq - Invertebrate sequence entries, part 274.
3361. gbinv275.seq - Invertebrate sequence entries, part 275.
3362. gbinv276.seq - Invertebrate sequence entries, part 276.
3363. gbinv277.seq - Invertebrate sequence entries, part 277.
3364. gbinv278.seq - Invertebrate sequence entries, part 278.
3365. gbinv279.seq - Invertebrate sequence entries, part 279.
3366. gbinv28.seq - Invertebrate sequence entries, part 28.
3367. gbinv280.seq - Invertebrate sequence entries, part 280.
3368. gbinv281.seq - Invertebrate sequence entries, part 281.
3369. gbinv282.seq - Invertebrate sequence entries, part 282.
3370. gbinv283.seq - Invertebrate sequence entries, part 283.
3371. gbinv284.seq - Invertebrate sequence entries, part 284.
3372. gbinv285.seq - Invertebrate sequence entries, part 285.
3373. gbinv286.seq - Invertebrate sequence entries, part 286.
3374. gbinv287.seq - Invertebrate sequence entries, part 287.
3375. gbinv288.seq - Invertebrate sequence entries, part 288.
3376. gbinv289.seq - Invertebrate sequence entries, part 289.
3377. gbinv29.seq - Invertebrate sequence entries, part 29.
3378. gbinv290.seq - Invertebrate sequence entries, part 290.
3379. gbinv291.seq - Invertebrate sequence entries, part 291.
3380. gbinv292.seq - Invertebrate sequence entries, part 292.
3381. gbinv293.seq - Invertebrate sequence entries, part 293.
3382. gbinv294.seq - Invertebrate sequence entries, part 294.
3383. gbinv295.seq - Invertebrate sequence entries, part 295.
3384. gbinv296.seq - Invertebrate sequence entries, part 296.
3385. gbinv297.seq - Invertebrate sequence entries, part 297.
3386. gbinv298.seq - Invertebrate sequence entries, part 298.
3387. gbinv299.seq - Invertebrate sequence entries, part 299.
3388. gbinv3.seq - Invertebrate sequence entries, part 3.
3389. gbinv30.seq - Invertebrate sequence entries, part 30.
3390. gbinv300.seq - Invertebrate sequence entries, part 300.
3391. gbinv301.seq - Invertebrate sequence entries, part 301.
3392. gbinv302.seq - Invertebrate sequence entries, part 302.
3393. gbinv303.seq - Invertebrate sequence entries, part 303.
3394. gbinv304.seq - Invertebrate sequence entries, part 304.
3395. gbinv305.seq - Invertebrate sequence entries, part 305.
3396. gbinv306.seq - Invertebrate sequence entries, part 306.
3397. gbinv307.seq - Invertebrate sequence entries, part 307.
3398. gbinv308.seq - Invertebrate sequence entries, part 308.
3399. gbinv309.seq - Invertebrate sequence entries, part 309.
3400. gbinv31.seq - Invertebrate sequence entries, part 31.
3401. gbinv310.seq - Invertebrate sequence entries, part 310.
3402. gbinv311.seq - Invertebrate sequence entries, part 311.
3403. gbinv312.seq - Invertebrate sequence entries, part 312.
3404. gbinv313.seq - Invertebrate sequence entries, part 313.
3405. gbinv314.seq - Invertebrate sequence entries, part 314.
3406. gbinv315.seq - Invertebrate sequence entries, part 315.
3407. gbinv316.seq - Invertebrate sequence entries, part 316.
3408. gbinv317.seq - Invertebrate sequence entries, part 317.
3409. gbinv318.seq - Invertebrate sequence entries, part 318.
3410. gbinv319.seq - Invertebrate sequence entries, part 319.
3411. gbinv32.seq - Invertebrate sequence entries, part 32.
3412. gbinv320.seq - Invertebrate sequence entries, part 320.
3413. gbinv321.seq - Invertebrate sequence entries, part 321.
3414. gbinv322.seq - Invertebrate sequence entries, part 322.
3415. gbinv323.seq - Invertebrate sequence entries, part 323.
3416. gbinv324.seq - Invertebrate sequence entries, part 324.
3417. gbinv325.seq - Invertebrate sequence entries, part 325.
3418. gbinv326.seq - Invertebrate sequence entries, part 326.
3419. gbinv327.seq - Invertebrate sequence entries, part 327.
3420. gbinv328.seq - Invertebrate sequence entries, part 328.
3421. gbinv329.seq - Invertebrate sequence entries, part 329.
3422. gbinv33.seq - Invertebrate sequence entries, part 33.
3423. gbinv330.seq - Invertebrate sequence entries, part 330.
3424. gbinv331.seq - Invertebrate sequence entries, part 331.
3425. gbinv332.seq - Invertebrate sequence entries, part 332.
3426. gbinv333.seq - Invertebrate sequence entries, part 333.
3427. gbinv334.seq - Invertebrate sequence entries, part 334.
3428. gbinv335.seq - Invertebrate sequence entries, part 335.
3429. gbinv336.seq - Invertebrate sequence entries, part 336.
3430. gbinv337.seq - Invertebrate sequence entries, part 337.
3431. gbinv338.seq - Invertebrate sequence entries, part 338.
3432. gbinv339.seq - Invertebrate sequence entries, part 339.
3433. gbinv34.seq - Invertebrate sequence entries, part 34.
3434. gbinv340.seq - Invertebrate sequence entries, part 340.
3435. gbinv341.seq - Invertebrate sequence entries, part 341.
3436. gbinv342.seq - Invertebrate sequence entries, part 342.
3437. gbinv343.seq - Invertebrate sequence entries, part 343.
3438. gbinv344.seq - Invertebrate sequence entries, part 344.
3439. gbinv345.seq - Invertebrate sequence entries, part 345.
3440. gbinv346.seq - Invertebrate sequence entries, part 346.
3441. gbinv347.seq - Invertebrate sequence entries, part 347.
3442. gbinv348.seq - Invertebrate sequence entries, part 348.
3443. gbinv349.seq - Invertebrate sequence entries, part 349.
3444. gbinv35.seq - Invertebrate sequence entries, part 35.
3445. gbinv350.seq - Invertebrate sequence entries, part 350.
3446. gbinv351.seq - Invertebrate sequence entries, part 351.
3447. gbinv352.seq - Invertebrate sequence entries, part 352.
3448. gbinv353.seq - Invertebrate sequence entries, part 353.
3449. gbinv354.seq - Invertebrate sequence entries, part 354.
3450. gbinv355.seq - Invertebrate sequence entries, part 355.
3451. gbinv356.seq - Invertebrate sequence entries, part 356.
3452. gbinv357.seq - Invertebrate sequence entries, part 357.
3453. gbinv358.seq - Invertebrate sequence entries, part 358.
3454. gbinv359.seq - Invertebrate sequence entries, part 359.
3455. gbinv36.seq - Invertebrate sequence entries, part 36.
3456. gbinv360.seq - Invertebrate sequence entries, part 360.
3457. gbinv361.seq - Invertebrate sequence entries, part 361.
3458. gbinv362.seq - Invertebrate sequence entries, part 362.
3459. gbinv363.seq - Invertebrate sequence entries, part 363.
3460. gbinv364.seq - Invertebrate sequence entries, part 364.
3461. gbinv365.seq - Invertebrate sequence entries, part 365.
3462. gbinv366.seq - Invertebrate sequence entries, part 366.
3463. gbinv367.seq - Invertebrate sequence entries, part 367.
3464. gbinv368.seq - Invertebrate sequence entries, part 368.
3465. gbinv369.seq - Invertebrate sequence entries, part 369.
3466. gbinv37.seq - Invertebrate sequence entries, part 37.
3467. gbinv370.seq - Invertebrate sequence entries, part 370.
3468. gbinv371.seq - Invertebrate sequence entries, part 371.
3469. gbinv372.seq - Invertebrate sequence entries, part 372.
3470. gbinv373.seq - Invertebrate sequence entries, part 373.
3471. gbinv374.seq - Invertebrate sequence entries, part 374.
3472. gbinv375.seq - Invertebrate sequence entries, part 375.
3473. gbinv376.seq - Invertebrate sequence entries, part 376.
3474. gbinv377.seq - Invertebrate sequence entries, part 377.
3475. gbinv378.seq - Invertebrate sequence entries, part 378.
3476. gbinv379.seq - Invertebrate sequence entries, part 379.
3477. gbinv38.seq - Invertebrate sequence entries, part 38.
3478. gbinv380.seq - Invertebrate sequence entries, part 380.
3479. gbinv381.seq - Invertebrate sequence entries, part 381.
3480. gbinv382.seq - Invertebrate sequence entries, part 382.
3481. gbinv383.seq - Invertebrate sequence entries, part 383.
3482. gbinv384.seq - Invertebrate sequence entries, part 384.
3483. gbinv385.seq - Invertebrate sequence entries, part 385.
3484. gbinv386.seq - Invertebrate sequence entries, part 386.
3485. gbinv387.seq - Invertebrate sequence entries, part 387.
3486. gbinv388.seq - Invertebrate sequence entries, part 388.
3487. gbinv389.seq - Invertebrate sequence entries, part 389.
3488. gbinv39.seq - Invertebrate sequence entries, part 39.
3489. gbinv390.seq - Invertebrate sequence entries, part 390.
3490. gbinv391.seq - Invertebrate sequence entries, part 391.
3491. gbinv392.seq - Invertebrate sequence entries, part 392.
3492. gbinv393.seq - Invertebrate sequence entries, part 393.
3493. gbinv394.seq - Invertebrate sequence entries, part 394.
3494. gbinv395.seq - Invertebrate sequence entries, part 395.
3495. gbinv396.seq - Invertebrate sequence entries, part 396.
3496. gbinv397.seq - Invertebrate sequence entries, part 397.
3497. gbinv398.seq - Invertebrate sequence entries, part 398.
3498. gbinv399.seq - Invertebrate sequence entries, part 399.
3499. gbinv4.seq - Invertebrate sequence entries, part 4.
3500. gbinv40.seq - Invertebrate sequence entries, part 40.
3501. gbinv400.seq - Invertebrate sequence entries, part 400.
3502. gbinv401.seq - Invertebrate sequence entries, part 401.
3503. gbinv402.seq - Invertebrate sequence entries, part 402.
3504. gbinv403.seq - Invertebrate sequence entries, part 403.
3505. gbinv404.seq - Invertebrate sequence entries, part 404.
3506. gbinv405.seq - Invertebrate sequence entries, part 405.
3507. gbinv406.seq - Invertebrate sequence entries, part 406.
3508. gbinv407.seq - Invertebrate sequence entries, part 407.
3509. gbinv408.seq - Invertebrate sequence entries, part 408.
3510. gbinv409.seq - Invertebrate sequence entries, part 409.
3511. gbinv41.seq - Invertebrate sequence entries, part 41.
3512. gbinv410.seq - Invertebrate sequence entries, part 410.
3513. gbinv411.seq - Invertebrate sequence entries, part 411.
3514. gbinv412.seq - Invertebrate sequence entries, part 412.
3515. gbinv413.seq - Invertebrate sequence entries, part 413.
3516. gbinv414.seq - Invertebrate sequence entries, part 414.
3517. gbinv415.seq - Invertebrate sequence entries, part 415.
3518. gbinv416.seq - Invertebrate sequence entries, part 416.
3519. gbinv417.seq - Invertebrate sequence entries, part 417.
3520. gbinv418.seq - Invertebrate sequence entries, part 418.
3521. gbinv419.seq - Invertebrate sequence entries, part 419.
3522. gbinv42.seq - Invertebrate sequence entries, part 42.
3523. gbinv420.seq - Invertebrate sequence entries, part 420.
3524. gbinv421.seq - Invertebrate sequence entries, part 421.
3525. gbinv422.seq - Invertebrate sequence entries, part 422.
3526. gbinv423.seq - Invertebrate sequence entries, part 423.
3527. gbinv424.seq - Invertebrate sequence entries, part 424.
3528. gbinv425.seq - Invertebrate sequence entries, part 425.
3529. gbinv426.seq - Invertebrate sequence entries, part 426.
3530. gbinv427.seq - Invertebrate sequence entries, part 427.
3531. gbinv428.seq - Invertebrate sequence entries, part 428.
3532. gbinv429.seq - Invertebrate sequence entries, part 429.
3533. gbinv43.seq - Invertebrate sequence entries, part 43.
3534. gbinv430.seq - Invertebrate sequence entries, part 430.
3535. gbinv431.seq - Invertebrate sequence entries, part 431.
3536. gbinv432.seq - Invertebrate sequence entries, part 432.
3537. gbinv433.seq - Invertebrate sequence entries, part 433.
3538. gbinv434.seq - Invertebrate sequence entries, part 434.
3539. gbinv435.seq - Invertebrate sequence entries, part 435.
3540. gbinv436.seq - Invertebrate sequence entries, part 436.
3541. gbinv437.seq - Invertebrate sequence entries, part 437.
3542. gbinv438.seq - Invertebrate sequence entries, part 438.
3543. gbinv439.seq - Invertebrate sequence entries, part 439.
3544. gbinv44.seq - Invertebrate sequence entries, part 44.
3545. gbinv440.seq - Invertebrate sequence entries, part 440.
3546. gbinv441.seq - Invertebrate sequence entries, part 441.
3547. gbinv442.seq - Invertebrate sequence entries, part 442.
3548. gbinv443.seq - Invertebrate sequence entries, part 443.
3549. gbinv444.seq - Invertebrate sequence entries, part 444.
3550. gbinv445.seq - Invertebrate sequence entries, part 445.
3551. gbinv446.seq - Invertebrate sequence entries, part 446.
3552. gbinv447.seq - Invertebrate sequence entries, part 447.
3553. gbinv448.seq - Invertebrate sequence entries, part 448.
3554. gbinv449.seq - Invertebrate sequence entries, part 449.
3555. gbinv45.seq - Invertebrate sequence entries, part 45.
3556. gbinv450.seq - Invertebrate sequence entries, part 450.
3557. gbinv451.seq - Invertebrate sequence entries, part 451.
3558. gbinv452.seq - Invertebrate sequence entries, part 452.
3559. gbinv453.seq - Invertebrate sequence entries, part 453.
3560. gbinv454.seq - Invertebrate sequence entries, part 454.
3561. gbinv455.seq - Invertebrate sequence entries, part 455.
3562. gbinv456.seq - Invertebrate sequence entries, part 456.
3563. gbinv457.seq - Invertebrate sequence entries, part 457.
3564. gbinv458.seq - Invertebrate sequence entries, part 458.
3565. gbinv459.seq - Invertebrate sequence entries, part 459.
3566. gbinv46.seq - Invertebrate sequence entries, part 46.
3567. gbinv460.seq - Invertebrate sequence entries, part 460.
3568. gbinv461.seq - Invertebrate sequence entries, part 461.
3569. gbinv462.seq - Invertebrate sequence entries, part 462.
3570. gbinv463.seq - Invertebrate sequence entries, part 463.
3571. gbinv464.seq - Invertebrate sequence entries, part 464.
3572. gbinv465.seq - Invertebrate sequence entries, part 465.
3573. gbinv466.seq - Invertebrate sequence entries, part 466.
3574. gbinv467.seq - Invertebrate sequence entries, part 467.
3575. gbinv468.seq - Invertebrate sequence entries, part 468.
3576. gbinv469.seq - Invertebrate sequence entries, part 469.
3577. gbinv47.seq - Invertebrate sequence entries, part 47.
3578. gbinv470.seq - Invertebrate sequence entries, part 470.
3579. gbinv471.seq - Invertebrate sequence entries, part 471.
3580. gbinv472.seq - Invertebrate sequence entries, part 472.
3581. gbinv473.seq - Invertebrate sequence entries, part 473.
3582. gbinv474.seq - Invertebrate sequence entries, part 474.
3583. gbinv475.seq - Invertebrate sequence entries, part 475.
3584. gbinv476.seq - Invertebrate sequence entries, part 476.
3585. gbinv477.seq - Invertebrate sequence entries, part 477.
3586. gbinv478.seq - Invertebrate sequence entries, part 478.
3587. gbinv479.seq - Invertebrate sequence entries, part 479.
3588. gbinv48.seq - Invertebrate sequence entries, part 48.
3589. gbinv480.seq - Invertebrate sequence entries, part 480.
3590. gbinv481.seq - Invertebrate sequence entries, part 481.
3591. gbinv482.seq - Invertebrate sequence entries, part 482.
3592. gbinv483.seq - Invertebrate sequence entries, part 483.
3593. gbinv484.seq - Invertebrate sequence entries, part 484.
3594. gbinv485.seq - Invertebrate sequence entries, part 485.
3595. gbinv486.seq - Invertebrate sequence entries, part 486.
3596. gbinv487.seq - Invertebrate sequence entries, part 487.
3597. gbinv488.seq - Invertebrate sequence entries, part 488.
3598. gbinv489.seq - Invertebrate sequence entries, part 489.
3599. gbinv49.seq - Invertebrate sequence entries, part 49.
3600. gbinv490.seq - Invertebrate sequence entries, part 490.
3601. gbinv491.seq - Invertebrate sequence entries, part 491.
3602. gbinv492.seq - Invertebrate sequence entries, part 492.
3603. gbinv493.seq - Invertebrate sequence entries, part 493.
3604. gbinv494.seq - Invertebrate sequence entries, part 494.
3605. gbinv495.seq - Invertebrate sequence entries, part 495.
3606. gbinv496.seq - Invertebrate sequence entries, part 496.
3607. gbinv497.seq - Invertebrate sequence entries, part 497.
3608. gbinv498.seq - Invertebrate sequence entries, part 498.
3609. gbinv499.seq - Invertebrate sequence entries, part 499.
3610. gbinv5.seq - Invertebrate sequence entries, part 5.
3611. gbinv50.seq - Invertebrate sequence entries, part 50.
3612. gbinv500.seq - Invertebrate sequence entries, part 500.
3613. gbinv501.seq - Invertebrate sequence entries, part 501.
3614. gbinv502.seq - Invertebrate sequence entries, part 502.
3615. gbinv503.seq - Invertebrate sequence entries, part 503.
3616. gbinv504.seq - Invertebrate sequence entries, part 504.
3617. gbinv505.seq - Invertebrate sequence entries, part 505.
3618. gbinv506.seq - Invertebrate sequence entries, part 506.
3619. gbinv507.seq - Invertebrate sequence entries, part 507.
3620. gbinv508.seq - Invertebrate sequence entries, part 508.
3621. gbinv509.seq - Invertebrate sequence entries, part 509.
3622. gbinv51.seq - Invertebrate sequence entries, part 51.
3623. gbinv510.seq - Invertebrate sequence entries, part 510.
3624. gbinv511.seq - Invertebrate sequence entries, part 511.
3625. gbinv512.seq - Invertebrate sequence entries, part 512.
3626. gbinv513.seq - Invertebrate sequence entries, part 513.
3627. gbinv514.seq - Invertebrate sequence entries, part 514.
3628. gbinv515.seq - Invertebrate sequence entries, part 515.
3629. gbinv516.seq - Invertebrate sequence entries, part 516.
3630. gbinv517.seq - Invertebrate sequence entries, part 517.
3631. gbinv518.seq - Invertebrate sequence entries, part 518.
3632. gbinv519.seq - Invertebrate sequence entries, part 519.
3633. gbinv52.seq - Invertebrate sequence entries, part 52.
3634. gbinv520.seq - Invertebrate sequence entries, part 520.
3635. gbinv521.seq - Invertebrate sequence entries, part 521.
3636. gbinv522.seq - Invertebrate sequence entries, part 522.
3637. gbinv523.seq - Invertebrate sequence entries, part 523.
3638. gbinv524.seq - Invertebrate sequence entries, part 524.
3639. gbinv525.seq - Invertebrate sequence entries, part 525.
3640. gbinv526.seq - Invertebrate sequence entries, part 526.
3641. gbinv527.seq - Invertebrate sequence entries, part 527.
3642. gbinv528.seq - Invertebrate sequence entries, part 528.
3643. gbinv529.seq - Invertebrate sequence entries, part 529.
3644. gbinv53.seq - Invertebrate sequence entries, part 53.
3645. gbinv530.seq - Invertebrate sequence entries, part 530.
3646. gbinv531.seq - Invertebrate sequence entries, part 531.
3647. gbinv532.seq - Invertebrate sequence entries, part 532.
3648. gbinv533.seq - Invertebrate sequence entries, part 533.
3649. gbinv534.seq - Invertebrate sequence entries, part 534.
3650. gbinv535.seq - Invertebrate sequence entries, part 535.
3651. gbinv536.seq - Invertebrate sequence entries, part 536.
3652. gbinv537.seq - Invertebrate sequence entries, part 537.
3653. gbinv538.seq - Invertebrate sequence entries, part 538.
3654. gbinv539.seq - Invertebrate sequence entries, part 539.
3655. gbinv54.seq - Invertebrate sequence entries, part 54.
3656. gbinv540.seq - Invertebrate sequence entries, part 540.
3657. gbinv541.seq - Invertebrate sequence entries, part 541.
3658. gbinv542.seq - Invertebrate sequence entries, part 542.
3659. gbinv543.seq - Invertebrate sequence entries, part 543.
3660. gbinv544.seq - Invertebrate sequence entries, part 544.
3661. gbinv545.seq - Invertebrate sequence entries, part 545.
3662. gbinv546.seq - Invertebrate sequence entries, part 546.
3663. gbinv547.seq - Invertebrate sequence entries, part 547.
3664. gbinv548.seq - Invertebrate sequence entries, part 548.
3665. gbinv549.seq - Invertebrate sequence entries, part 549.
3666. gbinv55.seq - Invertebrate sequence entries, part 55.
3667. gbinv550.seq - Invertebrate sequence entries, part 550.
3668. gbinv551.seq - Invertebrate sequence entries, part 551.
3669. gbinv552.seq - Invertebrate sequence entries, part 552.
3670. gbinv553.seq - Invertebrate sequence entries, part 553.
3671. gbinv554.seq - Invertebrate sequence entries, part 554.
3672. gbinv555.seq - Invertebrate sequence entries, part 555.
3673. gbinv556.seq - Invertebrate sequence entries, part 556.
3674. gbinv557.seq - Invertebrate sequence entries, part 557.
3675. gbinv558.seq - Invertebrate sequence entries, part 558.
3676. gbinv559.seq - Invertebrate sequence entries, part 559.
3677. gbinv56.seq - Invertebrate sequence entries, part 56.
3678. gbinv560.seq - Invertebrate sequence entries, part 560.
3679. gbinv561.seq - Invertebrate sequence entries, part 561.
3680. gbinv562.seq - Invertebrate sequence entries, part 562.
3681. gbinv563.seq - Invertebrate sequence entries, part 563.
3682. gbinv564.seq - Invertebrate sequence entries, part 564.
3683. gbinv565.seq - Invertebrate sequence entries, part 565.
3684. gbinv566.seq - Invertebrate sequence entries, part 566.
3685. gbinv567.seq - Invertebrate sequence entries, part 567.
3686. gbinv568.seq - Invertebrate sequence entries, part 568.
3687. gbinv569.seq - Invertebrate sequence entries, part 569.
3688. gbinv57.seq - Invertebrate sequence entries, part 57.
3689. gbinv570.seq - Invertebrate sequence entries, part 570.
3690. gbinv571.seq - Invertebrate sequence entries, part 571.
3691. gbinv572.seq - Invertebrate sequence entries, part 572.
3692. gbinv573.seq - Invertebrate sequence entries, part 573.
3693. gbinv574.seq - Invertebrate sequence entries, part 574.
3694. gbinv575.seq - Invertebrate sequence entries, part 575.
3695. gbinv576.seq - Invertebrate sequence entries, part 576.
3696. gbinv577.seq - Invertebrate sequence entries, part 577.
3697. gbinv578.seq - Invertebrate sequence entries, part 578.
3698. gbinv579.seq - Invertebrate sequence entries, part 579.
3699. gbinv58.seq - Invertebrate sequence entries, part 58.
3700. gbinv580.seq - Invertebrate sequence entries, part 580.
3701. gbinv581.seq - Invertebrate sequence entries, part 581.
3702. gbinv582.seq - Invertebrate sequence entries, part 582.
3703. gbinv583.seq - Invertebrate sequence entries, part 583.
3704. gbinv584.seq - Invertebrate sequence entries, part 584.
3705. gbinv585.seq - Invertebrate sequence entries, part 585.
3706. gbinv586.seq - Invertebrate sequence entries, part 586.
3707. gbinv587.seq - Invertebrate sequence entries, part 587.
3708. gbinv588.seq - Invertebrate sequence entries, part 588.
3709. gbinv589.seq - Invertebrate sequence entries, part 589.
3710. gbinv59.seq - Invertebrate sequence entries, part 59.
3711. gbinv590.seq - Invertebrate sequence entries, part 590.
3712. gbinv591.seq - Invertebrate sequence entries, part 591.
3713. gbinv592.seq - Invertebrate sequence entries, part 592.
3714. gbinv593.seq - Invertebrate sequence entries, part 593.
3715. gbinv594.seq - Invertebrate sequence entries, part 594.
3716. gbinv595.seq - Invertebrate sequence entries, part 595.
3717. gbinv596.seq - Invertebrate sequence entries, part 596.
3718. gbinv597.seq - Invertebrate sequence entries, part 597.
3719. gbinv598.seq - Invertebrate sequence entries, part 598.
3720. gbinv599.seq - Invertebrate sequence entries, part 599.
3721. gbinv6.seq - Invertebrate sequence entries, part 6.
3722. gbinv60.seq - Invertebrate sequence entries, part 60.
3723. gbinv600.seq - Invertebrate sequence entries, part 600.
3724. gbinv601.seq - Invertebrate sequence entries, part 601.
3725. gbinv602.seq - Invertebrate sequence entries, part 602.
3726. gbinv603.seq - Invertebrate sequence entries, part 603.
3727. gbinv604.seq - Invertebrate sequence entries, part 604.
3728. gbinv605.seq - Invertebrate sequence entries, part 605.
3729. gbinv606.seq - Invertebrate sequence entries, part 606.
3730. gbinv607.seq - Invertebrate sequence entries, part 607.
3731. gbinv608.seq - Invertebrate sequence entries, part 608.
3732. gbinv609.seq - Invertebrate sequence entries, part 609.
3733. gbinv61.seq - Invertebrate sequence entries, part 61.
3734. gbinv610.seq - Invertebrate sequence entries, part 610.
3735. gbinv611.seq - Invertebrate sequence entries, part 611.
3736. gbinv612.seq - Invertebrate sequence entries, part 612.
3737. gbinv613.seq - Invertebrate sequence entries, part 613.
3738. gbinv614.seq - Invertebrate sequence entries, part 614.
3739. gbinv615.seq - Invertebrate sequence entries, part 615.
3740. gbinv616.seq - Invertebrate sequence entries, part 616.
3741. gbinv617.seq - Invertebrate sequence entries, part 617.
3742. gbinv618.seq - Invertebrate sequence entries, part 618.
3743. gbinv619.seq - Invertebrate sequence entries, part 619.
3744. gbinv62.seq - Invertebrate sequence entries, part 62.
3745. gbinv620.seq - Invertebrate sequence entries, part 620.
3746. gbinv621.seq - Invertebrate sequence entries, part 621.
3747. gbinv622.seq - Invertebrate sequence entries, part 622.
3748. gbinv623.seq - Invertebrate sequence entries, part 623.
3749. gbinv624.seq - Invertebrate sequence entries, part 624.
3750. gbinv625.seq - Invertebrate sequence entries, part 625.
3751. gbinv626.seq - Invertebrate sequence entries, part 626.
3752. gbinv627.seq - Invertebrate sequence entries, part 627.
3753. gbinv628.seq - Invertebrate sequence entries, part 628.
3754. gbinv629.seq - Invertebrate sequence entries, part 629.
3755. gbinv63.seq - Invertebrate sequence entries, part 63.
3756. gbinv630.seq - Invertebrate sequence entries, part 630.
3757. gbinv631.seq - Invertebrate sequence entries, part 631.
3758. gbinv632.seq - Invertebrate sequence entries, part 632.
3759. gbinv633.seq - Invertebrate sequence entries, part 633.
3760. gbinv634.seq - Invertebrate sequence entries, part 634.
3761. gbinv635.seq - Invertebrate sequence entries, part 635.
3762. gbinv636.seq - Invertebrate sequence entries, part 636.
3763. gbinv637.seq - Invertebrate sequence entries, part 637.
3764. gbinv638.seq - Invertebrate sequence entries, part 638.
3765. gbinv639.seq - Invertebrate sequence entries, part 639.
3766. gbinv64.seq - Invertebrate sequence entries, part 64.
3767. gbinv640.seq - Invertebrate sequence entries, part 640.
3768. gbinv641.seq - Invertebrate sequence entries, part 641.
3769. gbinv642.seq - Invertebrate sequence entries, part 642.
3770. gbinv643.seq - Invertebrate sequence entries, part 643.
3771. gbinv644.seq - Invertebrate sequence entries, part 644.
3772. gbinv645.seq - Invertebrate sequence entries, part 645.
3773. gbinv646.seq - Invertebrate sequence entries, part 646.
3774. gbinv647.seq - Invertebrate sequence entries, part 647.
3775. gbinv648.seq - Invertebrate sequence entries, part 648.
3776. gbinv649.seq - Invertebrate sequence entries, part 649.
3777. gbinv65.seq - Invertebrate sequence entries, part 65.
3778. gbinv650.seq - Invertebrate sequence entries, part 650.
3779. gbinv651.seq - Invertebrate sequence entries, part 651.
3780. gbinv652.seq - Invertebrate sequence entries, part 652.
3781. gbinv653.seq - Invertebrate sequence entries, part 653.
3782. gbinv654.seq - Invertebrate sequence entries, part 654.
3783. gbinv655.seq - Invertebrate sequence entries, part 655.
3784. gbinv656.seq - Invertebrate sequence entries, part 656.
3785. gbinv657.seq - Invertebrate sequence entries, part 657.
3786. gbinv658.seq - Invertebrate sequence entries, part 658.
3787. gbinv659.seq - Invertebrate sequence entries, part 659.
3788. gbinv66.seq - Invertebrate sequence entries, part 66.
3789. gbinv660.seq - Invertebrate sequence entries, part 660.
3790. gbinv661.seq - Invertebrate sequence entries, part 661.
3791. gbinv662.seq - Invertebrate sequence entries, part 662.
3792. gbinv663.seq - Invertebrate sequence entries, part 663.
3793. gbinv664.seq - Invertebrate sequence entries, part 664.
3794. gbinv665.seq - Invertebrate sequence entries, part 665.
3795. gbinv666.seq - Invertebrate sequence entries, part 666.
3796. gbinv667.seq - Invertebrate sequence entries, part 667.
3797. gbinv668.seq - Invertebrate sequence entries, part 668.
3798. gbinv669.seq - Invertebrate sequence entries, part 669.
3799. gbinv67.seq - Invertebrate sequence entries, part 67.
3800. gbinv670.seq - Invertebrate sequence entries, part 670.
3801. gbinv671.seq - Invertebrate sequence entries, part 671.
3802. gbinv672.seq - Invertebrate sequence entries, part 672.
3803. gbinv673.seq - Invertebrate sequence entries, part 673.
3804. gbinv674.seq - Invertebrate sequence entries, part 674.
3805. gbinv675.seq - Invertebrate sequence entries, part 675.
3806. gbinv676.seq - Invertebrate sequence entries, part 676.
3807. gbinv677.seq - Invertebrate sequence entries, part 677.
3808. gbinv678.seq - Invertebrate sequence entries, part 678.
3809. gbinv679.seq - Invertebrate sequence entries, part 679.
3810. gbinv68.seq - Invertebrate sequence entries, part 68.
3811. gbinv680.seq - Invertebrate sequence entries, part 680.
3812. gbinv681.seq - Invertebrate sequence entries, part 681.
3813. gbinv682.seq - Invertebrate sequence entries, part 682.
3814. gbinv683.seq - Invertebrate sequence entries, part 683.
3815. gbinv684.seq - Invertebrate sequence entries, part 684.
3816. gbinv685.seq - Invertebrate sequence entries, part 685.
3817. gbinv686.seq - Invertebrate sequence entries, part 686.
3818. gbinv687.seq - Invertebrate sequence entries, part 687.
3819. gbinv688.seq - Invertebrate sequence entries, part 688.
3820. gbinv689.seq - Invertebrate sequence entries, part 689.
3821. gbinv69.seq - Invertebrate sequence entries, part 69.
3822. gbinv690.seq - Invertebrate sequence entries, part 690.
3823. gbinv691.seq - Invertebrate sequence entries, part 691.
3824. gbinv692.seq - Invertebrate sequence entries, part 692.
3825. gbinv693.seq - Invertebrate sequence entries, part 693.
3826. gbinv694.seq - Invertebrate sequence entries, part 694.
3827. gbinv695.seq - Invertebrate sequence entries, part 695.
3828. gbinv696.seq - Invertebrate sequence entries, part 696.
3829. gbinv697.seq - Invertebrate sequence entries, part 697.
3830. gbinv698.seq - Invertebrate sequence entries, part 698.
3831. gbinv699.seq - Invertebrate sequence entries, part 699.
3832. gbinv7.seq - Invertebrate sequence entries, part 7.
3833. gbinv70.seq - Invertebrate sequence entries, part 70.
3834. gbinv700.seq - Invertebrate sequence entries, part 700.
3835. gbinv701.seq - Invertebrate sequence entries, part 701.
3836. gbinv702.seq - Invertebrate sequence entries, part 702.
3837. gbinv703.seq - Invertebrate sequence entries, part 703.
3838. gbinv704.seq - Invertebrate sequence entries, part 704.
3839. gbinv705.seq - Invertebrate sequence entries, part 705.
3840. gbinv706.seq - Invertebrate sequence entries, part 706.
3841. gbinv707.seq - Invertebrate sequence entries, part 707.
3842. gbinv708.seq - Invertebrate sequence entries, part 708.
3843. gbinv709.seq - Invertebrate sequence entries, part 709.
3844. gbinv71.seq - Invertebrate sequence entries, part 71.
3845. gbinv710.seq - Invertebrate sequence entries, part 710.
3846. gbinv711.seq - Invertebrate sequence entries, part 711.
3847. gbinv712.seq - Invertebrate sequence entries, part 712.
3848. gbinv713.seq - Invertebrate sequence entries, part 713.
3849. gbinv714.seq - Invertebrate sequence entries, part 714.
3850. gbinv715.seq - Invertebrate sequence entries, part 715.
3851. gbinv716.seq - Invertebrate sequence entries, part 716.
3852. gbinv717.seq - Invertebrate sequence entries, part 717.
3853. gbinv718.seq - Invertebrate sequence entries, part 718.
3854. gbinv719.seq - Invertebrate sequence entries, part 719.
3855. gbinv72.seq - Invertebrate sequence entries, part 72.
3856. gbinv720.seq - Invertebrate sequence entries, part 720.
3857. gbinv721.seq - Invertebrate sequence entries, part 721.
3858. gbinv722.seq - Invertebrate sequence entries, part 722.
3859. gbinv723.seq - Invertebrate sequence entries, part 723.
3860. gbinv724.seq - Invertebrate sequence entries, part 724.
3861. gbinv725.seq - Invertebrate sequence entries, part 725.
3862. gbinv726.seq - Invertebrate sequence entries, part 726.
3863. gbinv727.seq - Invertebrate sequence entries, part 727.
3864. gbinv728.seq - Invertebrate sequence entries, part 728.
3865. gbinv729.seq - Invertebrate sequence entries, part 729.
3866. gbinv73.seq - Invertebrate sequence entries, part 73.
3867. gbinv730.seq - Invertebrate sequence entries, part 730.
3868. gbinv731.seq - Invertebrate sequence entries, part 731.
3869. gbinv732.seq - Invertebrate sequence entries, part 732.
3870. gbinv733.seq - Invertebrate sequence entries, part 733.
3871. gbinv734.seq - Invertebrate sequence entries, part 734.
3872. gbinv735.seq - Invertebrate sequence entries, part 735.
3873. gbinv736.seq - Invertebrate sequence entries, part 736.
3874. gbinv737.seq - Invertebrate sequence entries, part 737.
3875. gbinv738.seq - Invertebrate sequence entries, part 738.
3876. gbinv739.seq - Invertebrate sequence entries, part 739.
3877. gbinv74.seq - Invertebrate sequence entries, part 74.
3878. gbinv740.seq - Invertebrate sequence entries, part 740.
3879. gbinv741.seq - Invertebrate sequence entries, part 741.
3880. gbinv742.seq - Invertebrate sequence entries, part 742.
3881. gbinv743.seq - Invertebrate sequence entries, part 743.
3882. gbinv744.seq - Invertebrate sequence entries, part 744.
3883. gbinv745.seq - Invertebrate sequence entries, part 745.
3884. gbinv746.seq - Invertebrate sequence entries, part 746.
3885. gbinv747.seq - Invertebrate sequence entries, part 747.
3886. gbinv748.seq - Invertebrate sequence entries, part 748.
3887. gbinv749.seq - Invertebrate sequence entries, part 749.
3888. gbinv75.seq - Invertebrate sequence entries, part 75.
3889. gbinv750.seq - Invertebrate sequence entries, part 750.
3890. gbinv751.seq - Invertebrate sequence entries, part 751.
3891. gbinv752.seq - Invertebrate sequence entries, part 752.
3892. gbinv753.seq - Invertebrate sequence entries, part 753.
3893. gbinv754.seq - Invertebrate sequence entries, part 754.
3894. gbinv755.seq - Invertebrate sequence entries, part 755.
3895. gbinv756.seq - Invertebrate sequence entries, part 756.
3896. gbinv757.seq - Invertebrate sequence entries, part 757.
3897. gbinv758.seq - Invertebrate sequence entries, part 758.
3898. gbinv759.seq - Invertebrate sequence entries, part 759.
3899. gbinv76.seq - Invertebrate sequence entries, part 76.
3900. gbinv760.seq - Invertebrate sequence entries, part 760.
3901. gbinv761.seq - Invertebrate sequence entries, part 761.
3902. gbinv762.seq - Invertebrate sequence entries, part 762.
3903. gbinv763.seq - Invertebrate sequence entries, part 763.
3904. gbinv764.seq - Invertebrate sequence entries, part 764.
3905. gbinv765.seq - Invertebrate sequence entries, part 765.
3906. gbinv766.seq - Invertebrate sequence entries, part 766.
3907. gbinv767.seq - Invertebrate sequence entries, part 767.
3908. gbinv768.seq - Invertebrate sequence entries, part 768.
3909. gbinv769.seq - Invertebrate sequence entries, part 769.
3910. gbinv77.seq - Invertebrate sequence entries, part 77.
3911. gbinv770.seq - Invertebrate sequence entries, part 770.
3912. gbinv771.seq - Invertebrate sequence entries, part 771.
3913. gbinv772.seq - Invertebrate sequence entries, part 772.
3914. gbinv773.seq - Invertebrate sequence entries, part 773.
3915. gbinv774.seq - Invertebrate sequence entries, part 774.
3916. gbinv775.seq - Invertebrate sequence entries, part 775.
3917. gbinv776.seq - Invertebrate sequence entries, part 776.
3918. gbinv777.seq - Invertebrate sequence entries, part 777.
3919. gbinv778.seq - Invertebrate sequence entries, part 778.
3920. gbinv779.seq - Invertebrate sequence entries, part 779.
3921. gbinv78.seq - Invertebrate sequence entries, part 78.
3922. gbinv780.seq - Invertebrate sequence entries, part 780.
3923. gbinv781.seq - Invertebrate sequence entries, part 781.
3924. gbinv782.seq - Invertebrate sequence entries, part 782.
3925. gbinv783.seq - Invertebrate sequence entries, part 783.
3926. gbinv784.seq - Invertebrate sequence entries, part 784.
3927. gbinv785.seq - Invertebrate sequence entries, part 785.
3928. gbinv786.seq - Invertebrate sequence entries, part 786.
3929. gbinv787.seq - Invertebrate sequence entries, part 787.
3930. gbinv788.seq - Invertebrate sequence entries, part 788.
3931. gbinv789.seq - Invertebrate sequence entries, part 789.
3932. gbinv79.seq - Invertebrate sequence entries, part 79.
3933. gbinv790.seq - Invertebrate sequence entries, part 790.
3934. gbinv791.seq - Invertebrate sequence entries, part 791.
3935. gbinv792.seq - Invertebrate sequence entries, part 792.
3936. gbinv793.seq - Invertebrate sequence entries, part 793.
3937. gbinv794.seq - Invertebrate sequence entries, part 794.
3938. gbinv795.seq - Invertebrate sequence entries, part 795.
3939. gbinv796.seq - Invertebrate sequence entries, part 796.
3940. gbinv797.seq - Invertebrate sequence entries, part 797.
3941. gbinv798.seq - Invertebrate sequence entries, part 798.
3942. gbinv799.seq - Invertebrate sequence entries, part 799.
3943. gbinv8.seq - Invertebrate sequence entries, part 8.
3944. gbinv80.seq - Invertebrate sequence entries, part 80.
3945. gbinv800.seq - Invertebrate sequence entries, part 800.
3946. gbinv801.seq - Invertebrate sequence entries, part 801.
3947. gbinv802.seq - Invertebrate sequence entries, part 802.
3948. gbinv803.seq - Invertebrate sequence entries, part 803.
3949. gbinv804.seq - Invertebrate sequence entries, part 804.
3950. gbinv805.seq - Invertebrate sequence entries, part 805.
3951. gbinv806.seq - Invertebrate sequence entries, part 806.
3952. gbinv807.seq - Invertebrate sequence entries, part 807.
3953. gbinv808.seq - Invertebrate sequence entries, part 808.
3954. gbinv809.seq - Invertebrate sequence entries, part 809.
3955. gbinv81.seq - Invertebrate sequence entries, part 81.
3956. gbinv810.seq - Invertebrate sequence entries, part 810.
3957. gbinv811.seq - Invertebrate sequence entries, part 811.
3958. gbinv812.seq - Invertebrate sequence entries, part 812.
3959. gbinv813.seq - Invertebrate sequence entries, part 813.
3960. gbinv814.seq - Invertebrate sequence entries, part 814.
3961. gbinv815.seq - Invertebrate sequence entries, part 815.
3962. gbinv816.seq - Invertebrate sequence entries, part 816.
3963. gbinv817.seq - Invertebrate sequence entries, part 817.
3964. gbinv818.seq - Invertebrate sequence entries, part 818.
3965. gbinv819.seq - Invertebrate sequence entries, part 819.
3966. gbinv82.seq - Invertebrate sequence entries, part 82.
3967. gbinv820.seq - Invertebrate sequence entries, part 820.
3968. gbinv821.seq - Invertebrate sequence entries, part 821.
3969. gbinv822.seq - Invertebrate sequence entries, part 822.
3970. gbinv823.seq - Invertebrate sequence entries, part 823.
3971. gbinv824.seq - Invertebrate sequence entries, part 824.
3972. gbinv825.seq - Invertebrate sequence entries, part 825.
3973. gbinv826.seq - Invertebrate sequence entries, part 826.
3974. gbinv827.seq - Invertebrate sequence entries, part 827.
3975. gbinv828.seq - Invertebrate sequence entries, part 828.
3976. gbinv829.seq - Invertebrate sequence entries, part 829.
3977. gbinv83.seq - Invertebrate sequence entries, part 83.
3978. gbinv830.seq - Invertebrate sequence entries, part 830.
3979. gbinv831.seq - Invertebrate sequence entries, part 831.
3980. gbinv832.seq - Invertebrate sequence entries, part 832.
3981. gbinv833.seq - Invertebrate sequence entries, part 833.
3982. gbinv834.seq - Invertebrate sequence entries, part 834.
3983. gbinv835.seq - Invertebrate sequence entries, part 835.
3984. gbinv836.seq - Invertebrate sequence entries, part 836.
3985. gbinv837.seq - Invertebrate sequence entries, part 837.
3986. gbinv838.seq - Invertebrate sequence entries, part 838.
3987. gbinv839.seq - Invertebrate sequence entries, part 839.
3988. gbinv84.seq - Invertebrate sequence entries, part 84.
3989. gbinv840.seq - Invertebrate sequence entries, part 840.
3990. gbinv841.seq - Invertebrate sequence entries, part 841.
3991. gbinv842.seq - Invertebrate sequence entries, part 842.
3992. gbinv843.seq - Invertebrate sequence entries, part 843.
3993. gbinv844.seq - Invertebrate sequence entries, part 844.
3994. gbinv845.seq - Invertebrate sequence entries, part 845.
3995. gbinv846.seq - Invertebrate sequence entries, part 846.
3996. gbinv847.seq - Invertebrate sequence entries, part 847.
3997. gbinv848.seq - Invertebrate sequence entries, part 848.
3998. gbinv849.seq - Invertebrate sequence entries, part 849.
3999. gbinv85.seq - Invertebrate sequence entries, part 85.
4000. gbinv850.seq - Invertebrate sequence entries, part 850.
4001. gbinv851.seq - Invertebrate sequence entries, part 851.
4002. gbinv852.seq - Invertebrate sequence entries, part 852.
4003. gbinv853.seq - Invertebrate sequence entries, part 853.
4004. gbinv854.seq - Invertebrate sequence entries, part 854.
4005. gbinv855.seq - Invertebrate sequence entries, part 855.
4006. gbinv856.seq - Invertebrate sequence entries, part 856.
4007. gbinv857.seq - Invertebrate sequence entries, part 857.
4008. gbinv858.seq - Invertebrate sequence entries, part 858.
4009. gbinv859.seq - Invertebrate sequence entries, part 859.
4010. gbinv86.seq - Invertebrate sequence entries, part 86.
4011. gbinv860.seq - Invertebrate sequence entries, part 860.
4012. gbinv861.seq - Invertebrate sequence entries, part 861.
4013. gbinv862.seq - Invertebrate sequence entries, part 862.
4014. gbinv863.seq - Invertebrate sequence entries, part 863.
4015. gbinv864.seq - Invertebrate sequence entries, part 864.
4016. gbinv865.seq - Invertebrate sequence entries, part 865.
4017. gbinv866.seq - Invertebrate sequence entries, part 866.
4018. gbinv867.seq - Invertebrate sequence entries, part 867.
4019. gbinv868.seq - Invertebrate sequence entries, part 868.
4020. gbinv869.seq - Invertebrate sequence entries, part 869.
4021. gbinv87.seq - Invertebrate sequence entries, part 87.
4022. gbinv870.seq - Invertebrate sequence entries, part 870.
4023. gbinv871.seq - Invertebrate sequence entries, part 871.
4024. gbinv872.seq - Invertebrate sequence entries, part 872.
4025. gbinv873.seq - Invertebrate sequence entries, part 873.
4026. gbinv874.seq - Invertebrate sequence entries, part 874.
4027. gbinv875.seq - Invertebrate sequence entries, part 875.
4028. gbinv876.seq - Invertebrate sequence entries, part 876.
4029. gbinv877.seq - Invertebrate sequence entries, part 877.
4030. gbinv878.seq - Invertebrate sequence entries, part 878.
4031. gbinv879.seq - Invertebrate sequence entries, part 879.
4032. gbinv88.seq - Invertebrate sequence entries, part 88.
4033. gbinv880.seq - Invertebrate sequence entries, part 880.
4034. gbinv881.seq - Invertebrate sequence entries, part 881.
4035. gbinv882.seq - Invertebrate sequence entries, part 882.
4036. gbinv883.seq - Invertebrate sequence entries, part 883.
4037. gbinv884.seq - Invertebrate sequence entries, part 884.
4038. gbinv885.seq - Invertebrate sequence entries, part 885.
4039. gbinv886.seq - Invertebrate sequence entries, part 886.
4040. gbinv887.seq - Invertebrate sequence entries, part 887.
4041. gbinv888.seq - Invertebrate sequence entries, part 888.
4042. gbinv889.seq - Invertebrate sequence entries, part 889.
4043. gbinv89.seq - Invertebrate sequence entries, part 89.
4044. gbinv890.seq - Invertebrate sequence entries, part 890.
4045. gbinv891.seq - Invertebrate sequence entries, part 891.
4046. gbinv892.seq - Invertebrate sequence entries, part 892.
4047. gbinv893.seq - Invertebrate sequence entries, part 893.
4048. gbinv894.seq - Invertebrate sequence entries, part 894.
4049. gbinv895.seq - Invertebrate sequence entries, part 895.
4050. gbinv896.seq - Invertebrate sequence entries, part 896.
4051. gbinv897.seq - Invertebrate sequence entries, part 897.
4052. gbinv898.seq - Invertebrate sequence entries, part 898.
4053. gbinv899.seq - Invertebrate sequence entries, part 899.
4054. gbinv9.seq - Invertebrate sequence entries, part 9.
4055. gbinv90.seq - Invertebrate sequence entries, part 90.
4056. gbinv900.seq - Invertebrate sequence entries, part 900.
4057. gbinv901.seq - Invertebrate sequence entries, part 901.
4058. gbinv902.seq - Invertebrate sequence entries, part 902.
4059. gbinv903.seq - Invertebrate sequence entries, part 903.
4060. gbinv904.seq - Invertebrate sequence entries, part 904.
4061. gbinv905.seq - Invertebrate sequence entries, part 905.
4062. gbinv906.seq - Invertebrate sequence entries, part 906.
4063. gbinv907.seq - Invertebrate sequence entries, part 907.
4064. gbinv908.seq - Invertebrate sequence entries, part 908.
4065. gbinv909.seq - Invertebrate sequence entries, part 909.
4066. gbinv91.seq - Invertebrate sequence entries, part 91.
4067. gbinv910.seq - Invertebrate sequence entries, part 910.
4068. gbinv911.seq - Invertebrate sequence entries, part 911.
4069. gbinv912.seq - Invertebrate sequence entries, part 912.
4070. gbinv913.seq - Invertebrate sequence entries, part 913.
4071. gbinv914.seq - Invertebrate sequence entries, part 914.
4072. gbinv915.seq - Invertebrate sequence entries, part 915.
4073. gbinv916.seq - Invertebrate sequence entries, part 916.
4074. gbinv917.seq - Invertebrate sequence entries, part 917.
4075. gbinv918.seq - Invertebrate sequence entries, part 918.
4076. gbinv919.seq - Invertebrate sequence entries, part 919.
4077. gbinv92.seq - Invertebrate sequence entries, part 92.
4078. gbinv920.seq - Invertebrate sequence entries, part 920.
4079. gbinv921.seq - Invertebrate sequence entries, part 921.
4080. gbinv922.seq - Invertebrate sequence entries, part 922.
4081. gbinv923.seq - Invertebrate sequence entries, part 923.
4082. gbinv924.seq - Invertebrate sequence entries, part 924.
4083. gbinv925.seq - Invertebrate sequence entries, part 925.
4084. gbinv926.seq - Invertebrate sequence entries, part 926.
4085. gbinv927.seq - Invertebrate sequence entries, part 927.
4086. gbinv928.seq - Invertebrate sequence entries, part 928.
4087. gbinv929.seq - Invertebrate sequence entries, part 929.
4088. gbinv93.seq - Invertebrate sequence entries, part 93.
4089. gbinv930.seq - Invertebrate sequence entries, part 930.
4090. gbinv931.seq - Invertebrate sequence entries, part 931.
4091. gbinv932.seq - Invertebrate sequence entries, part 932.
4092. gbinv933.seq - Invertebrate sequence entries, part 933.
4093. gbinv934.seq - Invertebrate sequence entries, part 934.
4094. gbinv935.seq - Invertebrate sequence entries, part 935.
4095. gbinv936.seq - Invertebrate sequence entries, part 936.
4096. gbinv937.seq - Invertebrate sequence entries, part 937.
4097. gbinv938.seq - Invertebrate sequence entries, part 938.
4098. gbinv939.seq - Invertebrate sequence entries, part 939.
4099. gbinv94.seq - Invertebrate sequence entries, part 94.
4100. gbinv940.seq - Invertebrate sequence entries, part 940.
4101. gbinv941.seq - Invertebrate sequence entries, part 941.
4102. gbinv942.seq - Invertebrate sequence entries, part 942.
4103. gbinv943.seq - Invertebrate sequence entries, part 943.
4104. gbinv944.seq - Invertebrate sequence entries, part 944.
4105. gbinv945.seq - Invertebrate sequence entries, part 945.
4106. gbinv946.seq - Invertebrate sequence entries, part 946.
4107. gbinv947.seq - Invertebrate sequence entries, part 947.
4108. gbinv948.seq - Invertebrate sequence entries, part 948.
4109. gbinv949.seq - Invertebrate sequence entries, part 949.
4110. gbinv95.seq - Invertebrate sequence entries, part 95.
4111. gbinv950.seq - Invertebrate sequence entries, part 950.
4112. gbinv951.seq - Invertebrate sequence entries, part 951.
4113. gbinv952.seq - Invertebrate sequence entries, part 952.
4114. gbinv953.seq - Invertebrate sequence entries, part 953.
4115. gbinv954.seq - Invertebrate sequence entries, part 954.
4116. gbinv955.seq - Invertebrate sequence entries, part 955.
4117. gbinv956.seq - Invertebrate sequence entries, part 956.
4118. gbinv957.seq - Invertebrate sequence entries, part 957.
4119. gbinv958.seq - Invertebrate sequence entries, part 958.
4120. gbinv959.seq - Invertebrate sequence entries, part 959.
4121. gbinv96.seq - Invertebrate sequence entries, part 96.
4122. gbinv960.seq - Invertebrate sequence entries, part 960.
4123. gbinv961.seq - Invertebrate sequence entries, part 961.
4124. gbinv962.seq - Invertebrate sequence entries, part 962.
4125. gbinv963.seq - Invertebrate sequence entries, part 963.
4126. gbinv964.seq - Invertebrate sequence entries, part 964.
4127. gbinv965.seq - Invertebrate sequence entries, part 965.
4128. gbinv966.seq - Invertebrate sequence entries, part 966.
4129. gbinv967.seq - Invertebrate sequence entries, part 967.
4130. gbinv968.seq - Invertebrate sequence entries, part 968.
4131. gbinv969.seq - Invertebrate sequence entries, part 969.
4132. gbinv97.seq - Invertebrate sequence entries, part 97.
4133. gbinv970.seq - Invertebrate sequence entries, part 970.
4134. gbinv971.seq - Invertebrate sequence entries, part 971.
4135. gbinv972.seq - Invertebrate sequence entries, part 972.
4136. gbinv973.seq - Invertebrate sequence entries, part 973.
4137. gbinv974.seq - Invertebrate sequence entries, part 974.
4138. gbinv975.seq - Invertebrate sequence entries, part 975.
4139. gbinv976.seq - Invertebrate sequence entries, part 976.
4140. gbinv977.seq - Invertebrate sequence entries, part 977.
4141. gbinv978.seq - Invertebrate sequence entries, part 978.
4142. gbinv979.seq - Invertebrate sequence entries, part 979.
4143. gbinv98.seq - Invertebrate sequence entries, part 98.
4144. gbinv980.seq - Invertebrate sequence entries, part 980.
4145. gbinv981.seq - Invertebrate sequence entries, part 981.
4146. gbinv982.seq - Invertebrate sequence entries, part 982.
4147. gbinv983.seq - Invertebrate sequence entries, part 983.
4148. gbinv984.seq - Invertebrate sequence entries, part 984.
4149. gbinv985.seq - Invertebrate sequence entries, part 985.
4150. gbinv986.seq - Invertebrate sequence entries, part 986.
4151. gbinv987.seq - Invertebrate sequence entries, part 987.
4152. gbinv988.seq - Invertebrate sequence entries, part 988.
4153. gbinv989.seq - Invertebrate sequence entries, part 989.
4154. gbinv99.seq - Invertebrate sequence entries, part 99.
4155. gbinv990.seq - Invertebrate sequence entries, part 990.
4156. gbinv991.seq - Invertebrate sequence entries, part 991.
4157. gbinv992.seq - Invertebrate sequence entries, part 992.
4158. gbinv993.seq - Invertebrate sequence entries, part 993.
4159. gbinv994.seq - Invertebrate sequence entries, part 994.
4160. gbinv995.seq - Invertebrate sequence entries, part 995.
4161. gbinv996.seq - Invertebrate sequence entries, part 996.
4162. gbinv997.seq - Invertebrate sequence entries, part 997.
4163. gbinv998.seq - Invertebrate sequence entries, part 998.
4164. gbinv999.seq - Invertebrate sequence entries, part 999.
4165. gbmam1.seq - Other mammalian sequence entries, part 1.
4166. gbmam10.seq - Other mammalian sequence entries, part 10.
4167. gbmam100.seq - Other mammalian sequence entries, part 100.
4168. gbmam101.seq - Other mammalian sequence entries, part 101.
4169. gbmam102.seq - Other mammalian sequence entries, part 102.
4170. gbmam103.seq - Other mammalian sequence entries, part 103.
4171. gbmam104.seq - Other mammalian sequence entries, part 104.
4172. gbmam105.seq - Other mammalian sequence entries, part 105.
4173. gbmam106.seq - Other mammalian sequence entries, part 106.
4174. gbmam107.seq - Other mammalian sequence entries, part 107.
4175. gbmam108.seq - Other mammalian sequence entries, part 108.
4176. gbmam109.seq - Other mammalian sequence entries, part 109.
4177. gbmam11.seq - Other mammalian sequence entries, part 11.
4178. gbmam110.seq - Other mammalian sequence entries, part 110.
4179. gbmam111.seq - Other mammalian sequence entries, part 111.
4180. gbmam112.seq - Other mammalian sequence entries, part 112.
4181. gbmam113.seq - Other mammalian sequence entries, part 113.
4182. gbmam114.seq - Other mammalian sequence entries, part 114.
4183. gbmam115.seq - Other mammalian sequence entries, part 115.
4184. gbmam116.seq - Other mammalian sequence entries, part 116.
4185. gbmam117.seq - Other mammalian sequence entries, part 117.
4186. gbmam118.seq - Other mammalian sequence entries, part 118.
4187. gbmam119.seq - Other mammalian sequence entries, part 119.
4188. gbmam12.seq - Other mammalian sequence entries, part 12.
4189. gbmam120.seq - Other mammalian sequence entries, part 120.
4190. gbmam121.seq - Other mammalian sequence entries, part 121.
4191. gbmam122.seq - Other mammalian sequence entries, part 122.
4192. gbmam123.seq - Other mammalian sequence entries, part 123.
4193. gbmam124.seq - Other mammalian sequence entries, part 124.
4194. gbmam125.seq - Other mammalian sequence entries, part 125.
4195. gbmam126.seq - Other mammalian sequence entries, part 126.
4196. gbmam127.seq - Other mammalian sequence entries, part 127.
4197. gbmam128.seq - Other mammalian sequence entries, part 128.
4198. gbmam129.seq - Other mammalian sequence entries, part 129.
4199. gbmam13.seq - Other mammalian sequence entries, part 13.
4200. gbmam130.seq - Other mammalian sequence entries, part 130.
4201. gbmam131.seq - Other mammalian sequence entries, part 131.
4202. gbmam132.seq - Other mammalian sequence entries, part 132.
4203. gbmam133.seq - Other mammalian sequence entries, part 133.
4204. gbmam134.seq - Other mammalian sequence entries, part 134.
4205. gbmam135.seq - Other mammalian sequence entries, part 135.
4206. gbmam136.seq - Other mammalian sequence entries, part 136.
4207. gbmam137.seq - Other mammalian sequence entries, part 137.
4208. gbmam138.seq - Other mammalian sequence entries, part 138.
4209. gbmam139.seq - Other mammalian sequence entries, part 139.
4210. gbmam14.seq - Other mammalian sequence entries, part 14.
4211. gbmam140.seq - Other mammalian sequence entries, part 140.
4212. gbmam141.seq - Other mammalian sequence entries, part 141.
4213. gbmam142.seq - Other mammalian sequence entries, part 142.
4214. gbmam143.seq - Other mammalian sequence entries, part 143.
4215. gbmam144.seq - Other mammalian sequence entries, part 144.
4216. gbmam145.seq - Other mammalian sequence entries, part 145.
4217. gbmam146.seq - Other mammalian sequence entries, part 146.
4218. gbmam147.seq - Other mammalian sequence entries, part 147.
4219. gbmam148.seq - Other mammalian sequence entries, part 148.
4220. gbmam149.seq - Other mammalian sequence entries, part 149.
4221. gbmam15.seq - Other mammalian sequence entries, part 15.
4222. gbmam150.seq - Other mammalian sequence entries, part 150.
4223. gbmam151.seq - Other mammalian sequence entries, part 151.
4224. gbmam152.seq - Other mammalian sequence entries, part 152.
4225. gbmam153.seq - Other mammalian sequence entries, part 153.
4226. gbmam154.seq - Other mammalian sequence entries, part 154.
4227. gbmam155.seq - Other mammalian sequence entries, part 155.
4228. gbmam156.seq - Other mammalian sequence entries, part 156.
4229. gbmam157.seq - Other mammalian sequence entries, part 157.
4230. gbmam158.seq - Other mammalian sequence entries, part 158.
4231. gbmam159.seq - Other mammalian sequence entries, part 159.
4232. gbmam16.seq - Other mammalian sequence entries, part 16.
4233. gbmam160.seq - Other mammalian sequence entries, part 160.
4234. gbmam161.seq - Other mammalian sequence entries, part 161.
4235. gbmam162.seq - Other mammalian sequence entries, part 162.
4236. gbmam163.seq - Other mammalian sequence entries, part 163.
4237. gbmam164.seq - Other mammalian sequence entries, part 164.
4238. gbmam165.seq - Other mammalian sequence entries, part 165.
4239. gbmam166.seq - Other mammalian sequence entries, part 166.
4240. gbmam167.seq - Other mammalian sequence entries, part 167.
4241. gbmam168.seq - Other mammalian sequence entries, part 168.
4242. gbmam169.seq - Other mammalian sequence entries, part 169.
4243. gbmam17.seq - Other mammalian sequence entries, part 17.
4244. gbmam170.seq - Other mammalian sequence entries, part 170.
4245. gbmam171.seq - Other mammalian sequence entries, part 171.
4246. gbmam172.seq - Other mammalian sequence entries, part 172.
4247. gbmam173.seq - Other mammalian sequence entries, part 173.
4248. gbmam174.seq - Other mammalian sequence entries, part 174.
4249. gbmam175.seq - Other mammalian sequence entries, part 175.
4250. gbmam176.seq - Other mammalian sequence entries, part 176.
4251. gbmam177.seq - Other mammalian sequence entries, part 177.
4252. gbmam178.seq - Other mammalian sequence entries, part 178.
4253. gbmam179.seq - Other mammalian sequence entries, part 179.
4254. gbmam18.seq - Other mammalian sequence entries, part 18.
4255. gbmam180.seq - Other mammalian sequence entries, part 180.
4256. gbmam181.seq - Other mammalian sequence entries, part 181.
4257. gbmam182.seq - Other mammalian sequence entries, part 182.
4258. gbmam183.seq - Other mammalian sequence entries, part 183.
4259. gbmam184.seq - Other mammalian sequence entries, part 184.
4260. gbmam185.seq - Other mammalian sequence entries, part 185.
4261. gbmam186.seq - Other mammalian sequence entries, part 186.
4262. gbmam187.seq - Other mammalian sequence entries, part 187.
4263. gbmam188.seq - Other mammalian sequence entries, part 188.
4264. gbmam189.seq - Other mammalian sequence entries, part 189.
4265. gbmam19.seq - Other mammalian sequence entries, part 19.
4266. gbmam190.seq - Other mammalian sequence entries, part 190.
4267. gbmam191.seq - Other mammalian sequence entries, part 191.
4268. gbmam192.seq - Other mammalian sequence entries, part 192.
4269. gbmam193.seq - Other mammalian sequence entries, part 193.
4270. gbmam194.seq - Other mammalian sequence entries, part 194.
4271. gbmam195.seq - Other mammalian sequence entries, part 195.
4272. gbmam196.seq - Other mammalian sequence entries, part 196.
4273. gbmam197.seq - Other mammalian sequence entries, part 197.
4274. gbmam198.seq - Other mammalian sequence entries, part 198.
4275. gbmam199.seq - Other mammalian sequence entries, part 199.
4276. gbmam2.seq - Other mammalian sequence entries, part 2.
4277. gbmam20.seq - Other mammalian sequence entries, part 20.
4278. gbmam200.seq - Other mammalian sequence entries, part 200.
4279. gbmam201.seq - Other mammalian sequence entries, part 201.
4280. gbmam202.seq - Other mammalian sequence entries, part 202.
4281. gbmam203.seq - Other mammalian sequence entries, part 203.
4282. gbmam204.seq - Other mammalian sequence entries, part 204.
4283. gbmam205.seq - Other mammalian sequence entries, part 205.
4284. gbmam206.seq - Other mammalian sequence entries, part 206.
4285. gbmam207.seq - Other mammalian sequence entries, part 207.
4286. gbmam208.seq - Other mammalian sequence entries, part 208.
4287. gbmam209.seq - Other mammalian sequence entries, part 209.
4288. gbmam21.seq - Other mammalian sequence entries, part 21.
4289. gbmam210.seq - Other mammalian sequence entries, part 210.
4290. gbmam211.seq - Other mammalian sequence entries, part 211.
4291. gbmam212.seq - Other mammalian sequence entries, part 212.
4292. gbmam213.seq - Other mammalian sequence entries, part 213.
4293. gbmam214.seq - Other mammalian sequence entries, part 214.
4294. gbmam215.seq - Other mammalian sequence entries, part 215.
4295. gbmam216.seq - Other mammalian sequence entries, part 216.
4296. gbmam217.seq - Other mammalian sequence entries, part 217.
4297. gbmam218.seq - Other mammalian sequence entries, part 218.
4298. gbmam219.seq - Other mammalian sequence entries, part 219.
4299. gbmam22.seq - Other mammalian sequence entries, part 22.
4300. gbmam220.seq - Other mammalian sequence entries, part 220.
4301. gbmam221.seq - Other mammalian sequence entries, part 221.
4302. gbmam222.seq - Other mammalian sequence entries, part 222.
4303. gbmam223.seq - Other mammalian sequence entries, part 223.
4304. gbmam224.seq - Other mammalian sequence entries, part 224.
4305. gbmam225.seq - Other mammalian sequence entries, part 225.
4306. gbmam226.seq - Other mammalian sequence entries, part 226.
4307. gbmam227.seq - Other mammalian sequence entries, part 227.
4308. gbmam228.seq - Other mammalian sequence entries, part 228.
4309. gbmam229.seq - Other mammalian sequence entries, part 229.
4310. gbmam23.seq - Other mammalian sequence entries, part 23.
4311. gbmam230.seq - Other mammalian sequence entries, part 230.
4312. gbmam231.seq - Other mammalian sequence entries, part 231.
4313. gbmam232.seq - Other mammalian sequence entries, part 232.
4314. gbmam233.seq - Other mammalian sequence entries, part 233.
4315. gbmam234.seq - Other mammalian sequence entries, part 234.
4316. gbmam235.seq - Other mammalian sequence entries, part 235.
4317. gbmam236.seq - Other mammalian sequence entries, part 236.
4318. gbmam237.seq - Other mammalian sequence entries, part 237.
4319. gbmam238.seq - Other mammalian sequence entries, part 238.
4320. gbmam239.seq - Other mammalian sequence entries, part 239.
4321. gbmam24.seq - Other mammalian sequence entries, part 24.
4322. gbmam240.seq - Other mammalian sequence entries, part 240.
4323. gbmam241.seq - Other mammalian sequence entries, part 241.
4324. gbmam242.seq - Other mammalian sequence entries, part 242.
4325. gbmam243.seq - Other mammalian sequence entries, part 243.
4326. gbmam244.seq - Other mammalian sequence entries, part 244.
4327. gbmam245.seq - Other mammalian sequence entries, part 245.
4328. gbmam246.seq - Other mammalian sequence entries, part 246.
4329. gbmam247.seq - Other mammalian sequence entries, part 247.
4330. gbmam248.seq - Other mammalian sequence entries, part 248.
4331. gbmam249.seq - Other mammalian sequence entries, part 249.
4332. gbmam25.seq - Other mammalian sequence entries, part 25.
4333. gbmam250.seq - Other mammalian sequence entries, part 250.
4334. gbmam251.seq - Other mammalian sequence entries, part 251.
4335. gbmam252.seq - Other mammalian sequence entries, part 252.
4336. gbmam253.seq - Other mammalian sequence entries, part 253.
4337. gbmam254.seq - Other mammalian sequence entries, part 254.
4338. gbmam255.seq - Other mammalian sequence entries, part 255.
4339. gbmam256.seq - Other mammalian sequence entries, part 256.
4340. gbmam257.seq - Other mammalian sequence entries, part 257.
4341. gbmam258.seq - Other mammalian sequence entries, part 258.
4342. gbmam259.seq - Other mammalian sequence entries, part 259.
4343. gbmam26.seq - Other mammalian sequence entries, part 26.
4344. gbmam260.seq - Other mammalian sequence entries, part 260.
4345. gbmam261.seq - Other mammalian sequence entries, part 261.
4346. gbmam262.seq - Other mammalian sequence entries, part 262.
4347. gbmam263.seq - Other mammalian sequence entries, part 263.
4348. gbmam264.seq - Other mammalian sequence entries, part 264.
4349. gbmam265.seq - Other mammalian sequence entries, part 265.
4350. gbmam266.seq - Other mammalian sequence entries, part 266.
4351. gbmam267.seq - Other mammalian sequence entries, part 267.
4352. gbmam268.seq - Other mammalian sequence entries, part 268.
4353. gbmam269.seq - Other mammalian sequence entries, part 269.
4354. gbmam27.seq - Other mammalian sequence entries, part 27.
4355. gbmam270.seq - Other mammalian sequence entries, part 270.
4356. gbmam271.seq - Other mammalian sequence entries, part 271.
4357. gbmam272.seq - Other mammalian sequence entries, part 272.
4358. gbmam28.seq - Other mammalian sequence entries, part 28.
4359. gbmam29.seq - Other mammalian sequence entries, part 29.
4360. gbmam3.seq - Other mammalian sequence entries, part 3.
4361. gbmam30.seq - Other mammalian sequence entries, part 30.
4362. gbmam31.seq - Other mammalian sequence entries, part 31.
4363. gbmam32.seq - Other mammalian sequence entries, part 32.
4364. gbmam33.seq - Other mammalian sequence entries, part 33.
4365. gbmam34.seq - Other mammalian sequence entries, part 34.
4366. gbmam35.seq - Other mammalian sequence entries, part 35.
4367. gbmam36.seq - Other mammalian sequence entries, part 36.
4368. gbmam37.seq - Other mammalian sequence entries, part 37.
4369. gbmam38.seq - Other mammalian sequence entries, part 38.
4370. gbmam39.seq - Other mammalian sequence entries, part 39.
4371. gbmam4.seq - Other mammalian sequence entries, part 4.
4372. gbmam40.seq - Other mammalian sequence entries, part 40.
4373. gbmam41.seq - Other mammalian sequence entries, part 41.
4374. gbmam42.seq - Other mammalian sequence entries, part 42.
4375. gbmam43.seq - Other mammalian sequence entries, part 43.
4376. gbmam44.seq - Other mammalian sequence entries, part 44.
4377. gbmam45.seq - Other mammalian sequence entries, part 45.
4378. gbmam46.seq - Other mammalian sequence entries, part 46.
4379. gbmam47.seq - Other mammalian sequence entries, part 47.
4380. gbmam48.seq - Other mammalian sequence entries, part 48.
4381. gbmam49.seq - Other mammalian sequence entries, part 49.
4382. gbmam5.seq - Other mammalian sequence entries, part 5.
4383. gbmam50.seq - Other mammalian sequence entries, part 50.
4384. gbmam51.seq - Other mammalian sequence entries, part 51.
4385. gbmam52.seq - Other mammalian sequence entries, part 52.
4386. gbmam53.seq - Other mammalian sequence entries, part 53.
4387. gbmam54.seq - Other mammalian sequence entries, part 54.
4388. gbmam55.seq - Other mammalian sequence entries, part 55.
4389. gbmam56.seq - Other mammalian sequence entries, part 56.
4390. gbmam57.seq - Other mammalian sequence entries, part 57.
4391. gbmam58.seq - Other mammalian sequence entries, part 58.
4392. gbmam59.seq - Other mammalian sequence entries, part 59.
4393. gbmam6.seq - Other mammalian sequence entries, part 6.
4394. gbmam60.seq - Other mammalian sequence entries, part 60.
4395. gbmam61.seq - Other mammalian sequence entries, part 61.
4396. gbmam62.seq - Other mammalian sequence entries, part 62.
4397. gbmam63.seq - Other mammalian sequence entries, part 63.
4398. gbmam64.seq - Other mammalian sequence entries, part 64.
4399. gbmam65.seq - Other mammalian sequence entries, part 65.
4400. gbmam66.seq - Other mammalian sequence entries, part 66.
4401. gbmam67.seq - Other mammalian sequence entries, part 67.
4402. gbmam68.seq - Other mammalian sequence entries, part 68.
4403. gbmam69.seq - Other mammalian sequence entries, part 69.
4404. gbmam7.seq - Other mammalian sequence entries, part 7.
4405. gbmam70.seq - Other mammalian sequence entries, part 70.
4406. gbmam71.seq - Other mammalian sequence entries, part 71.
4407. gbmam72.seq - Other mammalian sequence entries, part 72.
4408. gbmam73.seq - Other mammalian sequence entries, part 73.
4409. gbmam74.seq - Other mammalian sequence entries, part 74.
4410. gbmam75.seq - Other mammalian sequence entries, part 75.
4411. gbmam76.seq - Other mammalian sequence entries, part 76.
4412. gbmam77.seq - Other mammalian sequence entries, part 77.
4413. gbmam78.seq - Other mammalian sequence entries, part 78.
4414. gbmam79.seq - Other mammalian sequence entries, part 79.
4415. gbmam8.seq - Other mammalian sequence entries, part 8.
4416. gbmam80.seq - Other mammalian sequence entries, part 80.
4417. gbmam81.seq - Other mammalian sequence entries, part 81.
4418. gbmam82.seq - Other mammalian sequence entries, part 82.
4419. gbmam83.seq - Other mammalian sequence entries, part 83.
4420. gbmam84.seq - Other mammalian sequence entries, part 84.
4421. gbmam85.seq - Other mammalian sequence entries, part 85.
4422. gbmam86.seq - Other mammalian sequence entries, part 86.
4423. gbmam87.seq - Other mammalian sequence entries, part 87.
4424. gbmam88.seq - Other mammalian sequence entries, part 88.
4425. gbmam89.seq - Other mammalian sequence entries, part 89.
4426. gbmam9.seq - Other mammalian sequence entries, part 9.
4427. gbmam90.seq - Other mammalian sequence entries, part 90.
4428. gbmam91.seq - Other mammalian sequence entries, part 91.
4429. gbmam92.seq - Other mammalian sequence entries, part 92.
4430. gbmam93.seq - Other mammalian sequence entries, part 93.
4431. gbmam94.seq - Other mammalian sequence entries, part 94.
4432. gbmam95.seq - Other mammalian sequence entries, part 95.
4433. gbmam96.seq - Other mammalian sequence entries, part 96.
4434. gbmam97.seq - Other mammalian sequence entries, part 97.
4435. gbmam98.seq - Other mammalian sequence entries, part 98.
4436. gbmam99.seq - Other mammalian sequence entries, part 99.
4437. gbnew.txt - Accession numbers of entries new since the previous release.
4438. gbpat1.seq - Patent sequence entries, part 1.
4439. gbpat10.seq - Patent sequence entries, part 10.
4440. gbpat100.seq - Patent sequence entries, part 100.
4441. gbpat101.seq - Patent sequence entries, part 101.
4442. gbpat102.seq - Patent sequence entries, part 102.
4443. gbpat103.seq - Patent sequence entries, part 103.
4444. gbpat104.seq - Patent sequence entries, part 104.
4445. gbpat105.seq - Patent sequence entries, part 105.
4446. gbpat106.seq - Patent sequence entries, part 106.
4447. gbpat107.seq - Patent sequence entries, part 107.
4448. gbpat108.seq - Patent sequence entries, part 108.
4449. gbpat109.seq - Patent sequence entries, part 109.
4450. gbpat11.seq - Patent sequence entries, part 11.
4451. gbpat110.seq - Patent sequence entries, part 110.
4452. gbpat111.seq - Patent sequence entries, part 111.
4453. gbpat112.seq - Patent sequence entries, part 112.
4454. gbpat113.seq - Patent sequence entries, part 113.
4455. gbpat114.seq - Patent sequence entries, part 114.
4456. gbpat115.seq - Patent sequence entries, part 115.
4457. gbpat116.seq - Patent sequence entries, part 116.
4458. gbpat117.seq - Patent sequence entries, part 117.
4459. gbpat118.seq - Patent sequence entries, part 118.
4460. gbpat119.seq - Patent sequence entries, part 119.
4461. gbpat12.seq - Patent sequence entries, part 12.
4462. gbpat120.seq - Patent sequence entries, part 120.
4463. gbpat121.seq - Patent sequence entries, part 121.
4464. gbpat122.seq - Patent sequence entries, part 122.
4465. gbpat123.seq - Patent sequence entries, part 123.
4466. gbpat124.seq - Patent sequence entries, part 124.
4467. gbpat125.seq - Patent sequence entries, part 125.
4468. gbpat126.seq - Patent sequence entries, part 126.
4469. gbpat127.seq - Patent sequence entries, part 127.
4470. gbpat128.seq - Patent sequence entries, part 128.
4471. gbpat129.seq - Patent sequence entries, part 129.
4472. gbpat13.seq - Patent sequence entries, part 13.
4473. gbpat130.seq - Patent sequence entries, part 130.
4474. gbpat131.seq - Patent sequence entries, part 131.
4475. gbpat132.seq - Patent sequence entries, part 132.
4476. gbpat133.seq - Patent sequence entries, part 133.
4477. gbpat134.seq - Patent sequence entries, part 134.
4478. gbpat135.seq - Patent sequence entries, part 135.
4479. gbpat136.seq - Patent sequence entries, part 136.
4480. gbpat137.seq - Patent sequence entries, part 137.
4481. gbpat138.seq - Patent sequence entries, part 138.
4482. gbpat139.seq - Patent sequence entries, part 139.
4483. gbpat14.seq - Patent sequence entries, part 14.
4484. gbpat140.seq - Patent sequence entries, part 140.
4485. gbpat141.seq - Patent sequence entries, part 141.
4486. gbpat142.seq - Patent sequence entries, part 142.
4487. gbpat143.seq - Patent sequence entries, part 143.
4488. gbpat144.seq - Patent sequence entries, part 144.
4489. gbpat145.seq - Patent sequence entries, part 145.
4490. gbpat146.seq - Patent sequence entries, part 146.
4491. gbpat147.seq - Patent sequence entries, part 147.
4492. gbpat148.seq - Patent sequence entries, part 148.
4493. gbpat149.seq - Patent sequence entries, part 149.
4494. gbpat15.seq - Patent sequence entries, part 15.
4495. gbpat150.seq - Patent sequence entries, part 150.
4496. gbpat151.seq - Patent sequence entries, part 151.
4497. gbpat152.seq - Patent sequence entries, part 152.
4498. gbpat153.seq - Patent sequence entries, part 153.
4499. gbpat154.seq - Patent sequence entries, part 154.
4500. gbpat155.seq - Patent sequence entries, part 155.
4501. gbpat156.seq - Patent sequence entries, part 156.
4502. gbpat157.seq - Patent sequence entries, part 157.
4503. gbpat158.seq - Patent sequence entries, part 158.
4504. gbpat159.seq - Patent sequence entries, part 159.
4505. gbpat16.seq - Patent sequence entries, part 16.
4506. gbpat160.seq - Patent sequence entries, part 160.
4507. gbpat161.seq - Patent sequence entries, part 161.
4508. gbpat162.seq - Patent sequence entries, part 162.
4509. gbpat163.seq - Patent sequence entries, part 163.
4510. gbpat164.seq - Patent sequence entries, part 164.
4511. gbpat165.seq - Patent sequence entries, part 165.
4512. gbpat166.seq - Patent sequence entries, part 166.
4513. gbpat167.seq - Patent sequence entries, part 167.
4514. gbpat168.seq - Patent sequence entries, part 168.
4515. gbpat169.seq - Patent sequence entries, part 169.
4516. gbpat17.seq - Patent sequence entries, part 17.
4517. gbpat170.seq - Patent sequence entries, part 170.
4518. gbpat171.seq - Patent sequence entries, part 171.
4519. gbpat172.seq - Patent sequence entries, part 172.
4520. gbpat173.seq - Patent sequence entries, part 173.
4521. gbpat174.seq - Patent sequence entries, part 174.
4522. gbpat175.seq - Patent sequence entries, part 175.
4523. gbpat176.seq - Patent sequence entries, part 176.
4524. gbpat177.seq - Patent sequence entries, part 177.
4525. gbpat178.seq - Patent sequence entries, part 178.
4526. gbpat179.seq - Patent sequence entries, part 179.
4527. gbpat18.seq - Patent sequence entries, part 18.
4528. gbpat180.seq - Patent sequence entries, part 180.
4529. gbpat181.seq - Patent sequence entries, part 181.
4530. gbpat182.seq - Patent sequence entries, part 182.
4531. gbpat183.seq - Patent sequence entries, part 183.
4532. gbpat184.seq - Patent sequence entries, part 184.
4533. gbpat185.seq - Patent sequence entries, part 185.
4534. gbpat186.seq - Patent sequence entries, part 186.
4535. gbpat187.seq - Patent sequence entries, part 187.
4536. gbpat188.seq - Patent sequence entries, part 188.
4537. gbpat189.seq - Patent sequence entries, part 189.
4538. gbpat19.seq - Patent sequence entries, part 19.
4539. gbpat190.seq - Patent sequence entries, part 190.
4540. gbpat191.seq - Patent sequence entries, part 191.
4541. gbpat192.seq - Patent sequence entries, part 192.
4542. gbpat193.seq - Patent sequence entries, part 193.
4543. gbpat194.seq - Patent sequence entries, part 194.
4544. gbpat195.seq - Patent sequence entries, part 195.
4545. gbpat196.seq - Patent sequence entries, part 196.
4546. gbpat197.seq - Patent sequence entries, part 197.
4547. gbpat198.seq - Patent sequence entries, part 198.
4548. gbpat199.seq - Patent sequence entries, part 199.
4549. gbpat2.seq - Patent sequence entries, part 2.
4550. gbpat20.seq - Patent sequence entries, part 20.
4551. gbpat200.seq - Patent sequence entries, part 200.
4552. gbpat201.seq - Patent sequence entries, part 201.
4553. gbpat202.seq - Patent sequence entries, part 202.
4554. gbpat203.seq - Patent sequence entries, part 203.
4555. gbpat204.seq - Patent sequence entries, part 204.
4556. gbpat205.seq - Patent sequence entries, part 205.
4557. gbpat206.seq - Patent sequence entries, part 206.
4558. gbpat207.seq - Patent sequence entries, part 207.
4559. gbpat208.seq - Patent sequence entries, part 208.
4560. gbpat209.seq - Patent sequence entries, part 209.
4561. gbpat21.seq - Patent sequence entries, part 21.
4562. gbpat210.seq - Patent sequence entries, part 210.
4563. gbpat211.seq - Patent sequence entries, part 211.
4564. gbpat212.seq - Patent sequence entries, part 212.
4565. gbpat213.seq - Patent sequence entries, part 213.
4566. gbpat214.seq - Patent sequence entries, part 214.
4567. gbpat215.seq - Patent sequence entries, part 215.
4568. gbpat216.seq - Patent sequence entries, part 216.
4569. gbpat217.seq - Patent sequence entries, part 217.
4570. gbpat218.seq - Patent sequence entries, part 218.
4571. gbpat219.seq - Patent sequence entries, part 219.
4572. gbpat22.seq - Patent sequence entries, part 22.
4573. gbpat220.seq - Patent sequence entries, part 220.
4574. gbpat221.seq - Patent sequence entries, part 221.
4575. gbpat222.seq - Patent sequence entries, part 222.
4576. gbpat223.seq - Patent sequence entries, part 223.
4577. gbpat224.seq - Patent sequence entries, part 224.
4578. gbpat225.seq - Patent sequence entries, part 225.
4579. gbpat226.seq - Patent sequence entries, part 226.
4580. gbpat227.seq - Patent sequence entries, part 227.
4581. gbpat228.seq - Patent sequence entries, part 228.
4582. gbpat229.seq - Patent sequence entries, part 229.
4583. gbpat23.seq - Patent sequence entries, part 23.
4584. gbpat230.seq - Patent sequence entries, part 230.
4585. gbpat231.seq - Patent sequence entries, part 231.
4586. gbpat232.seq - Patent sequence entries, part 232.
4587. gbpat233.seq - Patent sequence entries, part 233.
4588. gbpat234.seq - Patent sequence entries, part 234.
4589. gbpat235.seq - Patent sequence entries, part 235.
4590. gbpat236.seq - Patent sequence entries, part 236.
4591. gbpat237.seq - Patent sequence entries, part 237.
4592. gbpat238.seq - Patent sequence entries, part 238.
4593. gbpat239.seq - Patent sequence entries, part 239.
4594. gbpat24.seq - Patent sequence entries, part 24.
4595. gbpat240.seq - Patent sequence entries, part 240.
4596. gbpat241.seq - Patent sequence entries, part 241.
4597. gbpat242.seq - Patent sequence entries, part 242.
4598. gbpat243.seq - Patent sequence entries, part 243.
4599. gbpat244.seq - Patent sequence entries, part 244.
4600. gbpat245.seq - Patent sequence entries, part 245.
4601. gbpat246.seq - Patent sequence entries, part 246.
4602. gbpat247.seq - Patent sequence entries, part 247.
4603. gbpat248.seq - Patent sequence entries, part 248.
4604. gbpat249.seq - Patent sequence entries, part 249.
4605. gbpat25.seq - Patent sequence entries, part 25.
4606. gbpat250.seq - Patent sequence entries, part 250.
4607. gbpat251.seq - Patent sequence entries, part 251.
4608. gbpat252.seq - Patent sequence entries, part 252.
4609. gbpat253.seq - Patent sequence entries, part 253.
4610. gbpat254.seq - Patent sequence entries, part 254.
4611. gbpat255.seq - Patent sequence entries, part 255.
4612. gbpat256.seq - Patent sequence entries, part 256.
4613. gbpat257.seq - Patent sequence entries, part 257.
4614. gbpat258.seq - Patent sequence entries, part 258.
4615. gbpat259.seq - Patent sequence entries, part 259.
4616. gbpat26.seq - Patent sequence entries, part 26.
4617. gbpat260.seq - Patent sequence entries, part 260.
4618. gbpat261.seq - Patent sequence entries, part 261.
4619. gbpat27.seq - Patent sequence entries, part 27.
4620. gbpat28.seq - Patent sequence entries, part 28.
4621. gbpat29.seq - Patent sequence entries, part 29.
4622. gbpat3.seq - Patent sequence entries, part 3.
4623. gbpat30.seq - Patent sequence entries, part 30.
4624. gbpat31.seq - Patent sequence entries, part 31.
4625. gbpat32.seq - Patent sequence entries, part 32.
4626. gbpat33.seq - Patent sequence entries, part 33.
4627. gbpat34.seq - Patent sequence entries, part 34.
4628. gbpat35.seq - Patent sequence entries, part 35.
4629. gbpat36.seq - Patent sequence entries, part 36.
4630. gbpat37.seq - Patent sequence entries, part 37.
4631. gbpat38.seq - Patent sequence entries, part 38.
4632. gbpat39.seq - Patent sequence entries, part 39.
4633. gbpat4.seq - Patent sequence entries, part 4.
4634. gbpat40.seq - Patent sequence entries, part 40.
4635. gbpat41.seq - Patent sequence entries, part 41.
4636. gbpat42.seq - Patent sequence entries, part 42.
4637. gbpat43.seq - Patent sequence entries, part 43.
4638. gbpat44.seq - Patent sequence entries, part 44.
4639. gbpat45.seq - Patent sequence entries, part 45.
4640. gbpat46.seq - Patent sequence entries, part 46.
4641. gbpat47.seq - Patent sequence entries, part 47.
4642. gbpat48.seq - Patent sequence entries, part 48.
4643. gbpat49.seq - Patent sequence entries, part 49.
4644. gbpat5.seq - Patent sequence entries, part 5.
4645. gbpat50.seq - Patent sequence entries, part 50.
4646. gbpat51.seq - Patent sequence entries, part 51.
4647. gbpat52.seq - Patent sequence entries, part 52.
4648. gbpat53.seq - Patent sequence entries, part 53.
4649. gbpat54.seq - Patent sequence entries, part 54.
4650. gbpat55.seq - Patent sequence entries, part 55.
4651. gbpat56.seq - Patent sequence entries, part 56.
4652. gbpat57.seq - Patent sequence entries, part 57.
4653. gbpat58.seq - Patent sequence entries, part 58.
4654. gbpat59.seq - Patent sequence entries, part 59.
4655. gbpat6.seq - Patent sequence entries, part 6.
4656. gbpat60.seq - Patent sequence entries, part 60.
4657. gbpat61.seq - Patent sequence entries, part 61.
4658. gbpat62.seq - Patent sequence entries, part 62.
4659. gbpat63.seq - Patent sequence entries, part 63.
4660. gbpat64.seq - Patent sequence entries, part 64.
4661. gbpat65.seq - Patent sequence entries, part 65.
4662. gbpat66.seq - Patent sequence entries, part 66.
4663. gbpat67.seq - Patent sequence entries, part 67.
4664. gbpat68.seq - Patent sequence entries, part 68.
4665. gbpat69.seq - Patent sequence entries, part 69.
4666. gbpat7.seq - Patent sequence entries, part 7.
4667. gbpat70.seq - Patent sequence entries, part 70.
4668. gbpat71.seq - Patent sequence entries, part 71.
4669. gbpat72.seq - Patent sequence entries, part 72.
4670. gbpat73.seq - Patent sequence entries, part 73.
4671. gbpat74.seq - Patent sequence entries, part 74.
4672. gbpat75.seq - Patent sequence entries, part 75.
4673. gbpat76.seq - Patent sequence entries, part 76.
4674. gbpat77.seq - Patent sequence entries, part 77.
4675. gbpat78.seq - Patent sequence entries, part 78.
4676. gbpat79.seq - Patent sequence entries, part 79.
4677. gbpat8.seq - Patent sequence entries, part 8.
4678. gbpat80.seq - Patent sequence entries, part 80.
4679. gbpat81.seq - Patent sequence entries, part 81.
4680. gbpat82.seq - Patent sequence entries, part 82.
4681. gbpat83.seq - Patent sequence entries, part 83.
4682. gbpat84.seq - Patent sequence entries, part 84.
4683. gbpat85.seq - Patent sequence entries, part 85.
4684. gbpat86.seq - Patent sequence entries, part 86.
4685. gbpat87.seq - Patent sequence entries, part 87.
4686. gbpat88.seq - Patent sequence entries, part 88.
4687. gbpat89.seq - Patent sequence entries, part 89.
4688. gbpat9.seq - Patent sequence entries, part 9.
4689. gbpat90.seq - Patent sequence entries, part 90.
4690. gbpat91.seq - Patent sequence entries, part 91.
4691. gbpat92.seq - Patent sequence entries, part 92.
4692. gbpat93.seq - Patent sequence entries, part 93.
4693. gbpat94.seq - Patent sequence entries, part 94.
4694. gbpat95.seq - Patent sequence entries, part 95.
4695. gbpat96.seq - Patent sequence entries, part 96.
4696. gbpat97.seq - Patent sequence entries, part 97.
4697. gbpat98.seq - Patent sequence entries, part 98.
4698. gbpat99.seq - Patent sequence entries, part 99.
4699. gbphg1.seq - Phage sequence entries, part 1.
4700. gbphg2.seq - Phage sequence entries, part 2.
4701. gbphg3.seq - Phage sequence entries, part 3.
4702. gbphg4.seq - Phage sequence entries, part 4.
4703. gbphg5.seq - Phage sequence entries, part 5.
4704. gbphg6.seq - Phage sequence entries, part 6.
4705. gbphg7.seq - Phage sequence entries, part 7.
4706. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
4707. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
4708. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
4709. gbpln1000.seq - Plant sequence entries (including fungi and algae), part 1000.
4710. gbpln1001.seq - Plant sequence entries (including fungi and algae), part 1001.
4711. gbpln1002.seq - Plant sequence entries (including fungi and algae), part 1002.
4712. gbpln1003.seq - Plant sequence entries (including fungi and algae), part 1003.
4713. gbpln1004.seq - Plant sequence entries (including fungi and algae), part 1004.
4714. gbpln1005.seq - Plant sequence entries (including fungi and algae), part 1005.
4715. gbpln1006.seq - Plant sequence entries (including fungi and algae), part 1006.
4716. gbpln1007.seq - Plant sequence entries (including fungi and algae), part 1007.
4717. gbpln1008.seq - Plant sequence entries (including fungi and algae), part 1008.
4718. gbpln1009.seq - Plant sequence entries (including fungi and algae), part 1009.
4719. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
4720. gbpln1010.seq - Plant sequence entries (including fungi and algae), part 1010.
4721. gbpln1011.seq - Plant sequence entries (including fungi and algae), part 1011.
4722. gbpln1012.seq - Plant sequence entries (including fungi and algae), part 1012.
4723. gbpln1013.seq - Plant sequence entries (including fungi and algae), part 1013.
4724. gbpln1014.seq - Plant sequence entries (including fungi and algae), part 1014.
4725. gbpln1015.seq - Plant sequence entries (including fungi and algae), part 1015.
4726. gbpln1016.seq - Plant sequence entries (including fungi and algae), part 1016.
4727. gbpln1017.seq - Plant sequence entries (including fungi and algae), part 1017.
4728. gbpln1018.seq - Plant sequence entries (including fungi and algae), part 1018.
4729. gbpln1019.seq - Plant sequence entries (including fungi and algae), part 1019.
4730. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
4731. gbpln1020.seq - Plant sequence entries (including fungi and algae), part 1020.
4732. gbpln1021.seq - Plant sequence entries (including fungi and algae), part 1021.
4733. gbpln1022.seq - Plant sequence entries (including fungi and algae), part 1022.
4734. gbpln1023.seq - Plant sequence entries (including fungi and algae), part 1023.
4735. gbpln1024.seq - Plant sequence entries (including fungi and algae), part 1024.
4736. gbpln1025.seq - Plant sequence entries (including fungi and algae), part 1025.
4737. gbpln1026.seq - Plant sequence entries (including fungi and algae), part 1026.
4738. gbpln1027.seq - Plant sequence entries (including fungi and algae), part 1027.
4739. gbpln1028.seq - Plant sequence entries (including fungi and algae), part 1028.
4740. gbpln1029.seq - Plant sequence entries (including fungi and algae), part 1029.
4741. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
4742. gbpln1030.seq - Plant sequence entries (including fungi and algae), part 1030.
4743. gbpln1031.seq - Plant sequence entries (including fungi and algae), part 1031.
4744. gbpln1032.seq - Plant sequence entries (including fungi and algae), part 1032.
4745. gbpln1033.seq - Plant sequence entries (including fungi and algae), part 1033.
4746. gbpln1034.seq - Plant sequence entries (including fungi and algae), part 1034.
4747. gbpln1035.seq - Plant sequence entries (including fungi and algae), part 1035.
4748. gbpln1036.seq - Plant sequence entries (including fungi and algae), part 1036.
4749. gbpln1037.seq - Plant sequence entries (including fungi and algae), part 1037.
4750. gbpln1038.seq - Plant sequence entries (including fungi and algae), part 1038.
4751. gbpln1039.seq - Plant sequence entries (including fungi and algae), part 1039.
4752. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
4753. gbpln1040.seq - Plant sequence entries (including fungi and algae), part 1040.
4754. gbpln1041.seq - Plant sequence entries (including fungi and algae), part 1041.
4755. gbpln1042.seq - Plant sequence entries (including fungi and algae), part 1042.
4756. gbpln1043.seq - Plant sequence entries (including fungi and algae), part 1043.
4757. gbpln1044.seq - Plant sequence entries (including fungi and algae), part 1044.
4758. gbpln1045.seq - Plant sequence entries (including fungi and algae), part 1045.
4759. gbpln1046.seq - Plant sequence entries (including fungi and algae), part 1046.
4760. gbpln1047.seq - Plant sequence entries (including fungi and algae), part 1047.
4761. gbpln1048.seq - Plant sequence entries (including fungi and algae), part 1048.
4762. gbpln1049.seq - Plant sequence entries (including fungi and algae), part 1049.
4763. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
4764. gbpln1050.seq - Plant sequence entries (including fungi and algae), part 1050.
4765. gbpln1051.seq - Plant sequence entries (including fungi and algae), part 1051.
4766. gbpln1052.seq - Plant sequence entries (including fungi and algae), part 1052.
4767. gbpln1053.seq - Plant sequence entries (including fungi and algae), part 1053.
4768. gbpln1054.seq - Plant sequence entries (including fungi and algae), part 1054.
4769. gbpln1055.seq - Plant sequence entries (including fungi and algae), part 1055.
4770. gbpln1056.seq - Plant sequence entries (including fungi and algae), part 1056.
4771. gbpln1057.seq - Plant sequence entries (including fungi and algae), part 1057.
4772. gbpln1058.seq - Plant sequence entries (including fungi and algae), part 1058.
4773. gbpln1059.seq - Plant sequence entries (including fungi and algae), part 1059.
4774. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
4775. gbpln1060.seq - Plant sequence entries (including fungi and algae), part 1060.
4776. gbpln1061.seq - Plant sequence entries (including fungi and algae), part 1061.
4777. gbpln1062.seq - Plant sequence entries (including fungi and algae), part 1062.
4778. gbpln1063.seq - Plant sequence entries (including fungi and algae), part 1063.
4779. gbpln1064.seq - Plant sequence entries (including fungi and algae), part 1064.
4780. gbpln1065.seq - Plant sequence entries (including fungi and algae), part 1065.
4781. gbpln1066.seq - Plant sequence entries (including fungi and algae), part 1066.
4782. gbpln1067.seq - Plant sequence entries (including fungi and algae), part 1067.
4783. gbpln1068.seq - Plant sequence entries (including fungi and algae), part 1068.
4784. gbpln1069.seq - Plant sequence entries (including fungi and algae), part 1069.
4785. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
4786. gbpln1070.seq - Plant sequence entries (including fungi and algae), part 1070.
4787. gbpln1071.seq - Plant sequence entries (including fungi and algae), part 1071.
4788. gbpln1072.seq - Plant sequence entries (including fungi and algae), part 1072.
4789. gbpln1073.seq - Plant sequence entries (including fungi and algae), part 1073.
4790. gbpln1074.seq - Plant sequence entries (including fungi and algae), part 1074.
4791. gbpln1075.seq - Plant sequence entries (including fungi and algae), part 1075.
4792. gbpln1076.seq - Plant sequence entries (including fungi and algae), part 1076.
4793. gbpln1077.seq - Plant sequence entries (including fungi and algae), part 1077.
4794. gbpln1078.seq - Plant sequence entries (including fungi and algae), part 1078.
4795. gbpln1079.seq - Plant sequence entries (including fungi and algae), part 1079.
4796. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
4797. gbpln1080.seq - Plant sequence entries (including fungi and algae), part 1080.
4798. gbpln1081.seq - Plant sequence entries (including fungi and algae), part 1081.
4799. gbpln1082.seq - Plant sequence entries (including fungi and algae), part 1082.
4800. gbpln1083.seq - Plant sequence entries (including fungi and algae), part 1083.
4801. gbpln1084.seq - Plant sequence entries (including fungi and algae), part 1084.
4802. gbpln1085.seq - Plant sequence entries (including fungi and algae), part 1085.
4803. gbpln1086.seq - Plant sequence entries (including fungi and algae), part 1086.
4804. gbpln1087.seq - Plant sequence entries (including fungi and algae), part 1087.
4805. gbpln1088.seq - Plant sequence entries (including fungi and algae), part 1088.
4806. gbpln1089.seq - Plant sequence entries (including fungi and algae), part 1089.
4807. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
4808. gbpln1090.seq - Plant sequence entries (including fungi and algae), part 1090.
4809. gbpln1091.seq - Plant sequence entries (including fungi and algae), part 1091.
4810. gbpln1092.seq - Plant sequence entries (including fungi and algae), part 1092.
4811. gbpln1093.seq - Plant sequence entries (including fungi and algae), part 1093.
4812. gbpln1094.seq - Plant sequence entries (including fungi and algae), part 1094.
4813. gbpln1095.seq - Plant sequence entries (including fungi and algae), part 1095.
4814. gbpln1096.seq - Plant sequence entries (including fungi and algae), part 1096.
4815. gbpln1097.seq - Plant sequence entries (including fungi and algae), part 1097.
4816. gbpln1098.seq - Plant sequence entries (including fungi and algae), part 1098.
4817. gbpln1099.seq - Plant sequence entries (including fungi and algae), part 1099.
4818. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
4819. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
4820. gbpln1100.seq - Plant sequence entries (including fungi and algae), part 1100.
4821. gbpln1101.seq - Plant sequence entries (including fungi and algae), part 1101.
4822. gbpln1102.seq - Plant sequence entries (including fungi and algae), part 1102.
4823. gbpln1103.seq - Plant sequence entries (including fungi and algae), part 1103.
4824. gbpln1104.seq - Plant sequence entries (including fungi and algae), part 1104.
4825. gbpln1105.seq - Plant sequence entries (including fungi and algae), part 1105.
4826. gbpln1106.seq - Plant sequence entries (including fungi and algae), part 1106.
4827. gbpln1107.seq - Plant sequence entries (including fungi and algae), part 1107.
4828. gbpln1108.seq - Plant sequence entries (including fungi and algae), part 1108.
4829. gbpln1109.seq - Plant sequence entries (including fungi and algae), part 1109.
4830. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
4831. gbpln1110.seq - Plant sequence entries (including fungi and algae), part 1110.
4832. gbpln1111.seq - Plant sequence entries (including fungi and algae), part 1111.
4833. gbpln1112.seq - Plant sequence entries (including fungi and algae), part 1112.
4834. gbpln1113.seq - Plant sequence entries (including fungi and algae), part 1113.
4835. gbpln1114.seq - Plant sequence entries (including fungi and algae), part 1114.
4836. gbpln1115.seq - Plant sequence entries (including fungi and algae), part 1115.
4837. gbpln1116.seq - Plant sequence entries (including fungi and algae), part 1116.
4838. gbpln1117.seq - Plant sequence entries (including fungi and algae), part 1117.
4839. gbpln1118.seq - Plant sequence entries (including fungi and algae), part 1118.
4840. gbpln1119.seq - Plant sequence entries (including fungi and algae), part 1119.
4841. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
4842. gbpln1120.seq - Plant sequence entries (including fungi and algae), part 1120.
4843. gbpln1121.seq - Plant sequence entries (including fungi and algae), part 1121.
4844. gbpln1122.seq - Plant sequence entries (including fungi and algae), part 1122.
4845. gbpln1123.seq - Plant sequence entries (including fungi and algae), part 1123.
4846. gbpln1124.seq - Plant sequence entries (including fungi and algae), part 1124.
4847. gbpln1125.seq - Plant sequence entries (including fungi and algae), part 1125.
4848. gbpln1126.seq - Plant sequence entries (including fungi and algae), part 1126.
4849. gbpln1127.seq - Plant sequence entries (including fungi and algae), part 1127.
4850. gbpln1128.seq - Plant sequence entries (including fungi and algae), part 1128.
4851. gbpln1129.seq - Plant sequence entries (including fungi and algae), part 1129.
4852. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
4853. gbpln1130.seq - Plant sequence entries (including fungi and algae), part 1130.
4854. gbpln1131.seq - Plant sequence entries (including fungi and algae), part 1131.
4855. gbpln1132.seq - Plant sequence entries (including fungi and algae), part 1132.
4856. gbpln1133.seq - Plant sequence entries (including fungi and algae), part 1133.
4857. gbpln1134.seq - Plant sequence entries (including fungi and algae), part 1134.
4858. gbpln1135.seq - Plant sequence entries (including fungi and algae), part 1135.
4859. gbpln1136.seq - Plant sequence entries (including fungi and algae), part 1136.
4860. gbpln1137.seq - Plant sequence entries (including fungi and algae), part 1137.
4861. gbpln1138.seq - Plant sequence entries (including fungi and algae), part 1138.
4862. gbpln1139.seq - Plant sequence entries (including fungi and algae), part 1139.
4863. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
4864. gbpln1140.seq - Plant sequence entries (including fungi and algae), part 1140.
4865. gbpln1141.seq - Plant sequence entries (including fungi and algae), part 1141.
4866. gbpln1142.seq - Plant sequence entries (including fungi and algae), part 1142.
4867. gbpln1143.seq - Plant sequence entries (including fungi and algae), part 1143.
4868. gbpln1144.seq - Plant sequence entries (including fungi and algae), part 1144.
4869. gbpln1145.seq - Plant sequence entries (including fungi and algae), part 1145.
4870. gbpln1146.seq - Plant sequence entries (including fungi and algae), part 1146.
4871. gbpln1147.seq - Plant sequence entries (including fungi and algae), part 1147.
4872. gbpln1148.seq - Plant sequence entries (including fungi and algae), part 1148.
4873. gbpln1149.seq - Plant sequence entries (including fungi and algae), part 1149.
4874. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
4875. gbpln1150.seq - Plant sequence entries (including fungi and algae), part 1150.
4876. gbpln1151.seq - Plant sequence entries (including fungi and algae), part 1151.
4877. gbpln1152.seq - Plant sequence entries (including fungi and algae), part 1152.
4878. gbpln1153.seq - Plant sequence entries (including fungi and algae), part 1153.
4879. gbpln1154.seq - Plant sequence entries (including fungi and algae), part 1154.
4880. gbpln1155.seq - Plant sequence entries (including fungi and algae), part 1155.
4881. gbpln1156.seq - Plant sequence entries (including fungi and algae), part 1156.
4882. gbpln1157.seq - Plant sequence entries (including fungi and algae), part 1157.
4883. gbpln1158.seq - Plant sequence entries (including fungi and algae), part 1158.
4884. gbpln1159.seq - Plant sequence entries (including fungi and algae), part 1159.
4885. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
4886. gbpln1160.seq - Plant sequence entries (including fungi and algae), part 1160.
4887. gbpln1161.seq - Plant sequence entries (including fungi and algae), part 1161.
4888. gbpln1162.seq - Plant sequence entries (including fungi and algae), part 1162.
4889. gbpln1163.seq - Plant sequence entries (including fungi and algae), part 1163.
4890. gbpln1164.seq - Plant sequence entries (including fungi and algae), part 1164.
4891. gbpln1165.seq - Plant sequence entries (including fungi and algae), part 1165.
4892. gbpln1166.seq - Plant sequence entries (including fungi and algae), part 1166.
4893. gbpln1167.seq - Plant sequence entries (including fungi and algae), part 1167.
4894. gbpln1168.seq - Plant sequence entries (including fungi and algae), part 1168.
4895. gbpln1169.seq - Plant sequence entries (including fungi and algae), part 1169.
4896. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
4897. gbpln1170.seq - Plant sequence entries (including fungi and algae), part 1170.
4898. gbpln1171.seq - Plant sequence entries (including fungi and algae), part 1171.
4899. gbpln1172.seq - Plant sequence entries (including fungi and algae), part 1172.
4900. gbpln1173.seq - Plant sequence entries (including fungi and algae), part 1173.
4901. gbpln1174.seq - Plant sequence entries (including fungi and algae), part 1174.
4902. gbpln1175.seq - Plant sequence entries (including fungi and algae), part 1175.
4903. gbpln1176.seq - Plant sequence entries (including fungi and algae), part 1176.
4904. gbpln1177.seq - Plant sequence entries (including fungi and algae), part 1177.
4905. gbpln1178.seq - Plant sequence entries (including fungi and algae), part 1178.
4906. gbpln1179.seq - Plant sequence entries (including fungi and algae), part 1179.
4907. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
4908. gbpln1180.seq - Plant sequence entries (including fungi and algae), part 1180.
4909. gbpln1181.seq - Plant sequence entries (including fungi and algae), part 1181.
4910. gbpln1182.seq - Plant sequence entries (including fungi and algae), part 1182.
4911. gbpln1183.seq - Plant sequence entries (including fungi and algae), part 1183.
4912. gbpln1184.seq - Plant sequence entries (including fungi and algae), part 1184.
4913. gbpln1185.seq - Plant sequence entries (including fungi and algae), part 1185.
4914. gbpln1186.seq - Plant sequence entries (including fungi and algae), part 1186.
4915. gbpln1187.seq - Plant sequence entries (including fungi and algae), part 1187.
4916. gbpln1188.seq - Plant sequence entries (including fungi and algae), part 1188.
4917. gbpln1189.seq - Plant sequence entries (including fungi and algae), part 1189.
4918. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
4919. gbpln1190.seq - Plant sequence entries (including fungi and algae), part 1190.
4920. gbpln1191.seq - Plant sequence entries (including fungi and algae), part 1191.
4921. gbpln1192.seq - Plant sequence entries (including fungi and algae), part 1192.
4922. gbpln1193.seq - Plant sequence entries (including fungi and algae), part 1193.
4923. gbpln1194.seq - Plant sequence entries (including fungi and algae), part 1194.
4924. gbpln1195.seq - Plant sequence entries (including fungi and algae), part 1195.
4925. gbpln1196.seq - Plant sequence entries (including fungi and algae), part 1196.
4926. gbpln1197.seq - Plant sequence entries (including fungi and algae), part 1197.
4927. gbpln1198.seq - Plant sequence entries (including fungi and algae), part 1198.
4928. gbpln1199.seq - Plant sequence entries (including fungi and algae), part 1199.
4929. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
4930. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
4931. gbpln1200.seq - Plant sequence entries (including fungi and algae), part 1200.
4932. gbpln1201.seq - Plant sequence entries (including fungi and algae), part 1201.
4933. gbpln1202.seq - Plant sequence entries (including fungi and algae), part 1202.
4934. gbpln1203.seq - Plant sequence entries (including fungi and algae), part 1203.
4935. gbpln1204.seq - Plant sequence entries (including fungi and algae), part 1204.
4936. gbpln1205.seq - Plant sequence entries (including fungi and algae), part 1205.
4937. gbpln1206.seq - Plant sequence entries (including fungi and algae), part 1206.
4938. gbpln1207.seq - Plant sequence entries (including fungi and algae), part 1207.
4939. gbpln1208.seq - Plant sequence entries (including fungi and algae), part 1208.
4940. gbpln1209.seq - Plant sequence entries (including fungi and algae), part 1209.
4941. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
4942. gbpln1210.seq - Plant sequence entries (including fungi and algae), part 1210.
4943. gbpln1211.seq - Plant sequence entries (including fungi and algae), part 1211.
4944. gbpln1212.seq - Plant sequence entries (including fungi and algae), part 1212.
4945. gbpln1213.seq - Plant sequence entries (including fungi and algae), part 1213.
4946. gbpln1214.seq - Plant sequence entries (including fungi and algae), part 1214.
4947. gbpln1215.seq - Plant sequence entries (including fungi and algae), part 1215.
4948. gbpln1216.seq - Plant sequence entries (including fungi and algae), part 1216.
4949. gbpln1217.seq - Plant sequence entries (including fungi and algae), part 1217.
4950. gbpln1218.seq - Plant sequence entries (including fungi and algae), part 1218.
4951. gbpln1219.seq - Plant sequence entries (including fungi and algae), part 1219.
4952. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
4953. gbpln1220.seq - Plant sequence entries (including fungi and algae), part 1220.
4954. gbpln1221.seq - Plant sequence entries (including fungi and algae), part 1221.
4955. gbpln1222.seq - Plant sequence entries (including fungi and algae), part 1222.
4956. gbpln1223.seq - Plant sequence entries (including fungi and algae), part 1223.
4957. gbpln1224.seq - Plant sequence entries (including fungi and algae), part 1224.
4958. gbpln1225.seq - Plant sequence entries (including fungi and algae), part 1225.
4959. gbpln1226.seq - Plant sequence entries (including fungi and algae), part 1226.
4960. gbpln1227.seq - Plant sequence entries (including fungi and algae), part 1227.
4961. gbpln1228.seq - Plant sequence entries (including fungi and algae), part 1228.
4962. gbpln1229.seq - Plant sequence entries (including fungi and algae), part 1229.
4963. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
4964. gbpln1230.seq - Plant sequence entries (including fungi and algae), part 1230.
4965. gbpln1231.seq - Plant sequence entries (including fungi and algae), part 1231.
4966. gbpln1232.seq - Plant sequence entries (including fungi and algae), part 1232.
4967. gbpln1233.seq - Plant sequence entries (including fungi and algae), part 1233.
4968. gbpln1234.seq - Plant sequence entries (including fungi and algae), part 1234.
4969. gbpln1235.seq - Plant sequence entries (including fungi and algae), part 1235.
4970. gbpln1236.seq - Plant sequence entries (including fungi and algae), part 1236.
4971. gbpln1237.seq - Plant sequence entries (including fungi and algae), part 1237.
4972. gbpln1238.seq - Plant sequence entries (including fungi and algae), part 1238.
4973. gbpln1239.seq - Plant sequence entries (including fungi and algae), part 1239.
4974. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
4975. gbpln1240.seq - Plant sequence entries (including fungi and algae), part 1240.
4976. gbpln1241.seq - Plant sequence entries (including fungi and algae), part 1241.
4977. gbpln1242.seq - Plant sequence entries (including fungi and algae), part 1242.
4978. gbpln1243.seq - Plant sequence entries (including fungi and algae), part 1243.
4979. gbpln1244.seq - Plant sequence entries (including fungi and algae), part 1244.
4980. gbpln1245.seq - Plant sequence entries (including fungi and algae), part 1245.
4981. gbpln1246.seq - Plant sequence entries (including fungi and algae), part 1246.
4982. gbpln1247.seq - Plant sequence entries (including fungi and algae), part 1247.
4983. gbpln1248.seq - Plant sequence entries (including fungi and algae), part 1248.
4984. gbpln1249.seq - Plant sequence entries (including fungi and algae), part 1249.
4985. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
4986. gbpln1250.seq - Plant sequence entries (including fungi and algae), part 1250.
4987. gbpln1251.seq - Plant sequence entries (including fungi and algae), part 1251.
4988. gbpln1252.seq - Plant sequence entries (including fungi and algae), part 1252.
4989. gbpln1253.seq - Plant sequence entries (including fungi and algae), part 1253.
4990. gbpln1254.seq - Plant sequence entries (including fungi and algae), part 1254.
4991. gbpln1255.seq - Plant sequence entries (including fungi and algae), part 1255.
4992. gbpln1256.seq - Plant sequence entries (including fungi and algae), part 1256.
4993. gbpln1257.seq - Plant sequence entries (including fungi and algae), part 1257.
4994. gbpln1258.seq - Plant sequence entries (including fungi and algae), part 1258.
4995. gbpln1259.seq - Plant sequence entries (including fungi and algae), part 1259.
4996. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
4997. gbpln1260.seq - Plant sequence entries (including fungi and algae), part 1260.
4998. gbpln1261.seq - Plant sequence entries (including fungi and algae), part 1261.
4999. gbpln1262.seq - Plant sequence entries (including fungi and algae), part 1262.
5000. gbpln1263.seq - Plant sequence entries (including fungi and algae), part 1263.
5001. gbpln1264.seq - Plant sequence entries (including fungi and algae), part 1264.
5002. gbpln1265.seq - Plant sequence entries (including fungi and algae), part 1265.
5003. gbpln1266.seq - Plant sequence entries (including fungi and algae), part 1266.
5004. gbpln1267.seq - Plant sequence entries (including fungi and algae), part 1267.
5005. gbpln1268.seq - Plant sequence entries (including fungi and algae), part 1268.
5006. gbpln1269.seq - Plant sequence entries (including fungi and algae), part 1269.
5007. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
5008. gbpln1270.seq - Plant sequence entries (including fungi and algae), part 1270.
5009. gbpln1271.seq - Plant sequence entries (including fungi and algae), part 1271.
5010. gbpln1272.seq - Plant sequence entries (including fungi and algae), part 1272.
5011. gbpln1273.seq - Plant sequence entries (including fungi and algae), part 1273.
5012. gbpln1274.seq - Plant sequence entries (including fungi and algae), part 1274.
5013. gbpln1275.seq - Plant sequence entries (including fungi and algae), part 1275.
5014. gbpln1276.seq - Plant sequence entries (including fungi and algae), part 1276.
5015. gbpln1277.seq - Plant sequence entries (including fungi and algae), part 1277.
5016. gbpln1278.seq - Plant sequence entries (including fungi and algae), part 1278.
5017. gbpln1279.seq - Plant sequence entries (including fungi and algae), part 1279.
5018. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
5019. gbpln1280.seq - Plant sequence entries (including fungi and algae), part 1280.
5020. gbpln1281.seq - Plant sequence entries (including fungi and algae), part 1281.
5021. gbpln1282.seq - Plant sequence entries (including fungi and algae), part 1282.
5022. gbpln1283.seq - Plant sequence entries (including fungi and algae), part 1283.
5023. gbpln1284.seq - Plant sequence entries (including fungi and algae), part 1284.
5024. gbpln1285.seq - Plant sequence entries (including fungi and algae), part 1285.
5025. gbpln1286.seq - Plant sequence entries (including fungi and algae), part 1286.
5026. gbpln1287.seq - Plant sequence entries (including fungi and algae), part 1287.
5027. gbpln1288.seq - Plant sequence entries (including fungi and algae), part 1288.
5028. gbpln1289.seq - Plant sequence entries (including fungi and algae), part 1289.
5029. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
5030. gbpln1290.seq - Plant sequence entries (including fungi and algae), part 1290.
5031. gbpln1291.seq - Plant sequence entries (including fungi and algae), part 1291.
5032. gbpln1292.seq - Plant sequence entries (including fungi and algae), part 1292.
5033. gbpln1293.seq - Plant sequence entries (including fungi and algae), part 1293.
5034. gbpln1294.seq - Plant sequence entries (including fungi and algae), part 1294.
5035. gbpln1295.seq - Plant sequence entries (including fungi and algae), part 1295.
5036. gbpln1296.seq - Plant sequence entries (including fungi and algae), part 1296.
5037. gbpln1297.seq - Plant sequence entries (including fungi and algae), part 1297.
5038. gbpln1298.seq - Plant sequence entries (including fungi and algae), part 1298.
5039. gbpln1299.seq - Plant sequence entries (including fungi and algae), part 1299.
5040. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
5041. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
5042. gbpln1300.seq - Plant sequence entries (including fungi and algae), part 1300.
5043. gbpln1301.seq - Plant sequence entries (including fungi and algae), part 1301.
5044. gbpln1302.seq - Plant sequence entries (including fungi and algae), part 1302.
5045. gbpln1303.seq - Plant sequence entries (including fungi and algae), part 1303.
5046. gbpln1304.seq - Plant sequence entries (including fungi and algae), part 1304.
5047. gbpln1305.seq - Plant sequence entries (including fungi and algae), part 1305.
5048. gbpln1306.seq - Plant sequence entries (including fungi and algae), part 1306.
5049. gbpln1307.seq - Plant sequence entries (including fungi and algae), part 1307.
5050. gbpln1308.seq - Plant sequence entries (including fungi and algae), part 1308.
5051. gbpln1309.seq - Plant sequence entries (including fungi and algae), part 1309.
5052. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
5053. gbpln1310.seq - Plant sequence entries (including fungi and algae), part 1310.
5054. gbpln1311.seq - Plant sequence entries (including fungi and algae), part 1311.
5055. gbpln1312.seq - Plant sequence entries (including fungi and algae), part 1312.
5056. gbpln1313.seq - Plant sequence entries (including fungi and algae), part 1313.
5057. gbpln1314.seq - Plant sequence entries (including fungi and algae), part 1314.
5058. gbpln1315.seq - Plant sequence entries (including fungi and algae), part 1315.
5059. gbpln1316.seq - Plant sequence entries (including fungi and algae), part 1316.
5060. gbpln1317.seq - Plant sequence entries (including fungi and algae), part 1317.
5061. gbpln1318.seq - Plant sequence entries (including fungi and algae), part 1318.
5062. gbpln1319.seq - Plant sequence entries (including fungi and algae), part 1319.
5063. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
5064. gbpln1320.seq - Plant sequence entries (including fungi and algae), part 1320.
5065. gbpln1321.seq - Plant sequence entries (including fungi and algae), part 1321.
5066. gbpln1322.seq - Plant sequence entries (including fungi and algae), part 1322.
5067. gbpln1323.seq - Plant sequence entries (including fungi and algae), part 1323.
5068. gbpln1324.seq - Plant sequence entries (including fungi and algae), part 1324.
5069. gbpln1325.seq - Plant sequence entries (including fungi and algae), part 1325.
5070. gbpln1326.seq - Plant sequence entries (including fungi and algae), part 1326.
5071. gbpln1327.seq - Plant sequence entries (including fungi and algae), part 1327.
5072. gbpln1328.seq - Plant sequence entries (including fungi and algae), part 1328.
5073. gbpln1329.seq - Plant sequence entries (including fungi and algae), part 1329.
5074. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
5075. gbpln1330.seq - Plant sequence entries (including fungi and algae), part 1330.
5076. gbpln1331.seq - Plant sequence entries (including fungi and algae), part 1331.
5077. gbpln1332.seq - Plant sequence entries (including fungi and algae), part 1332.
5078. gbpln1333.seq - Plant sequence entries (including fungi and algae), part 1333.
5079. gbpln1334.seq - Plant sequence entries (including fungi and algae), part 1334.
5080. gbpln1335.seq - Plant sequence entries (including fungi and algae), part 1335.
5081. gbpln1336.seq - Plant sequence entries (including fungi and algae), part 1336.
5082. gbpln1337.seq - Plant sequence entries (including fungi and algae), part 1337.
5083. gbpln1338.seq - Plant sequence entries (including fungi and algae), part 1338.
5084. gbpln1339.seq - Plant sequence entries (including fungi and algae), part 1339.
5085. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
5086. gbpln1340.seq - Plant sequence entries (including fungi and algae), part 1340.
5087. gbpln1341.seq - Plant sequence entries (including fungi and algae), part 1341.
5088. gbpln1342.seq - Plant sequence entries (including fungi and algae), part 1342.
5089. gbpln1343.seq - Plant sequence entries (including fungi and algae), part 1343.
5090. gbpln1344.seq - Plant sequence entries (including fungi and algae), part 1344.
5091. gbpln1345.seq - Plant sequence entries (including fungi and algae), part 1345.
5092. gbpln1346.seq - Plant sequence entries (including fungi and algae), part 1346.
5093. gbpln1347.seq - Plant sequence entries (including fungi and algae), part 1347.
5094. gbpln1348.seq - Plant sequence entries (including fungi and algae), part 1348.
5095. gbpln1349.seq - Plant sequence entries (including fungi and algae), part 1349.
5096. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
5097. gbpln1350.seq - Plant sequence entries (including fungi and algae), part 1350.
5098. gbpln1351.seq - Plant sequence entries (including fungi and algae), part 1351.
5099. gbpln1352.seq - Plant sequence entries (including fungi and algae), part 1352.
5100. gbpln1353.seq - Plant sequence entries (including fungi and algae), part 1353.
5101. gbpln1354.seq - Plant sequence entries (including fungi and algae), part 1354.
5102. gbpln1355.seq - Plant sequence entries (including fungi and algae), part 1355.
5103. gbpln1356.seq - Plant sequence entries (including fungi and algae), part 1356.
5104. gbpln1357.seq - Plant sequence entries (including fungi and algae), part 1357.
5105. gbpln1358.seq - Plant sequence entries (including fungi and algae), part 1358.
5106. gbpln1359.seq - Plant sequence entries (including fungi and algae), part 1359.
5107. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
5108. gbpln1360.seq - Plant sequence entries (including fungi and algae), part 1360.
5109. gbpln1361.seq - Plant sequence entries (including fungi and algae), part 1361.
5110. gbpln1362.seq - Plant sequence entries (including fungi and algae), part 1362.
5111. gbpln1363.seq - Plant sequence entries (including fungi and algae), part 1363.
5112. gbpln1364.seq - Plant sequence entries (including fungi and algae), part 1364.
5113. gbpln1365.seq - Plant sequence entries (including fungi and algae), part 1365.
5114. gbpln1366.seq - Plant sequence entries (including fungi and algae), part 1366.
5115. gbpln1367.seq - Plant sequence entries (including fungi and algae), part 1367.
5116. gbpln1368.seq - Plant sequence entries (including fungi and algae), part 1368.
5117. gbpln1369.seq - Plant sequence entries (including fungi and algae), part 1369.
5118. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
5119. gbpln1370.seq - Plant sequence entries (including fungi and algae), part 1370.
5120. gbpln1371.seq - Plant sequence entries (including fungi and algae), part 1371.
5121. gbpln1372.seq - Plant sequence entries (including fungi and algae), part 1372.
5122. gbpln1373.seq - Plant sequence entries (including fungi and algae), part 1373.
5123. gbpln1374.seq - Plant sequence entries (including fungi and algae), part 1374.
5124. gbpln1375.seq - Plant sequence entries (including fungi and algae), part 1375.
5125. gbpln1376.seq - Plant sequence entries (including fungi and algae), part 1376.
5126. gbpln1377.seq - Plant sequence entries (including fungi and algae), part 1377.
5127. gbpln1378.seq - Plant sequence entries (including fungi and algae), part 1378.
5128. gbpln1379.seq - Plant sequence entries (including fungi and algae), part 1379.
5129. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
5130. gbpln1380.seq - Plant sequence entries (including fungi and algae), part 1380.
5131. gbpln1381.seq - Plant sequence entries (including fungi and algae), part 1381.
5132. gbpln1382.seq - Plant sequence entries (including fungi and algae), part 1382.
5133. gbpln1383.seq - Plant sequence entries (including fungi and algae), part 1383.
5134. gbpln1384.seq - Plant sequence entries (including fungi and algae), part 1384.
5135. gbpln1385.seq - Plant sequence entries (including fungi and algae), part 1385.
5136. gbpln1386.seq - Plant sequence entries (including fungi and algae), part 1386.
5137. gbpln1387.seq - Plant sequence entries (including fungi and algae), part 1387.
5138. gbpln1388.seq - Plant sequence entries (including fungi and algae), part 1388.
5139. gbpln1389.seq - Plant sequence entries (including fungi and algae), part 1389.
5140. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
5141. gbpln1390.seq - Plant sequence entries (including fungi and algae), part 1390.
5142. gbpln1391.seq - Plant sequence entries (including fungi and algae), part 1391.
5143. gbpln1392.seq - Plant sequence entries (including fungi and algae), part 1392.
5144. gbpln1393.seq - Plant sequence entries (including fungi and algae), part 1393.
5145. gbpln1394.seq - Plant sequence entries (including fungi and algae), part 1394.
5146. gbpln1395.seq - Plant sequence entries (including fungi and algae), part 1395.
5147. gbpln1396.seq - Plant sequence entries (including fungi and algae), part 1396.
5148. gbpln1397.seq - Plant sequence entries (including fungi and algae), part 1397.
5149. gbpln1398.seq - Plant sequence entries (including fungi and algae), part 1398.
5150. gbpln1399.seq - Plant sequence entries (including fungi and algae), part 1399.
5151. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
5152. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
5153. gbpln1400.seq - Plant sequence entries (including fungi and algae), part 1400.
5154. gbpln1401.seq - Plant sequence entries (including fungi and algae), part 1401.
5155. gbpln1402.seq - Plant sequence entries (including fungi and algae), part 1402.
5156. gbpln1403.seq - Plant sequence entries (including fungi and algae), part 1403.
5157. gbpln1404.seq - Plant sequence entries (including fungi and algae), part 1404.
5158. gbpln1405.seq - Plant sequence entries (including fungi and algae), part 1405.
5159. gbpln1406.seq - Plant sequence entries (including fungi and algae), part 1406.
5160. gbpln1407.seq - Plant sequence entries (including fungi and algae), part 1407.
5161. gbpln1408.seq - Plant sequence entries (including fungi and algae), part 1408.
5162. gbpln1409.seq - Plant sequence entries (including fungi and algae), part 1409.
5163. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
5164. gbpln1410.seq - Plant sequence entries (including fungi and algae), part 1410.
5165. gbpln1411.seq - Plant sequence entries (including fungi and algae), part 1411.
5166. gbpln1412.seq - Plant sequence entries (including fungi and algae), part 1412.
5167. gbpln1413.seq - Plant sequence entries (including fungi and algae), part 1413.
5168. gbpln1414.seq - Plant sequence entries (including fungi and algae), part 1414.
5169. gbpln1415.seq - Plant sequence entries (including fungi and algae), part 1415.
5170. gbpln1416.seq - Plant sequence entries (including fungi and algae), part 1416.
5171. gbpln1417.seq - Plant sequence entries (including fungi and algae), part 1417.
5172. gbpln1418.seq - Plant sequence entries (including fungi and algae), part 1418.
5173. gbpln1419.seq - Plant sequence entries (including fungi and algae), part 1419.
5174. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
5175. gbpln1420.seq - Plant sequence entries (including fungi and algae), part 1420.
5176. gbpln1421.seq - Plant sequence entries (including fungi and algae), part 1421.
5177. gbpln1422.seq - Plant sequence entries (including fungi and algae), part 1422.
5178. gbpln1423.seq - Plant sequence entries (including fungi and algae), part 1423.
5179. gbpln1424.seq - Plant sequence entries (including fungi and algae), part 1424.
5180. gbpln1425.seq - Plant sequence entries (including fungi and algae), part 1425.
5181. gbpln1426.seq - Plant sequence entries (including fungi and algae), part 1426.
5182. gbpln1427.seq - Plant sequence entries (including fungi and algae), part 1427.
5183. gbpln1428.seq - Plant sequence entries (including fungi and algae), part 1428.
5184. gbpln1429.seq - Plant sequence entries (including fungi and algae), part 1429.
5185. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
5186. gbpln1430.seq - Plant sequence entries (including fungi and algae), part 1430.
5187. gbpln1431.seq - Plant sequence entries (including fungi and algae), part 1431.
5188. gbpln1432.seq - Plant sequence entries (including fungi and algae), part 1432.
5189. gbpln1433.seq - Plant sequence entries (including fungi and algae), part 1433.
5190. gbpln1434.seq - Plant sequence entries (including fungi and algae), part 1434.
5191. gbpln1435.seq - Plant sequence entries (including fungi and algae), part 1435.
5192. gbpln1436.seq - Plant sequence entries (including fungi and algae), part 1436.
5193. gbpln1437.seq - Plant sequence entries (including fungi and algae), part 1437.
5194. gbpln1438.seq - Plant sequence entries (including fungi and algae), part 1438.
5195. gbpln1439.seq - Plant sequence entries (including fungi and algae), part 1439.
5196. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
5197. gbpln1440.seq - Plant sequence entries (including fungi and algae), part 1440.
5198. gbpln1441.seq - Plant sequence entries (including fungi and algae), part 1441.
5199. gbpln1442.seq - Plant sequence entries (including fungi and algae), part 1442.
5200. gbpln1443.seq - Plant sequence entries (including fungi and algae), part 1443.
5201. gbpln1444.seq - Plant sequence entries (including fungi and algae), part 1444.
5202. gbpln1445.seq - Plant sequence entries (including fungi and algae), part 1445.
5203. gbpln1446.seq - Plant sequence entries (including fungi and algae), part 1446.
5204. gbpln1447.seq - Plant sequence entries (including fungi and algae), part 1447.
5205. gbpln1448.seq - Plant sequence entries (including fungi and algae), part 1448.
5206. gbpln1449.seq - Plant sequence entries (including fungi and algae), part 1449.
5207. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
5208. gbpln1450.seq - Plant sequence entries (including fungi and algae), part 1450.
5209. gbpln1451.seq - Plant sequence entries (including fungi and algae), part 1451.
5210. gbpln1452.seq - Plant sequence entries (including fungi and algae), part 1452.
5211. gbpln1453.seq - Plant sequence entries (including fungi and algae), part 1453.
5212. gbpln1454.seq - Plant sequence entries (including fungi and algae), part 1454.
5213. gbpln1455.seq - Plant sequence entries (including fungi and algae), part 1455.
5214. gbpln1456.seq - Plant sequence entries (including fungi and algae), part 1456.
5215. gbpln1457.seq - Plant sequence entries (including fungi and algae), part 1457.
5216. gbpln1458.seq - Plant sequence entries (including fungi and algae), part 1458.
5217. gbpln1459.seq - Plant sequence entries (including fungi and algae), part 1459.
5218. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
5219. gbpln1460.seq - Plant sequence entries (including fungi and algae), part 1460.
5220. gbpln1461.seq - Plant sequence entries (including fungi and algae), part 1461.
5221. gbpln1462.seq - Plant sequence entries (including fungi and algae), part 1462.
5222. gbpln1463.seq - Plant sequence entries (including fungi and algae), part 1463.
5223. gbpln1464.seq - Plant sequence entries (including fungi and algae), part 1464.
5224. gbpln1465.seq - Plant sequence entries (including fungi and algae), part 1465.
5225. gbpln1466.seq - Plant sequence entries (including fungi and algae), part 1466.
5226. gbpln1467.seq - Plant sequence entries (including fungi and algae), part 1467.
5227. gbpln1468.seq - Plant sequence entries (including fungi and algae), part 1468.
5228. gbpln1469.seq - Plant sequence entries (including fungi and algae), part 1469.
5229. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
5230. gbpln1470.seq - Plant sequence entries (including fungi and algae), part 1470.
5231. gbpln1471.seq - Plant sequence entries (including fungi and algae), part 1471.
5232. gbpln1472.seq - Plant sequence entries (including fungi and algae), part 1472.
5233. gbpln1473.seq - Plant sequence entries (including fungi and algae), part 1473.
5234. gbpln1474.seq - Plant sequence entries (including fungi and algae), part 1474.
5235. gbpln1475.seq - Plant sequence entries (including fungi and algae), part 1475.
5236. gbpln1476.seq - Plant sequence entries (including fungi and algae), part 1476.
5237. gbpln1477.seq - Plant sequence entries (including fungi and algae), part 1477.
5238. gbpln1478.seq - Plant sequence entries (including fungi and algae), part 1478.
5239. gbpln1479.seq - Plant sequence entries (including fungi and algae), part 1479.
5240. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
5241. gbpln1480.seq - Plant sequence entries (including fungi and algae), part 1480.
5242. gbpln1481.seq - Plant sequence entries (including fungi and algae), part 1481.
5243. gbpln1482.seq - Plant sequence entries (including fungi and algae), part 1482.
5244. gbpln1483.seq - Plant sequence entries (including fungi and algae), part 1483.
5245. gbpln1484.seq - Plant sequence entries (including fungi and algae), part 1484.
5246. gbpln1485.seq - Plant sequence entries (including fungi and algae), part 1485.
5247. gbpln1486.seq - Plant sequence entries (including fungi and algae), part 1486.
5248. gbpln1487.seq - Plant sequence entries (including fungi and algae), part 1487.
5249. gbpln1488.seq - Plant sequence entries (including fungi and algae), part 1488.
5250. gbpln1489.seq - Plant sequence entries (including fungi and algae), part 1489.
5251. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
5252. gbpln1490.seq - Plant sequence entries (including fungi and algae), part 1490.
5253. gbpln1491.seq - Plant sequence entries (including fungi and algae), part 1491.
5254. gbpln1492.seq - Plant sequence entries (including fungi and algae), part 1492.
5255. gbpln1493.seq - Plant sequence entries (including fungi and algae), part 1493.
5256. gbpln1494.seq - Plant sequence entries (including fungi and algae), part 1494.
5257. gbpln1495.seq - Plant sequence entries (including fungi and algae), part 1495.
5258. gbpln1496.seq - Plant sequence entries (including fungi and algae), part 1496.
5259. gbpln1497.seq - Plant sequence entries (including fungi and algae), part 1497.
5260. gbpln1498.seq - Plant sequence entries (including fungi and algae), part 1498.
5261. gbpln1499.seq - Plant sequence entries (including fungi and algae), part 1499.
5262. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
5263. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
5264. gbpln1500.seq - Plant sequence entries (including fungi and algae), part 1500.
5265. gbpln1501.seq - Plant sequence entries (including fungi and algae), part 1501.
5266. gbpln1502.seq - Plant sequence entries (including fungi and algae), part 1502.
5267. gbpln1503.seq - Plant sequence entries (including fungi and algae), part 1503.
5268. gbpln1504.seq - Plant sequence entries (including fungi and algae), part 1504.
5269. gbpln1505.seq - Plant sequence entries (including fungi and algae), part 1505.
5270. gbpln1506.seq - Plant sequence entries (including fungi and algae), part 1506.
5271. gbpln1507.seq - Plant sequence entries (including fungi and algae), part 1507.
5272. gbpln1508.seq - Plant sequence entries (including fungi and algae), part 1508.
5273. gbpln1509.seq - Plant sequence entries (including fungi and algae), part 1509.
5274. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
5275. gbpln1510.seq - Plant sequence entries (including fungi and algae), part 1510.
5276. gbpln1511.seq - Plant sequence entries (including fungi and algae), part 1511.
5277. gbpln1512.seq - Plant sequence entries (including fungi and algae), part 1512.
5278. gbpln1513.seq - Plant sequence entries (including fungi and algae), part 1513.
5279. gbpln1514.seq - Plant sequence entries (including fungi and algae), part 1514.
5280. gbpln1515.seq - Plant sequence entries (including fungi and algae), part 1515.
5281. gbpln1516.seq - Plant sequence entries (including fungi and algae), part 1516.
5282. gbpln1517.seq - Plant sequence entries (including fungi and algae), part 1517.
5283. gbpln1518.seq - Plant sequence entries (including fungi and algae), part 1518.
5284. gbpln1519.seq - Plant sequence entries (including fungi and algae), part 1519.
5285. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
5286. gbpln1520.seq - Plant sequence entries (including fungi and algae), part 1520.
5287. gbpln1521.seq - Plant sequence entries (including fungi and algae), part 1521.
5288. gbpln1522.seq - Plant sequence entries (including fungi and algae), part 1522.
5289. gbpln1523.seq - Plant sequence entries (including fungi and algae), part 1523.
5290. gbpln1524.seq - Plant sequence entries (including fungi and algae), part 1524.
5291. gbpln1525.seq - Plant sequence entries (including fungi and algae), part 1525.
5292. gbpln1526.seq - Plant sequence entries (including fungi and algae), part 1526.
5293. gbpln1527.seq - Plant sequence entries (including fungi and algae), part 1527.
5294. gbpln1528.seq - Plant sequence entries (including fungi and algae), part 1528.
5295. gbpln1529.seq - Plant sequence entries (including fungi and algae), part 1529.
5296. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
5297. gbpln1530.seq - Plant sequence entries (including fungi and algae), part 1530.
5298. gbpln1531.seq - Plant sequence entries (including fungi and algae), part 1531.
5299. gbpln1532.seq - Plant sequence entries (including fungi and algae), part 1532.
5300. gbpln1533.seq - Plant sequence entries (including fungi and algae), part 1533.
5301. gbpln1534.seq - Plant sequence entries (including fungi and algae), part 1534.
5302. gbpln1535.seq - Plant sequence entries (including fungi and algae), part 1535.
5303. gbpln1536.seq - Plant sequence entries (including fungi and algae), part 1536.
5304. gbpln1537.seq - Plant sequence entries (including fungi and algae), part 1537.
5305. gbpln1538.seq - Plant sequence entries (including fungi and algae), part 1538.
5306. gbpln1539.seq - Plant sequence entries (including fungi and algae), part 1539.
5307. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
5308. gbpln1540.seq - Plant sequence entries (including fungi and algae), part 1540.
5309. gbpln1541.seq - Plant sequence entries (including fungi and algae), part 1541.
5310. gbpln1542.seq - Plant sequence entries (including fungi and algae), part 1542.
5311. gbpln1543.seq - Plant sequence entries (including fungi and algae), part 1543.
5312. gbpln1544.seq - Plant sequence entries (including fungi and algae), part 1544.
5313. gbpln1545.seq - Plant sequence entries (including fungi and algae), part 1545.
5314. gbpln1546.seq - Plant sequence entries (including fungi and algae), part 1546.
5315. gbpln1547.seq - Plant sequence entries (including fungi and algae), part 1547.
5316. gbpln1548.seq - Plant sequence entries (including fungi and algae), part 1548.
5317. gbpln1549.seq - Plant sequence entries (including fungi and algae), part 1549.
5318. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
5319. gbpln1550.seq - Plant sequence entries (including fungi and algae), part 1550.
5320. gbpln1551.seq - Plant sequence entries (including fungi and algae), part 1551.
5321. gbpln1552.seq - Plant sequence entries (including fungi and algae), part 1552.
5322. gbpln1553.seq - Plant sequence entries (including fungi and algae), part 1553.
5323. gbpln1554.seq - Plant sequence entries (including fungi and algae), part 1554.
5324. gbpln1555.seq - Plant sequence entries (including fungi and algae), part 1555.
5325. gbpln1556.seq - Plant sequence entries (including fungi and algae), part 1556.
5326. gbpln1557.seq - Plant sequence entries (including fungi and algae), part 1557.
5327. gbpln1558.seq - Plant sequence entries (including fungi and algae), part 1558.
5328. gbpln1559.seq - Plant sequence entries (including fungi and algae), part 1559.
5329. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
5330. gbpln1560.seq - Plant sequence entries (including fungi and algae), part 1560.
5331. gbpln1561.seq - Plant sequence entries (including fungi and algae), part 1561.
5332. gbpln1562.seq - Plant sequence entries (including fungi and algae), part 1562.
5333. gbpln1563.seq - Plant sequence entries (including fungi and algae), part 1563.
5334. gbpln1564.seq - Plant sequence entries (including fungi and algae), part 1564.
5335. gbpln1565.seq - Plant sequence entries (including fungi and algae), part 1565.
5336. gbpln1566.seq - Plant sequence entries (including fungi and algae), part 1566.
5337. gbpln1567.seq - Plant sequence entries (including fungi and algae), part 1567.
5338. gbpln1568.seq - Plant sequence entries (including fungi and algae), part 1568.
5339. gbpln1569.seq - Plant sequence entries (including fungi and algae), part 1569.
5340. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
5341. gbpln1570.seq - Plant sequence entries (including fungi and algae), part 1570.
5342. gbpln1571.seq - Plant sequence entries (including fungi and algae), part 1571.
5343. gbpln1572.seq - Plant sequence entries (including fungi and algae), part 1572.
5344. gbpln1573.seq - Plant sequence entries (including fungi and algae), part 1573.
5345. gbpln1574.seq - Plant sequence entries (including fungi and algae), part 1574.
5346. gbpln1575.seq - Plant sequence entries (including fungi and algae), part 1575.
5347. gbpln1576.seq - Plant sequence entries (including fungi and algae), part 1576.
5348. gbpln1577.seq - Plant sequence entries (including fungi and algae), part 1577.
5349. gbpln1578.seq - Plant sequence entries (including fungi and algae), part 1578.
5350. gbpln1579.seq - Plant sequence entries (including fungi and algae), part 1579.
5351. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
5352. gbpln1580.seq - Plant sequence entries (including fungi and algae), part 1580.
5353. gbpln1581.seq - Plant sequence entries (including fungi and algae), part 1581.
5354. gbpln1582.seq - Plant sequence entries (including fungi and algae), part 1582.
5355. gbpln1583.seq - Plant sequence entries (including fungi and algae), part 1583.
5356. gbpln1584.seq - Plant sequence entries (including fungi and algae), part 1584.
5357. gbpln1585.seq - Plant sequence entries (including fungi and algae), part 1585.
5358. gbpln1586.seq - Plant sequence entries (including fungi and algae), part 1586.
5359. gbpln1587.seq - Plant sequence entries (including fungi and algae), part 1587.
5360. gbpln1588.seq - Plant sequence entries (including fungi and algae), part 1588.
5361. gbpln1589.seq - Plant sequence entries (including fungi and algae), part 1589.
5362. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
5363. gbpln1590.seq - Plant sequence entries (including fungi and algae), part 1590.
5364. gbpln1591.seq - Plant sequence entries (including fungi and algae), part 1591.
5365. gbpln1592.seq - Plant sequence entries (including fungi and algae), part 1592.
5366. gbpln1593.seq - Plant sequence entries (including fungi and algae), part 1593.
5367. gbpln1594.seq - Plant sequence entries (including fungi and algae), part 1594.
5368. gbpln1595.seq - Plant sequence entries (including fungi and algae), part 1595.
5369. gbpln1596.seq - Plant sequence entries (including fungi and algae), part 1596.
5370. gbpln1597.seq - Plant sequence entries (including fungi and algae), part 1597.
5371. gbpln1598.seq - Plant sequence entries (including fungi and algae), part 1598.
5372. gbpln1599.seq - Plant sequence entries (including fungi and algae), part 1599.
5373. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
5374. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
5375. gbpln1600.seq - Plant sequence entries (including fungi and algae), part 1600.
5376. gbpln1601.seq - Plant sequence entries (including fungi and algae), part 1601.
5377. gbpln1602.seq - Plant sequence entries (including fungi and algae), part 1602.
5378. gbpln1603.seq - Plant sequence entries (including fungi and algae), part 1603.
5379. gbpln1604.seq - Plant sequence entries (including fungi and algae), part 1604.
5380. gbpln1605.seq - Plant sequence entries (including fungi and algae), part 1605.
5381. gbpln1606.seq - Plant sequence entries (including fungi and algae), part 1606.
5382. gbpln1607.seq - Plant sequence entries (including fungi and algae), part 1607.
5383. gbpln1608.seq - Plant sequence entries (including fungi and algae), part 1608.
5384. gbpln1609.seq - Plant sequence entries (including fungi and algae), part 1609.
5385. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
5386. gbpln1610.seq - Plant sequence entries (including fungi and algae), part 1610.
5387. gbpln1611.seq - Plant sequence entries (including fungi and algae), part 1611.
5388. gbpln1612.seq - Plant sequence entries (including fungi and algae), part 1612.
5389. gbpln1613.seq - Plant sequence entries (including fungi and algae), part 1613.
5390. gbpln1614.seq - Plant sequence entries (including fungi and algae), part 1614.
5391. gbpln1615.seq - Plant sequence entries (including fungi and algae), part 1615.
5392. gbpln1616.seq - Plant sequence entries (including fungi and algae), part 1616.
5393. gbpln1617.seq - Plant sequence entries (including fungi and algae), part 1617.
5394. gbpln1618.seq - Plant sequence entries (including fungi and algae), part 1618.
5395. gbpln1619.seq - Plant sequence entries (including fungi and algae), part 1619.
5396. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
5397. gbpln1620.seq - Plant sequence entries (including fungi and algae), part 1620.
5398. gbpln1621.seq - Plant sequence entries (including fungi and algae), part 1621.
5399. gbpln1622.seq - Plant sequence entries (including fungi and algae), part 1622.
5400. gbpln1623.seq - Plant sequence entries (including fungi and algae), part 1623.
5401. gbpln1624.seq - Plant sequence entries (including fungi and algae), part 1624.
5402. gbpln1625.seq - Plant sequence entries (including fungi and algae), part 1625.
5403. gbpln1626.seq - Plant sequence entries (including fungi and algae), part 1626.
5404. gbpln1627.seq - Plant sequence entries (including fungi and algae), part 1627.
5405. gbpln1628.seq - Plant sequence entries (including fungi and algae), part 1628.
5406. gbpln1629.seq - Plant sequence entries (including fungi and algae), part 1629.
5407. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
5408. gbpln1630.seq - Plant sequence entries (including fungi and algae), part 1630.
5409. gbpln1631.seq - Plant sequence entries (including fungi and algae), part 1631.
5410. gbpln1632.seq - Plant sequence entries (including fungi and algae), part 1632.
5411. gbpln1633.seq - Plant sequence entries (including fungi and algae), part 1633.
5412. gbpln1634.seq - Plant sequence entries (including fungi and algae), part 1634.
5413. gbpln1635.seq - Plant sequence entries (including fungi and algae), part 1635.
5414. gbpln1636.seq - Plant sequence entries (including fungi and algae), part 1636.
5415. gbpln1637.seq - Plant sequence entries (including fungi and algae), part 1637.
5416. gbpln1638.seq - Plant sequence entries (including fungi and algae), part 1638.
5417. gbpln1639.seq - Plant sequence entries (including fungi and algae), part 1639.
5418. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
5419. gbpln1640.seq - Plant sequence entries (including fungi and algae), part 1640.
5420. gbpln1641.seq - Plant sequence entries (including fungi and algae), part 1641.
5421. gbpln1642.seq - Plant sequence entries (including fungi and algae), part 1642.
5422. gbpln1643.seq - Plant sequence entries (including fungi and algae), part 1643.
5423. gbpln1644.seq - Plant sequence entries (including fungi and algae), part 1644.
5424. gbpln1645.seq - Plant sequence entries (including fungi and algae), part 1645.
5425. gbpln1646.seq - Plant sequence entries (including fungi and algae), part 1646.
5426. gbpln1647.seq - Plant sequence entries (including fungi and algae), part 1647.
5427. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
5428. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
5429. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
5430. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
5431. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
5432. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
5433. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
5434. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
5435. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
5436. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
5437. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
5438. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
5439. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
5440. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
5441. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
5442. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
5443. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
5444. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
5445. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
5446. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
5447. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
5448. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
5449. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
5450. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
5451. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
5452. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
5453. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
5454. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
5455. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
5456. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
5457. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
5458. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
5459. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
5460. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
5461. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
5462. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
5463. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
5464. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
5465. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
5466. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
5467. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
5468. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
5469. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
5470. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
5471. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
5472. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
5473. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
5474. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
5475. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
5476. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
5477. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
5478. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
5479. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
5480. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
5481. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
5482. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
5483. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
5484. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
5485. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
5486. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
5487. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
5488. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
5489. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
5490. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
5491. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
5492. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
5493. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
5494. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
5495. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
5496. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
5497. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
5498. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
5499. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
5500. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
5501. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
5502. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
5503. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
5504. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
5505. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
5506. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
5507. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
5508. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
5509. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
5510. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
5511. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
5512. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
5513. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
5514. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
5515. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
5516. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
5517. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
5518. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
5519. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
5520. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
5521. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
5522. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
5523. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
5524. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
5525. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
5526. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
5527. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
5528. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
5529. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
5530. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
5531. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
5532. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
5533. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
5534. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
5535. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
5536. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
5537. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
5538. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
5539. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
5540. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
5541. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
5542. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
5543. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
5544. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
5545. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
5546. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
5547. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
5548. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
5549. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
5550. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
5551. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
5552. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
5553. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
5554. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
5555. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
5556. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
5557. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
5558. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
5559. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
5560. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
5561. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
5562. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
5563. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
5564. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
5565. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
5566. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
5567. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
5568. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
5569. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
5570. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
5571. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
5572. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
5573. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
5574. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
5575. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
5576. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
5577. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
5578. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
5579. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
5580. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
5581. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
5582. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
5583. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
5584. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
5585. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
5586. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
5587. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
5588. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
5589. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
5590. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
5591. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
5592. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
5593. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
5594. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
5595. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
5596. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
5597. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
5598. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
5599. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
5600. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
5601. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
5602. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
5603. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
5604. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
5605. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
5606. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
5607. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
5608. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
5609. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
5610. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
5611. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
5612. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
5613. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
5614. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
5615. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
5616. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
5617. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
5618. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
5619. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
5620. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
5621. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
5622. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
5623. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
5624. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
5625. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
5626. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
5627. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
5628. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
5629. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
5630. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
5631. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
5632. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
5633. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
5634. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
5635. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
5636. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
5637. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
5638. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
5639. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
5640. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
5641. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
5642. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
5643. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
5644. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
5645. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
5646. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
5647. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
5648. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
5649. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
5650. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
5651. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
5652. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
5653. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
5654. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
5655. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
5656. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
5657. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
5658. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
5659. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
5660. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
5661. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
5662. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
5663. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
5664. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
5665. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
5666. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
5667. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
5668. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
5669. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
5670. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
5671. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
5672. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
5673. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
5674. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
5675. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
5676. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
5677. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
5678. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
5679. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
5680. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
5681. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
5682. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
5683. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
5684. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
5685. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
5686. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
5687. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
5688. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
5689. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
5690. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
5691. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
5692. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
5693. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
5694. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
5695. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
5696. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
5697. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
5698. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
5699. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
5700. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
5701. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
5702. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
5703. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
5704. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
5705. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
5706. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
5707. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
5708. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
5709. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
5710. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
5711. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
5712. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
5713. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
5714. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
5715. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
5716. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
5717. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
5718. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
5719. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
5720. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
5721. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
5722. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
5723. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
5724. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
5725. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
5726. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
5727. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
5728. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
5729. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
5730. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
5731. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
5732. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
5733. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
5734. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
5735. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
5736. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
5737. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
5738. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
5739. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
5740. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
5741. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
5742. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
5743. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
5744. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
5745. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
5746. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
5747. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
5748. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
5749. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
5750. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
5751. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
5752. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
5753. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
5754. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
5755. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
5756. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
5757. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
5758. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
5759. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
5760. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
5761. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
5762. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
5763. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
5764. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
5765. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
5766. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
5767. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
5768. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
5769. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
5770. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
5771. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
5772. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
5773. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
5774. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
5775. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
5776. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
5777. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
5778. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
5779. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
5780. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
5781. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
5782. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
5783. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
5784. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
5785. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
5786. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
5787. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
5788. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
5789. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
5790. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
5791. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
5792. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
5793. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
5794. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
5795. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
5796. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
5797. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
5798. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
5799. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
5800. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
5801. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
5802. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
5803. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
5804. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
5805. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
5806. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
5807. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
5808. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
5809. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
5810. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
5811. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
5812. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
5813. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
5814. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
5815. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
5816. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
5817. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
5818. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
5819. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
5820. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
5821. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
5822. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
5823. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
5824. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
5825. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
5826. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
5827. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
5828. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
5829. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
5830. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
5831. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
5832. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
5833. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
5834. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
5835. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
5836. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
5837. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
5838. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
5839. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
5840. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
5841. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
5842. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
5843. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
5844. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
5845. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
5846. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
5847. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
5848. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
5849. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
5850. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
5851. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
5852. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548.
5853. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549.
5854. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
5855. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550.
5856. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551.
5857. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552.
5858. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553.
5859. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554.
5860. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555.
5861. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556.
5862. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557.
5863. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558.
5864. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559.
5865. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
5866. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560.
5867. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561.
5868. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562.
5869. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563.
5870. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564.
5871. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565.
5872. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566.
5873. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567.
5874. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568.
5875. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569.
5876. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
5877. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570.
5878. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571.
5879. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572.
5880. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573.
5881. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574.
5882. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575.
5883. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576.
5884. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577.
5885. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578.
5886. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579.
5887. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
5888. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580.
5889. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581.
5890. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582.
5891. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583.
5892. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584.
5893. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585.
5894. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586.
5895. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587.
5896. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588.
5897. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589.
5898. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
5899. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590.
5900. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591.
5901. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592.
5902. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593.
5903. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594.
5904. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595.
5905. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596.
5906. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597.
5907. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598.
5908. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599.
5909. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
5910. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
5911. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600.
5912. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601.
5913. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602.
5914. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603.
5915. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604.
5916. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605.
5917. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606.
5918. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607.
5919. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608.
5920. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609.
5921. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
5922. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610.
5923. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611.
5924. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612.
5925. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613.
5926. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614.
5927. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615.
5928. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616.
5929. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617.
5930. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618.
5931. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619.
5932. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
5933. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620.
5934. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621.
5935. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622.
5936. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623.
5937. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624.
5938. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625.
5939. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626.
5940. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627.
5941. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628.
5942. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629.
5943. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
5944. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630.
5945. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631.
5946. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632.
5947. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633.
5948. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634.
5949. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635.
5950. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636.
5951. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637.
5952. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638.
5953. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639.
5954. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
5955. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640.
5956. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641.
5957. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642.
5958. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643.
5959. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644.
5960. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645.
5961. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646.
5962. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647.
5963. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648.
5964. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649.
5965. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
5966. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650.
5967. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651.
5968. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652.
5969. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653.
5970. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654.
5971. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655.
5972. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656.
5973. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657.
5974. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658.
5975. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659.
5976. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
5977. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660.
5978. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661.
5979. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662.
5980. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663.
5981. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664.
5982. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665.
5983. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666.
5984. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667.
5985. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668.
5986. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669.
5987. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
5988. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670.
5989. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671.
5990. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672.
5991. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673.
5992. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674.
5993. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675.
5994. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676.
5995. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677.
5996. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678.
5997. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679.
5998. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
5999. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680.
6000. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681.
6001. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682.
6002. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683.
6003. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684.
6004. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685.
6005. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686.
6006. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687.
6007. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688.
6008. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689.
6009. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
6010. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690.
6011. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691.
6012. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692.
6013. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693.
6014. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694.
6015. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695.
6016. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696.
6017. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697.
6018. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698.
6019. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699.
6020. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
6021. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
6022. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700.
6023. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701.
6024. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702.
6025. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703.
6026. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704.
6027. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705.
6028. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706.
6029. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707.
6030. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708.
6031. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709.
6032. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
6033. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710.
6034. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711.
6035. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712.
6036. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713.
6037. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714.
6038. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715.
6039. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716.
6040. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717.
6041. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718.
6042. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719.
6043. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
6044. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720.
6045. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721.
6046. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722.
6047. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723.
6048. gbpln724.seq - Plant sequence entries (including fungi and algae), part 724.
6049. gbpln725.seq - Plant sequence entries (including fungi and algae), part 725.
6050. gbpln726.seq - Plant sequence entries (including fungi and algae), part 726.
6051. gbpln727.seq - Plant sequence entries (including fungi and algae), part 727.
6052. gbpln728.seq - Plant sequence entries (including fungi and algae), part 728.
6053. gbpln729.seq - Plant sequence entries (including fungi and algae), part 729.
6054. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
6055. gbpln730.seq - Plant sequence entries (including fungi and algae), part 730.
6056. gbpln731.seq - Plant sequence entries (including fungi and algae), part 731.
6057. gbpln732.seq - Plant sequence entries (including fungi and algae), part 732.
6058. gbpln733.seq - Plant sequence entries (including fungi and algae), part 733.
6059. gbpln734.seq - Plant sequence entries (including fungi and algae), part 734.
6060. gbpln735.seq - Plant sequence entries (including fungi and algae), part 735.
6061. gbpln736.seq - Plant sequence entries (including fungi and algae), part 736.
6062. gbpln737.seq - Plant sequence entries (including fungi and algae), part 737.
6063. gbpln738.seq - Plant sequence entries (including fungi and algae), part 738.
6064. gbpln739.seq - Plant sequence entries (including fungi and algae), part 739.
6065. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
6066. gbpln740.seq - Plant sequence entries (including fungi and algae), part 740.
6067. gbpln741.seq - Plant sequence entries (including fungi and algae), part 741.
6068. gbpln742.seq - Plant sequence entries (including fungi and algae), part 742.
6069. gbpln743.seq - Plant sequence entries (including fungi and algae), part 743.
6070. gbpln744.seq - Plant sequence entries (including fungi and algae), part 744.
6071. gbpln745.seq - Plant sequence entries (including fungi and algae), part 745.
6072. gbpln746.seq - Plant sequence entries (including fungi and algae), part 746.
6073. gbpln747.seq - Plant sequence entries (including fungi and algae), part 747.
6074. gbpln748.seq - Plant sequence entries (including fungi and algae), part 748.
6075. gbpln749.seq - Plant sequence entries (including fungi and algae), part 749.
6076. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
6077. gbpln750.seq - Plant sequence entries (including fungi and algae), part 750.
6078. gbpln751.seq - Plant sequence entries (including fungi and algae), part 751.
6079. gbpln752.seq - Plant sequence entries (including fungi and algae), part 752.
6080. gbpln753.seq - Plant sequence entries (including fungi and algae), part 753.
6081. gbpln754.seq - Plant sequence entries (including fungi and algae), part 754.
6082. gbpln755.seq - Plant sequence entries (including fungi and algae), part 755.
6083. gbpln756.seq - Plant sequence entries (including fungi and algae), part 756.
6084. gbpln757.seq - Plant sequence entries (including fungi and algae), part 757.
6085. gbpln758.seq - Plant sequence entries (including fungi and algae), part 758.
6086. gbpln759.seq - Plant sequence entries (including fungi and algae), part 759.
6087. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
6088. gbpln760.seq - Plant sequence entries (including fungi and algae), part 760.
6089. gbpln761.seq - Plant sequence entries (including fungi and algae), part 761.
6090. gbpln762.seq - Plant sequence entries (including fungi and algae), part 762.
6091. gbpln763.seq - Plant sequence entries (including fungi and algae), part 763.
6092. gbpln764.seq - Plant sequence entries (including fungi and algae), part 764.
6093. gbpln765.seq - Plant sequence entries (including fungi and algae), part 765.
6094. gbpln766.seq - Plant sequence entries (including fungi and algae), part 766.
6095. gbpln767.seq - Plant sequence entries (including fungi and algae), part 767.
6096. gbpln768.seq - Plant sequence entries (including fungi and algae), part 768.
6097. gbpln769.seq - Plant sequence entries (including fungi and algae), part 769.
6098. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
6099. gbpln770.seq - Plant sequence entries (including fungi and algae), part 770.
6100. gbpln771.seq - Plant sequence entries (including fungi and algae), part 771.
6101. gbpln772.seq - Plant sequence entries (including fungi and algae), part 772.
6102. gbpln773.seq - Plant sequence entries (including fungi and algae), part 773.
6103. gbpln774.seq - Plant sequence entries (including fungi and algae), part 774.
6104. gbpln775.seq - Plant sequence entries (including fungi and algae), part 775.
6105. gbpln776.seq - Plant sequence entries (including fungi and algae), part 776.
6106. gbpln777.seq - Plant sequence entries (including fungi and algae), part 777.
6107. gbpln778.seq - Plant sequence entries (including fungi and algae), part 778.
6108. gbpln779.seq - Plant sequence entries (including fungi and algae), part 779.
6109. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
6110. gbpln780.seq - Plant sequence entries (including fungi and algae), part 780.
6111. gbpln781.seq - Plant sequence entries (including fungi and algae), part 781.
6112. gbpln782.seq - Plant sequence entries (including fungi and algae), part 782.
6113. gbpln783.seq - Plant sequence entries (including fungi and algae), part 783.
6114. gbpln784.seq - Plant sequence entries (including fungi and algae), part 784.
6115. gbpln785.seq - Plant sequence entries (including fungi and algae), part 785.
6116. gbpln786.seq - Plant sequence entries (including fungi and algae), part 786.
6117. gbpln787.seq - Plant sequence entries (including fungi and algae), part 787.
6118. gbpln788.seq - Plant sequence entries (including fungi and algae), part 788.
6119. gbpln789.seq - Plant sequence entries (including fungi and algae), part 789.
6120. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
6121. gbpln790.seq - Plant sequence entries (including fungi and algae), part 790.
6122. gbpln791.seq - Plant sequence entries (including fungi and algae), part 791.
6123. gbpln792.seq - Plant sequence entries (including fungi and algae), part 792.
6124. gbpln793.seq - Plant sequence entries (including fungi and algae), part 793.
6125. gbpln794.seq - Plant sequence entries (including fungi and algae), part 794.
6126. gbpln795.seq - Plant sequence entries (including fungi and algae), part 795.
6127. gbpln796.seq - Plant sequence entries (including fungi and algae), part 796.
6128. gbpln797.seq - Plant sequence entries (including fungi and algae), part 797.
6129. gbpln798.seq - Plant sequence entries (including fungi and algae), part 798.
6130. gbpln799.seq - Plant sequence entries (including fungi and algae), part 799.
6131. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
6132. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
6133. gbpln800.seq - Plant sequence entries (including fungi and algae), part 800.
6134. gbpln801.seq - Plant sequence entries (including fungi and algae), part 801.
6135. gbpln802.seq - Plant sequence entries (including fungi and algae), part 802.
6136. gbpln803.seq - Plant sequence entries (including fungi and algae), part 803.
6137. gbpln804.seq - Plant sequence entries (including fungi and algae), part 804.
6138. gbpln805.seq - Plant sequence entries (including fungi and algae), part 805.
6139. gbpln806.seq - Plant sequence entries (including fungi and algae), part 806.
6140. gbpln807.seq - Plant sequence entries (including fungi and algae), part 807.
6141. gbpln808.seq - Plant sequence entries (including fungi and algae), part 808.
6142. gbpln809.seq - Plant sequence entries (including fungi and algae), part 809.
6143. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
6144. gbpln810.seq - Plant sequence entries (including fungi and algae), part 810.
6145. gbpln811.seq - Plant sequence entries (including fungi and algae), part 811.
6146. gbpln812.seq - Plant sequence entries (including fungi and algae), part 812.
6147. gbpln813.seq - Plant sequence entries (including fungi and algae), part 813.
6148. gbpln814.seq - Plant sequence entries (including fungi and algae), part 814.
6149. gbpln815.seq - Plant sequence entries (including fungi and algae), part 815.
6150. gbpln816.seq - Plant sequence entries (including fungi and algae), part 816.
6151. gbpln817.seq - Plant sequence entries (including fungi and algae), part 817.
6152. gbpln818.seq - Plant sequence entries (including fungi and algae), part 818.
6153. gbpln819.seq - Plant sequence entries (including fungi and algae), part 819.
6154. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
6155. gbpln820.seq - Plant sequence entries (including fungi and algae), part 820.
6156. gbpln821.seq - Plant sequence entries (including fungi and algae), part 821.
6157. gbpln822.seq - Plant sequence entries (including fungi and algae), part 822.
6158. gbpln823.seq - Plant sequence entries (including fungi and algae), part 823.
6159. gbpln824.seq - Plant sequence entries (including fungi and algae), part 824.
6160. gbpln825.seq - Plant sequence entries (including fungi and algae), part 825.
6161. gbpln826.seq - Plant sequence entries (including fungi and algae), part 826.
6162. gbpln827.seq - Plant sequence entries (including fungi and algae), part 827.
6163. gbpln828.seq - Plant sequence entries (including fungi and algae), part 828.
6164. gbpln829.seq - Plant sequence entries (including fungi and algae), part 829.
6165. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
6166. gbpln830.seq - Plant sequence entries (including fungi and algae), part 830.
6167. gbpln831.seq - Plant sequence entries (including fungi and algae), part 831.
6168. gbpln832.seq - Plant sequence entries (including fungi and algae), part 832.
6169. gbpln833.seq - Plant sequence entries (including fungi and algae), part 833.
6170. gbpln834.seq - Plant sequence entries (including fungi and algae), part 834.
6171. gbpln835.seq - Plant sequence entries (including fungi and algae), part 835.
6172. gbpln836.seq - Plant sequence entries (including fungi and algae), part 836.
6173. gbpln837.seq - Plant sequence entries (including fungi and algae), part 837.
6174. gbpln838.seq - Plant sequence entries (including fungi and algae), part 838.
6175. gbpln839.seq - Plant sequence entries (including fungi and algae), part 839.
6176. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
6177. gbpln840.seq - Plant sequence entries (including fungi and algae), part 840.
6178. gbpln841.seq - Plant sequence entries (including fungi and algae), part 841.
6179. gbpln842.seq - Plant sequence entries (including fungi and algae), part 842.
6180. gbpln843.seq - Plant sequence entries (including fungi and algae), part 843.
6181. gbpln844.seq - Plant sequence entries (including fungi and algae), part 844.
6182. gbpln845.seq - Plant sequence entries (including fungi and algae), part 845.
6183. gbpln846.seq - Plant sequence entries (including fungi and algae), part 846.
6184. gbpln847.seq - Plant sequence entries (including fungi and algae), part 847.
6185. gbpln848.seq - Plant sequence entries (including fungi and algae), part 848.
6186. gbpln849.seq - Plant sequence entries (including fungi and algae), part 849.
6187. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
6188. gbpln850.seq - Plant sequence entries (including fungi and algae), part 850.
6189. gbpln851.seq - Plant sequence entries (including fungi and algae), part 851.
6190. gbpln852.seq - Plant sequence entries (including fungi and algae), part 852.
6191. gbpln853.seq - Plant sequence entries (including fungi and algae), part 853.
6192. gbpln854.seq - Plant sequence entries (including fungi and algae), part 854.
6193. gbpln855.seq - Plant sequence entries (including fungi and algae), part 855.
6194. gbpln856.seq - Plant sequence entries (including fungi and algae), part 856.
6195. gbpln857.seq - Plant sequence entries (including fungi and algae), part 857.
6196. gbpln858.seq - Plant sequence entries (including fungi and algae), part 858.
6197. gbpln859.seq - Plant sequence entries (including fungi and algae), part 859.
6198. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
6199. gbpln860.seq - Plant sequence entries (including fungi and algae), part 860.
6200. gbpln861.seq - Plant sequence entries (including fungi and algae), part 861.
6201. gbpln862.seq - Plant sequence entries (including fungi and algae), part 862.
6202. gbpln863.seq - Plant sequence entries (including fungi and algae), part 863.
6203. gbpln864.seq - Plant sequence entries (including fungi and algae), part 864.
6204. gbpln865.seq - Plant sequence entries (including fungi and algae), part 865.
6205. gbpln866.seq - Plant sequence entries (including fungi and algae), part 866.
6206. gbpln867.seq - Plant sequence entries (including fungi and algae), part 867.
6207. gbpln868.seq - Plant sequence entries (including fungi and algae), part 868.
6208. gbpln869.seq - Plant sequence entries (including fungi and algae), part 869.
6209. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
6210. gbpln870.seq - Plant sequence entries (including fungi and algae), part 870.
6211. gbpln871.seq - Plant sequence entries (including fungi and algae), part 871.
6212. gbpln872.seq - Plant sequence entries (including fungi and algae), part 872.
6213. gbpln873.seq - Plant sequence entries (including fungi and algae), part 873.
6214. gbpln874.seq - Plant sequence entries (including fungi and algae), part 874.
6215. gbpln875.seq - Plant sequence entries (including fungi and algae), part 875.
6216. gbpln876.seq - Plant sequence entries (including fungi and algae), part 876.
6217. gbpln877.seq - Plant sequence entries (including fungi and algae), part 877.
6218. gbpln878.seq - Plant sequence entries (including fungi and algae), part 878.
6219. gbpln879.seq - Plant sequence entries (including fungi and algae), part 879.
6220. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
6221. gbpln880.seq - Plant sequence entries (including fungi and algae), part 880.
6222. gbpln881.seq - Plant sequence entries (including fungi and algae), part 881.
6223. gbpln882.seq - Plant sequence entries (including fungi and algae), part 882.
6224. gbpln883.seq - Plant sequence entries (including fungi and algae), part 883.
6225. gbpln884.seq - Plant sequence entries (including fungi and algae), part 884.
6226. gbpln885.seq - Plant sequence entries (including fungi and algae), part 885.
6227. gbpln886.seq - Plant sequence entries (including fungi and algae), part 886.
6228. gbpln887.seq - Plant sequence entries (including fungi and algae), part 887.
6229. gbpln888.seq - Plant sequence entries (including fungi and algae), part 888.
6230. gbpln889.seq - Plant sequence entries (including fungi and algae), part 889.
6231. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
6232. gbpln890.seq - Plant sequence entries (including fungi and algae), part 890.
6233. gbpln891.seq - Plant sequence entries (including fungi and algae), part 891.
6234. gbpln892.seq - Plant sequence entries (including fungi and algae), part 892.
6235. gbpln893.seq - Plant sequence entries (including fungi and algae), part 893.
6236. gbpln894.seq - Plant sequence entries (including fungi and algae), part 894.
6237. gbpln895.seq - Plant sequence entries (including fungi and algae), part 895.
6238. gbpln896.seq - Plant sequence entries (including fungi and algae), part 896.
6239. gbpln897.seq - Plant sequence entries (including fungi and algae), part 897.
6240. gbpln898.seq - Plant sequence entries (including fungi and algae), part 898.
6241. gbpln899.seq - Plant sequence entries (including fungi and algae), part 899.
6242. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
6243. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
6244. gbpln900.seq - Plant sequence entries (including fungi and algae), part 900.
6245. gbpln901.seq - Plant sequence entries (including fungi and algae), part 901.
6246. gbpln902.seq - Plant sequence entries (including fungi and algae), part 902.
6247. gbpln903.seq - Plant sequence entries (including fungi and algae), part 903.
6248. gbpln904.seq - Plant sequence entries (including fungi and algae), part 904.
6249. gbpln905.seq - Plant sequence entries (including fungi and algae), part 905.
6250. gbpln906.seq - Plant sequence entries (including fungi and algae), part 906.
6251. gbpln907.seq - Plant sequence entries (including fungi and algae), part 907.
6252. gbpln908.seq - Plant sequence entries (including fungi and algae), part 908.
6253. gbpln909.seq - Plant sequence entries (including fungi and algae), part 909.
6254. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
6255. gbpln910.seq - Plant sequence entries (including fungi and algae), part 910.
6256. gbpln911.seq - Plant sequence entries (including fungi and algae), part 911.
6257. gbpln912.seq - Plant sequence entries (including fungi and algae), part 912.
6258. gbpln913.seq - Plant sequence entries (including fungi and algae), part 913.
6259. gbpln914.seq - Plant sequence entries (including fungi and algae), part 914.
6260. gbpln915.seq - Plant sequence entries (including fungi and algae), part 915.
6261. gbpln916.seq - Plant sequence entries (including fungi and algae), part 916.
6262. gbpln917.seq - Plant sequence entries (including fungi and algae), part 917.
6263. gbpln918.seq - Plant sequence entries (including fungi and algae), part 918.
6264. gbpln919.seq - Plant sequence entries (including fungi and algae), part 919.
6265. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
6266. gbpln920.seq - Plant sequence entries (including fungi and algae), part 920.
6267. gbpln921.seq - Plant sequence entries (including fungi and algae), part 921.
6268. gbpln922.seq - Plant sequence entries (including fungi and algae), part 922.
6269. gbpln923.seq - Plant sequence entries (including fungi and algae), part 923.
6270. gbpln924.seq - Plant sequence entries (including fungi and algae), part 924.
6271. gbpln925.seq - Plant sequence entries (including fungi and algae), part 925.
6272. gbpln926.seq - Plant sequence entries (including fungi and algae), part 926.
6273. gbpln927.seq - Plant sequence entries (including fungi and algae), part 927.
6274. gbpln928.seq - Plant sequence entries (including fungi and algae), part 928.
6275. gbpln929.seq - Plant sequence entries (including fungi and algae), part 929.
6276. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
6277. gbpln930.seq - Plant sequence entries (including fungi and algae), part 930.
6278. gbpln931.seq - Plant sequence entries (including fungi and algae), part 931.
6279. gbpln932.seq - Plant sequence entries (including fungi and algae), part 932.
6280. gbpln933.seq - Plant sequence entries (including fungi and algae), part 933.
6281. gbpln934.seq - Plant sequence entries (including fungi and algae), part 934.
6282. gbpln935.seq - Plant sequence entries (including fungi and algae), part 935.
6283. gbpln936.seq - Plant sequence entries (including fungi and algae), part 936.
6284. gbpln937.seq - Plant sequence entries (including fungi and algae), part 937.
6285. gbpln938.seq - Plant sequence entries (including fungi and algae), part 938.
6286. gbpln939.seq - Plant sequence entries (including fungi and algae), part 939.
6287. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
6288. gbpln940.seq - Plant sequence entries (including fungi and algae), part 940.
6289. gbpln941.seq - Plant sequence entries (including fungi and algae), part 941.
6290. gbpln942.seq - Plant sequence entries (including fungi and algae), part 942.
6291. gbpln943.seq - Plant sequence entries (including fungi and algae), part 943.
6292. gbpln944.seq - Plant sequence entries (including fungi and algae), part 944.
6293. gbpln945.seq - Plant sequence entries (including fungi and algae), part 945.
6294. gbpln946.seq - Plant sequence entries (including fungi and algae), part 946.
6295. gbpln947.seq - Plant sequence entries (including fungi and algae), part 947.
6296. gbpln948.seq - Plant sequence entries (including fungi and algae), part 948.
6297. gbpln949.seq - Plant sequence entries (including fungi and algae), part 949.
6298. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
6299. gbpln950.seq - Plant sequence entries (including fungi and algae), part 950.
6300. gbpln951.seq - Plant sequence entries (including fungi and algae), part 951.
6301. gbpln952.seq - Plant sequence entries (including fungi and algae), part 952.
6302. gbpln953.seq - Plant sequence entries (including fungi and algae), part 953.
6303. gbpln954.seq - Plant sequence entries (including fungi and algae), part 954.
6304. gbpln955.seq - Plant sequence entries (including fungi and algae), part 955.
6305. gbpln956.seq - Plant sequence entries (including fungi and algae), part 956.
6306. gbpln957.seq - Plant sequence entries (including fungi and algae), part 957.
6307. gbpln958.seq - Plant sequence entries (including fungi and algae), part 958.
6308. gbpln959.seq - Plant sequence entries (including fungi and algae), part 959.
6309. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
6310. gbpln960.seq - Plant sequence entries (including fungi and algae), part 960.
6311. gbpln961.seq - Plant sequence entries (including fungi and algae), part 961.
6312. gbpln962.seq - Plant sequence entries (including fungi and algae), part 962.
6313. gbpln963.seq - Plant sequence entries (including fungi and algae), part 963.
6314. gbpln964.seq - Plant sequence entries (including fungi and algae), part 964.
6315. gbpln965.seq - Plant sequence entries (including fungi and algae), part 965.
6316. gbpln966.seq - Plant sequence entries (including fungi and algae), part 966.
6317. gbpln967.seq - Plant sequence entries (including fungi and algae), part 967.
6318. gbpln968.seq - Plant sequence entries (including fungi and algae), part 968.
6319. gbpln969.seq - Plant sequence entries (including fungi and algae), part 969.
6320. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
6321. gbpln970.seq - Plant sequence entries (including fungi and algae), part 970.
6322. gbpln971.seq - Plant sequence entries (including fungi and algae), part 971.
6323. gbpln972.seq - Plant sequence entries (including fungi and algae), part 972.
6324. gbpln973.seq - Plant sequence entries (including fungi and algae), part 973.
6325. gbpln974.seq - Plant sequence entries (including fungi and algae), part 974.
6326. gbpln975.seq - Plant sequence entries (including fungi and algae), part 975.
6327. gbpln976.seq - Plant sequence entries (including fungi and algae), part 976.
6328. gbpln977.seq - Plant sequence entries (including fungi and algae), part 977.
6329. gbpln978.seq - Plant sequence entries (including fungi and algae), part 978.
6330. gbpln979.seq - Plant sequence entries (including fungi and algae), part 979.
6331. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
6332. gbpln980.seq - Plant sequence entries (including fungi and algae), part 980.
6333. gbpln981.seq - Plant sequence entries (including fungi and algae), part 981.
6334. gbpln982.seq - Plant sequence entries (including fungi and algae), part 982.
6335. gbpln983.seq - Plant sequence entries (including fungi and algae), part 983.
6336. gbpln984.seq - Plant sequence entries (including fungi and algae), part 984.
6337. gbpln985.seq - Plant sequence entries (including fungi and algae), part 985.
6338. gbpln986.seq - Plant sequence entries (including fungi and algae), part 986.
6339. gbpln987.seq - Plant sequence entries (including fungi and algae), part 987.
6340. gbpln988.seq - Plant sequence entries (including fungi and algae), part 988.
6341. gbpln989.seq - Plant sequence entries (including fungi and algae), part 989.
6342. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
6343. gbpln990.seq - Plant sequence entries (including fungi and algae), part 990.
6344. gbpln991.seq - Plant sequence entries (including fungi and algae), part 991.
6345. gbpln992.seq - Plant sequence entries (including fungi and algae), part 992.
6346. gbpln993.seq - Plant sequence entries (including fungi and algae), part 993.
6347. gbpln994.seq - Plant sequence entries (including fungi and algae), part 994.
6348. gbpln995.seq - Plant sequence entries (including fungi and algae), part 995.
6349. gbpln996.seq - Plant sequence entries (including fungi and algae), part 996.
6350. gbpln997.seq - Plant sequence entries (including fungi and algae), part 997.
6351. gbpln998.seq - Plant sequence entries (including fungi and algae), part 998.
6352. gbpln999.seq - Plant sequence entries (including fungi and algae), part 999.
6353. gbpri1.seq - Primate sequence entries, part 1.
6354. gbpri10.seq - Primate sequence entries, part 10.
6355. gbpri11.seq - Primate sequence entries, part 11.
6356. gbpri12.seq - Primate sequence entries, part 12.
6357. gbpri13.seq - Primate sequence entries, part 13.
6358. gbpri14.seq - Primate sequence entries, part 14.
6359. gbpri15.seq - Primate sequence entries, part 15.
6360. gbpri16.seq - Primate sequence entries, part 16.
6361. gbpri17.seq - Primate sequence entries, part 17.
6362. gbpri18.seq - Primate sequence entries, part 18.
6363. gbpri19.seq - Primate sequence entries, part 19.
6364. gbpri2.seq - Primate sequence entries, part 2.
6365. gbpri20.seq - Primate sequence entries, part 20.
6366. gbpri21.seq - Primate sequence entries, part 21.
6367. gbpri22.seq - Primate sequence entries, part 22.
6368. gbpri23.seq - Primate sequence entries, part 23.
6369. gbpri24.seq - Primate sequence entries, part 24.
6370. gbpri25.seq - Primate sequence entries, part 25.
6371. gbpri26.seq - Primate sequence entries, part 26.
6372. gbpri27.seq - Primate sequence entries, part 27.
6373. gbpri28.seq - Primate sequence entries, part 28.
6374. gbpri29.seq - Primate sequence entries, part 29.
6375. gbpri3.seq - Primate sequence entries, part 3.
6376. gbpri30.seq - Primate sequence entries, part 30.
6377. gbpri31.seq - Primate sequence entries, part 31.
6378. gbpri32.seq - Primate sequence entries, part 32.
6379. gbpri33.seq - Primate sequence entries, part 33.
6380. gbpri34.seq - Primate sequence entries, part 34.
6381. gbpri35.seq - Primate sequence entries, part 35.
6382. gbpri36.seq - Primate sequence entries, part 36.
6383. gbpri37.seq - Primate sequence entries, part 37.
6384. gbpri38.seq - Primate sequence entries, part 38.
6385. gbpri39.seq - Primate sequence entries, part 39.
6386. gbpri4.seq - Primate sequence entries, part 4.
6387. gbpri40.seq - Primate sequence entries, part 40.
6388. gbpri41.seq - Primate sequence entries, part 41.
6389. gbpri42.seq - Primate sequence entries, part 42.
6390. gbpri43.seq - Primate sequence entries, part 43.
6391. gbpri44.seq - Primate sequence entries, part 44.
6392. gbpri45.seq - Primate sequence entries, part 45.
6393. gbpri46.seq - Primate sequence entries, part 46.
6394. gbpri47.seq - Primate sequence entries, part 47.
6395. gbpri48.seq - Primate sequence entries, part 48.
6396. gbpri49.seq - Primate sequence entries, part 49.
6397. gbpri5.seq - Primate sequence entries, part 5.
6398. gbpri50.seq - Primate sequence entries, part 50.
6399. gbpri51.seq - Primate sequence entries, part 51.
6400. gbpri52.seq - Primate sequence entries, part 52.
6401. gbpri53.seq - Primate sequence entries, part 53.
6402. gbpri54.seq - Primate sequence entries, part 54.
6403. gbpri55.seq - Primate sequence entries, part 55.
6404. gbpri56.seq - Primate sequence entries, part 56.
6405. gbpri57.seq - Primate sequence entries, part 57.
6406. gbpri58.seq - Primate sequence entries, part 58.
6407. gbpri6.seq - Primate sequence entries, part 6.
6408. gbpri7.seq - Primate sequence entries, part 7.
6409. gbpri8.seq - Primate sequence entries, part 8.
6410. gbpri9.seq - Primate sequence entries, part 9.
6411. gbrel.txt - Release notes (this document).
6412. gbrod1.seq - Rodent sequence entries, part 1.
6413. gbrod10.seq - Rodent sequence entries, part 10.
6414. gbrod100.seq - Rodent sequence entries, part 100.
6415. gbrod101.seq - Rodent sequence entries, part 101.
6416. gbrod102.seq - Rodent sequence entries, part 102.
6417. gbrod103.seq - Rodent sequence entries, part 103.
6418. gbrod104.seq - Rodent sequence entries, part 104.
6419. gbrod105.seq - Rodent sequence entries, part 105.
6420. gbrod106.seq - Rodent sequence entries, part 106.
6421. gbrod107.seq - Rodent sequence entries, part 107.
6422. gbrod108.seq - Rodent sequence entries, part 108.
6423. gbrod109.seq - Rodent sequence entries, part 109.
6424. gbrod11.seq - Rodent sequence entries, part 11.
6425. gbrod110.seq - Rodent sequence entries, part 110.
6426. gbrod111.seq - Rodent sequence entries, part 111.
6427. gbrod112.seq - Rodent sequence entries, part 112.
6428. gbrod113.seq - Rodent sequence entries, part 113.
6429. gbrod114.seq - Rodent sequence entries, part 114.
6430. gbrod115.seq - Rodent sequence entries, part 115.
6431. gbrod116.seq - Rodent sequence entries, part 116.
6432. gbrod117.seq - Rodent sequence entries, part 117.
6433. gbrod118.seq - Rodent sequence entries, part 118.
6434. gbrod119.seq - Rodent sequence entries, part 119.
6435. gbrod12.seq - Rodent sequence entries, part 12.
6436. gbrod120.seq - Rodent sequence entries, part 120.
6437. gbrod121.seq - Rodent sequence entries, part 121.
6438. gbrod122.seq - Rodent sequence entries, part 122.
6439. gbrod123.seq - Rodent sequence entries, part 123.
6440. gbrod124.seq - Rodent sequence entries, part 124.
6441. gbrod125.seq - Rodent sequence entries, part 125.
6442. gbrod126.seq - Rodent sequence entries, part 126.
6443. gbrod127.seq - Rodent sequence entries, part 127.
6444. gbrod128.seq - Rodent sequence entries, part 128.
6445. gbrod129.seq - Rodent sequence entries, part 129.
6446. gbrod13.seq - Rodent sequence entries, part 13.
6447. gbrod130.seq - Rodent sequence entries, part 130.
6448. gbrod131.seq - Rodent sequence entries, part 131.
6449. gbrod132.seq - Rodent sequence entries, part 132.
6450. gbrod133.seq - Rodent sequence entries, part 133.
6451. gbrod134.seq - Rodent sequence entries, part 134.
6452. gbrod135.seq - Rodent sequence entries, part 135.
6453. gbrod136.seq - Rodent sequence entries, part 136.
6454. gbrod137.seq - Rodent sequence entries, part 137.
6455. gbrod138.seq - Rodent sequence entries, part 138.
6456. gbrod139.seq - Rodent sequence entries, part 139.
6457. gbrod14.seq - Rodent sequence entries, part 14.
6458. gbrod140.seq - Rodent sequence entries, part 140.
6459. gbrod141.seq - Rodent sequence entries, part 141.
6460. gbrod142.seq - Rodent sequence entries, part 142.
6461. gbrod143.seq - Rodent sequence entries, part 143.
6462. gbrod144.seq - Rodent sequence entries, part 144.
6463. gbrod145.seq - Rodent sequence entries, part 145.
6464. gbrod146.seq - Rodent sequence entries, part 146.
6465. gbrod147.seq - Rodent sequence entries, part 147.
6466. gbrod148.seq - Rodent sequence entries, part 148.
6467. gbrod149.seq - Rodent sequence entries, part 149.
6468. gbrod15.seq - Rodent sequence entries, part 15.
6469. gbrod150.seq - Rodent sequence entries, part 150.
6470. gbrod151.seq - Rodent sequence entries, part 151.
6471. gbrod152.seq - Rodent sequence entries, part 152.
6472. gbrod153.seq - Rodent sequence entries, part 153.
6473. gbrod154.seq - Rodent sequence entries, part 154.
6474. gbrod155.seq - Rodent sequence entries, part 155.
6475. gbrod156.seq - Rodent sequence entries, part 156.
6476. gbrod157.seq - Rodent sequence entries, part 157.
6477. gbrod158.seq - Rodent sequence entries, part 158.
6478. gbrod159.seq - Rodent sequence entries, part 159.
6479. gbrod16.seq - Rodent sequence entries, part 16.
6480. gbrod160.seq - Rodent sequence entries, part 160.
6481. gbrod161.seq - Rodent sequence entries, part 161.
6482. gbrod162.seq - Rodent sequence entries, part 162.
6483. gbrod163.seq - Rodent sequence entries, part 163.
6484. gbrod164.seq - Rodent sequence entries, part 164.
6485. gbrod165.seq - Rodent sequence entries, part 165.
6486. gbrod166.seq - Rodent sequence entries, part 166.
6487. gbrod167.seq - Rodent sequence entries, part 167.
6488. gbrod168.seq - Rodent sequence entries, part 168.
6489. gbrod169.seq - Rodent sequence entries, part 169.
6490. gbrod17.seq - Rodent sequence entries, part 17.
6491. gbrod170.seq - Rodent sequence entries, part 170.
6492. gbrod171.seq - Rodent sequence entries, part 171.
6493. gbrod172.seq - Rodent sequence entries, part 172.
6494. gbrod173.seq - Rodent sequence entries, part 173.
6495. gbrod174.seq - Rodent sequence entries, part 174.
6496. gbrod175.seq - Rodent sequence entries, part 175.
6497. gbrod176.seq - Rodent sequence entries, part 176.
6498. gbrod177.seq - Rodent sequence entries, part 177.
6499. gbrod178.seq - Rodent sequence entries, part 178.
6500. gbrod179.seq - Rodent sequence entries, part 179.
6501. gbrod18.seq - Rodent sequence entries, part 18.
6502. gbrod180.seq - Rodent sequence entries, part 180.
6503. gbrod181.seq - Rodent sequence entries, part 181.
6504. gbrod182.seq - Rodent sequence entries, part 182.
6505. gbrod183.seq - Rodent sequence entries, part 183.
6506. gbrod184.seq - Rodent sequence entries, part 184.
6507. gbrod185.seq - Rodent sequence entries, part 185.
6508. gbrod186.seq - Rodent sequence entries, part 186.
6509. gbrod187.seq - Rodent sequence entries, part 187.
6510. gbrod188.seq - Rodent sequence entries, part 188.
6511. gbrod189.seq - Rodent sequence entries, part 189.
6512. gbrod19.seq - Rodent sequence entries, part 19.
6513. gbrod190.seq - Rodent sequence entries, part 190.
6514. gbrod191.seq - Rodent sequence entries, part 191.
6515. gbrod192.seq - Rodent sequence entries, part 192.
6516. gbrod193.seq - Rodent sequence entries, part 193.
6517. gbrod194.seq - Rodent sequence entries, part 194.
6518. gbrod195.seq - Rodent sequence entries, part 195.
6519. gbrod196.seq - Rodent sequence entries, part 196.
6520. gbrod197.seq - Rodent sequence entries, part 197.
6521. gbrod198.seq - Rodent sequence entries, part 198.
6522. gbrod199.seq - Rodent sequence entries, part 199.
6523. gbrod2.seq - Rodent sequence entries, part 2.
6524. gbrod20.seq - Rodent sequence entries, part 20.
6525. gbrod200.seq - Rodent sequence entries, part 200.
6526. gbrod201.seq - Rodent sequence entries, part 201.
6527. gbrod202.seq - Rodent sequence entries, part 202.
6528. gbrod203.seq - Rodent sequence entries, part 203.
6529. gbrod204.seq - Rodent sequence entries, part 204.
6530. gbrod205.seq - Rodent sequence entries, part 205.
6531. gbrod206.seq - Rodent sequence entries, part 206.
6532. gbrod207.seq - Rodent sequence entries, part 207.
6533. gbrod208.seq - Rodent sequence entries, part 208.
6534. gbrod209.seq - Rodent sequence entries, part 209.
6535. gbrod21.seq - Rodent sequence entries, part 21.
6536. gbrod210.seq - Rodent sequence entries, part 210.
6537. gbrod211.seq - Rodent sequence entries, part 211.
6538. gbrod212.seq - Rodent sequence entries, part 212.
6539. gbrod213.seq - Rodent sequence entries, part 213.
6540. gbrod214.seq - Rodent sequence entries, part 214.
6541. gbrod215.seq - Rodent sequence entries, part 215.
6542. gbrod216.seq - Rodent sequence entries, part 216.
6543. gbrod217.seq - Rodent sequence entries, part 217.
6544. gbrod218.seq - Rodent sequence entries, part 218.
6545. gbrod219.seq - Rodent sequence entries, part 219.
6546. gbrod22.seq - Rodent sequence entries, part 22.
6547. gbrod220.seq - Rodent sequence entries, part 220.
6548. gbrod221.seq - Rodent sequence entries, part 221.
6549. gbrod222.seq - Rodent sequence entries, part 222.
6550. gbrod223.seq - Rodent sequence entries, part 223.
6551. gbrod224.seq - Rodent sequence entries, part 224.
6552. gbrod225.seq - Rodent sequence entries, part 225.
6553. gbrod226.seq - Rodent sequence entries, part 226.
6554. gbrod227.seq - Rodent sequence entries, part 227.
6555. gbrod228.seq - Rodent sequence entries, part 228.
6556. gbrod229.seq - Rodent sequence entries, part 229.
6557. gbrod23.seq - Rodent sequence entries, part 23.
6558. gbrod230.seq - Rodent sequence entries, part 230.
6559. gbrod231.seq - Rodent sequence entries, part 231.
6560. gbrod232.seq - Rodent sequence entries, part 232.
6561. gbrod233.seq - Rodent sequence entries, part 233.
6562. gbrod234.seq - Rodent sequence entries, part 234.
6563. gbrod235.seq - Rodent sequence entries, part 235.
6564. gbrod236.seq - Rodent sequence entries, part 236.
6565. gbrod237.seq - Rodent sequence entries, part 237.
6566. gbrod238.seq - Rodent sequence entries, part 238.
6567. gbrod239.seq - Rodent sequence entries, part 239.
6568. gbrod24.seq - Rodent sequence entries, part 24.
6569. gbrod240.seq - Rodent sequence entries, part 240.
6570. gbrod241.seq - Rodent sequence entries, part 241.
6571. gbrod242.seq - Rodent sequence entries, part 242.
6572. gbrod243.seq - Rodent sequence entries, part 243.
6573. gbrod244.seq - Rodent sequence entries, part 244.
6574. gbrod245.seq - Rodent sequence entries, part 245.
6575. gbrod246.seq - Rodent sequence entries, part 246.
6576. gbrod247.seq - Rodent sequence entries, part 247.
6577. gbrod248.seq - Rodent sequence entries, part 248.
6578. gbrod249.seq - Rodent sequence entries, part 249.
6579. gbrod25.seq - Rodent sequence entries, part 25.
6580. gbrod250.seq - Rodent sequence entries, part 250.
6581. gbrod251.seq - Rodent sequence entries, part 251.
6582. gbrod252.seq - Rodent sequence entries, part 252.
6583. gbrod253.seq - Rodent sequence entries, part 253.
6584. gbrod254.seq - Rodent sequence entries, part 254.
6585. gbrod255.seq - Rodent sequence entries, part 255.
6586. gbrod256.seq - Rodent sequence entries, part 256.
6587. gbrod257.seq - Rodent sequence entries, part 257.
6588. gbrod258.seq - Rodent sequence entries, part 258.
6589. gbrod259.seq - Rodent sequence entries, part 259.
6590. gbrod26.seq - Rodent sequence entries, part 26.
6591. gbrod260.seq - Rodent sequence entries, part 260.
6592. gbrod261.seq - Rodent sequence entries, part 261.
6593. gbrod262.seq - Rodent sequence entries, part 262.
6594. gbrod263.seq - Rodent sequence entries, part 263.
6595. gbrod264.seq - Rodent sequence entries, part 264.
6596. gbrod265.seq - Rodent sequence entries, part 265.
6597. gbrod266.seq - Rodent sequence entries, part 266.
6598. gbrod267.seq - Rodent sequence entries, part 267.
6599. gbrod268.seq - Rodent sequence entries, part 268.
6600. gbrod269.seq - Rodent sequence entries, part 269.
6601. gbrod27.seq - Rodent sequence entries, part 27.
6602. gbrod270.seq - Rodent sequence entries, part 270.
6603. gbrod271.seq - Rodent sequence entries, part 271.
6604. gbrod272.seq - Rodent sequence entries, part 272.
6605. gbrod273.seq - Rodent sequence entries, part 273.
6606. gbrod274.seq - Rodent sequence entries, part 274.
6607. gbrod275.seq - Rodent sequence entries, part 275.
6608. gbrod276.seq - Rodent sequence entries, part 276.
6609. gbrod277.seq - Rodent sequence entries, part 277.
6610. gbrod278.seq - Rodent sequence entries, part 278.
6611. gbrod279.seq - Rodent sequence entries, part 279.
6612. gbrod28.seq - Rodent sequence entries, part 28.
6613. gbrod280.seq - Rodent sequence entries, part 280.
6614. gbrod281.seq - Rodent sequence entries, part 281.
6615. gbrod282.seq - Rodent sequence entries, part 282.
6616. gbrod283.seq - Rodent sequence entries, part 283.
6617. gbrod284.seq - Rodent sequence entries, part 284.
6618. gbrod285.seq - Rodent sequence entries, part 285.
6619. gbrod286.seq - Rodent sequence entries, part 286.
6620. gbrod287.seq - Rodent sequence entries, part 287.
6621. gbrod288.seq - Rodent sequence entries, part 288.
6622. gbrod289.seq - Rodent sequence entries, part 289.
6623. gbrod29.seq - Rodent sequence entries, part 29.
6624. gbrod290.seq - Rodent sequence entries, part 290.
6625. gbrod291.seq - Rodent sequence entries, part 291.
6626. gbrod292.seq - Rodent sequence entries, part 292.
6627. gbrod293.seq - Rodent sequence entries, part 293.
6628. gbrod294.seq - Rodent sequence entries, part 294.
6629. gbrod295.seq - Rodent sequence entries, part 295.
6630. gbrod296.seq - Rodent sequence entries, part 296.
6631. gbrod297.seq - Rodent sequence entries, part 297.
6632. gbrod298.seq - Rodent sequence entries, part 298.
6633. gbrod299.seq - Rodent sequence entries, part 299.
6634. gbrod3.seq - Rodent sequence entries, part 3.
6635. gbrod30.seq - Rodent sequence entries, part 30.
6636. gbrod300.seq - Rodent sequence entries, part 300.
6637. gbrod301.seq - Rodent sequence entries, part 301.
6638. gbrod302.seq - Rodent sequence entries, part 302.
6639. gbrod303.seq - Rodent sequence entries, part 303.
6640. gbrod304.seq - Rodent sequence entries, part 304.
6641. gbrod305.seq - Rodent sequence entries, part 305.
6642. gbrod306.seq - Rodent sequence entries, part 306.
6643. gbrod307.seq - Rodent sequence entries, part 307.
6644. gbrod308.seq - Rodent sequence entries, part 308.
6645. gbrod309.seq - Rodent sequence entries, part 309.
6646. gbrod31.seq - Rodent sequence entries, part 31.
6647. gbrod310.seq - Rodent sequence entries, part 310.
6648. gbrod311.seq - Rodent sequence entries, part 311.
6649. gbrod312.seq - Rodent sequence entries, part 312.
6650. gbrod313.seq - Rodent sequence entries, part 313.
6651. gbrod314.seq - Rodent sequence entries, part 314.
6652. gbrod32.seq - Rodent sequence entries, part 32.
6653. gbrod33.seq - Rodent sequence entries, part 33.
6654. gbrod34.seq - Rodent sequence entries, part 34.
6655. gbrod35.seq - Rodent sequence entries, part 35.
6656. gbrod36.seq - Rodent sequence entries, part 36.
6657. gbrod37.seq - Rodent sequence entries, part 37.
6658. gbrod38.seq - Rodent sequence entries, part 38.
6659. gbrod39.seq - Rodent sequence entries, part 39.
6660. gbrod4.seq - Rodent sequence entries, part 4.
6661. gbrod40.seq - Rodent sequence entries, part 40.
6662. gbrod41.seq - Rodent sequence entries, part 41.
6663. gbrod42.seq - Rodent sequence entries, part 42.
6664. gbrod43.seq - Rodent sequence entries, part 43.
6665. gbrod44.seq - Rodent sequence entries, part 44.
6666. gbrod45.seq - Rodent sequence entries, part 45.
6667. gbrod46.seq - Rodent sequence entries, part 46.
6668. gbrod47.seq - Rodent sequence entries, part 47.
6669. gbrod48.seq - Rodent sequence entries, part 48.
6670. gbrod49.seq - Rodent sequence entries, part 49.
6671. gbrod5.seq - Rodent sequence entries, part 5.
6672. gbrod50.seq - Rodent sequence entries, part 50.
6673. gbrod51.seq - Rodent sequence entries, part 51.
6674. gbrod52.seq - Rodent sequence entries, part 52.
6675. gbrod53.seq - Rodent sequence entries, part 53.
6676. gbrod54.seq - Rodent sequence entries, part 54.
6677. gbrod55.seq - Rodent sequence entries, part 55.
6678. gbrod56.seq - Rodent sequence entries, part 56.
6679. gbrod57.seq - Rodent sequence entries, part 57.
6680. gbrod58.seq - Rodent sequence entries, part 58.
6681. gbrod59.seq - Rodent sequence entries, part 59.
6682. gbrod6.seq - Rodent sequence entries, part 6.
6683. gbrod60.seq - Rodent sequence entries, part 60.
6684. gbrod61.seq - Rodent sequence entries, part 61.
6685. gbrod62.seq - Rodent sequence entries, part 62.
6686. gbrod63.seq - Rodent sequence entries, part 63.
6687. gbrod64.seq - Rodent sequence entries, part 64.
6688. gbrod65.seq - Rodent sequence entries, part 65.
6689. gbrod66.seq - Rodent sequence entries, part 66.
6690. gbrod67.seq - Rodent sequence entries, part 67.
6691. gbrod68.seq - Rodent sequence entries, part 68.
6692. gbrod69.seq - Rodent sequence entries, part 69.
6693. gbrod7.seq - Rodent sequence entries, part 7.
6694. gbrod70.seq - Rodent sequence entries, part 70.
6695. gbrod71.seq - Rodent sequence entries, part 71.
6696. gbrod72.seq - Rodent sequence entries, part 72.
6697. gbrod73.seq - Rodent sequence entries, part 73.
6698. gbrod74.seq - Rodent sequence entries, part 74.
6699. gbrod75.seq - Rodent sequence entries, part 75.
6700. gbrod76.seq - Rodent sequence entries, part 76.
6701. gbrod77.seq - Rodent sequence entries, part 77.
6702. gbrod78.seq - Rodent sequence entries, part 78.
6703. gbrod79.seq - Rodent sequence entries, part 79.
6704. gbrod8.seq - Rodent sequence entries, part 8.
6705. gbrod80.seq - Rodent sequence entries, part 80.
6706. gbrod81.seq - Rodent sequence entries, part 81.
6707. gbrod82.seq - Rodent sequence entries, part 82.
6708. gbrod83.seq - Rodent sequence entries, part 83.
6709. gbrod84.seq - Rodent sequence entries, part 84.
6710. gbrod85.seq - Rodent sequence entries, part 85.
6711. gbrod86.seq - Rodent sequence entries, part 86.
6712. gbrod87.seq - Rodent sequence entries, part 87.
6713. gbrod88.seq - Rodent sequence entries, part 88.
6714. gbrod89.seq - Rodent sequence entries, part 89.
6715. gbrod9.seq - Rodent sequence entries, part 9.
6716. gbrod90.seq - Rodent sequence entries, part 90.
6717. gbrod91.seq - Rodent sequence entries, part 91.
6718. gbrod92.seq - Rodent sequence entries, part 92.
6719. gbrod93.seq - Rodent sequence entries, part 93.
6720. gbrod94.seq - Rodent sequence entries, part 94.
6721. gbrod95.seq - Rodent sequence entries, part 95.
6722. gbrod96.seq - Rodent sequence entries, part 96.
6723. gbrod97.seq - Rodent sequence entries, part 97.
6724. gbrod98.seq - Rodent sequence entries, part 98.
6725. gbrod99.seq - Rodent sequence entries, part 99.
6726. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
6727. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
6728. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
6729. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
6730. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
6731. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
6732. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
6733. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
6734. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
6735. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
6736. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
6737. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
6738. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
6739. gbsyn11.seq - Synthetic and chimeric sequence entries, part 11.
6740. gbsyn12.seq - Synthetic and chimeric sequence entries, part 12.
6741. gbsyn13.seq - Synthetic and chimeric sequence entries, part 13.
6742. gbsyn14.seq - Synthetic and chimeric sequence entries, part 14.
6743. gbsyn15.seq - Synthetic and chimeric sequence entries, part 15.
6744. gbsyn16.seq - Synthetic and chimeric sequence entries, part 16.
6745. gbsyn17.seq - Synthetic and chimeric sequence entries, part 17.
6746. gbsyn18.seq - Synthetic and chimeric sequence entries, part 18.
6747. gbsyn19.seq - Synthetic and chimeric sequence entries, part 19.
6748. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
6749. gbsyn20.seq - Synthetic and chimeric sequence entries, part 20.
6750. gbsyn21.seq - Synthetic and chimeric sequence entries, part 21.
6751. gbsyn22.seq - Synthetic and chimeric sequence entries, part 22.
6752. gbsyn23.seq - Synthetic and chimeric sequence entries, part 23.
6753. gbsyn24.seq - Synthetic and chimeric sequence entries, part 24.
6754. gbsyn25.seq - Synthetic and chimeric sequence entries, part 25.
6755. gbsyn26.seq - Synthetic and chimeric sequence entries, part 26.
6756. gbsyn27.seq - Synthetic and chimeric sequence entries, part 27.
6757. gbsyn28.seq - Synthetic and chimeric sequence entries, part 28.
6758. gbsyn29.seq - Synthetic and chimeric sequence entries, part 29.
6759. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
6760. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
6761. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
6762. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
6763. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
6764. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
6765. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
6766. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
6767. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
6768. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
6769. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
6770. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
6771. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
6772. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
6773. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
6774. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
6775. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
6776. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
6777. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
6778. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
6779. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
6780. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
6781. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
6782. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
6783. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
6784. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
6785. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
6786. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
6787. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
6788. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
6789. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
6790. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
6791. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
6792. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
6793. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
6794. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
6795. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
6796. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
6797. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
6798. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
6799. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
6800. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
6801. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
6802. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
6803. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
6804. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
6805. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
6806. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
6807. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
6808. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
6809. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
6810. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
6811. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
6812. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
6813. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
6814. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
6815. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
6816. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
6817. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
6818. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
6819. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
6820. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
6821. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
6822. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
6823. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
6824. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
6825. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
6826. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
6827. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
6828. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
6829. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
6830. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
6831. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
6832. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
6833. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
6834. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
6835. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
6836. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
6837. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
6838. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
6839. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
6840. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
6841. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
6842. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
6843. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
6844. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
6845. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
6846. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
6847. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
6848. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
6849. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
6850. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
6851. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
6852. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
6853. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
6854. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
6855. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
6856. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
6857. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
6858. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
6859. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
6860. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
6861. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
6862. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
6863. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
6864. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
6865. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
6866. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
6867. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
6868. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
6869. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
6870. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
6871. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
6872. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
6873. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
6874. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
6875. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
6876. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
6877. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
6878. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
6879. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
6880. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
6881. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
6882. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
6883. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
6884. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
6885. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
6886. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
6887. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
6888. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
6889. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
6890. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
6891. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
6892. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
6893. gbuna1.seq - Unannotated sequence entries, part 1.
6894. gbvrl1.seq - Viral sequence entries, part 1.
6895. gbvrl10.seq - Viral sequence entries, part 10.
6896. gbvrl100.seq - Viral sequence entries, part 100.
6897. gbvrl1000.seq - Viral sequence entries, part 1000.
6898. gbvrl1001.seq - Viral sequence entries, part 1001.
6899. gbvrl1002.seq - Viral sequence entries, part 1002.
6900. gbvrl1003.seq - Viral sequence entries, part 1003.
6901. gbvrl1004.seq - Viral sequence entries, part 1004.
6902. gbvrl1005.seq - Viral sequence entries, part 1005.
6903. gbvrl1006.seq - Viral sequence entries, part 1006.
6904. gbvrl1007.seq - Viral sequence entries, part 1007.
6905. gbvrl1008.seq - Viral sequence entries, part 1008.
6906. gbvrl1009.seq - Viral sequence entries, part 1009.
6907. gbvrl101.seq - Viral sequence entries, part 101.
6908. gbvrl1010.seq - Viral sequence entries, part 1010.
6909. gbvrl1011.seq - Viral sequence entries, part 1011.
6910. gbvrl1012.seq - Viral sequence entries, part 1012.
6911. gbvrl1013.seq - Viral sequence entries, part 1013.
6912. gbvrl1014.seq - Viral sequence entries, part 1014.
6913. gbvrl1015.seq - Viral sequence entries, part 1015.
6914. gbvrl1016.seq - Viral sequence entries, part 1016.
6915. gbvrl1017.seq - Viral sequence entries, part 1017.
6916. gbvrl1018.seq - Viral sequence entries, part 1018.
6917. gbvrl1019.seq - Viral sequence entries, part 1019.
6918. gbvrl102.seq - Viral sequence entries, part 102.
6919. gbvrl1020.seq - Viral sequence entries, part 1020.
6920. gbvrl1021.seq - Viral sequence entries, part 1021.
6921. gbvrl1022.seq - Viral sequence entries, part 1022.
6922. gbvrl1023.seq - Viral sequence entries, part 1023.
6923. gbvrl1024.seq - Viral sequence entries, part 1024.
6924. gbvrl1025.seq - Viral sequence entries, part 1025.
6925. gbvrl1026.seq - Viral sequence entries, part 1026.
6926. gbvrl1027.seq - Viral sequence entries, part 1027.
6927. gbvrl1028.seq - Viral sequence entries, part 1028.
6928. gbvrl1029.seq - Viral sequence entries, part 1029.
6929. gbvrl103.seq - Viral sequence entries, part 103.
6930. gbvrl1030.seq - Viral sequence entries, part 1030.
6931. gbvrl1031.seq - Viral sequence entries, part 1031.
6932. gbvrl1032.seq - Viral sequence entries, part 1032.
6933. gbvrl1033.seq - Viral sequence entries, part 1033.
6934. gbvrl1034.seq - Viral sequence entries, part 1034.
6935. gbvrl1035.seq - Viral sequence entries, part 1035.
6936. gbvrl1036.seq - Viral sequence entries, part 1036.
6937. gbvrl1037.seq - Viral sequence entries, part 1037.
6938. gbvrl104.seq - Viral sequence entries, part 104.
6939. gbvrl105.seq - Viral sequence entries, part 105.
6940. gbvrl106.seq - Viral sequence entries, part 106.
6941. gbvrl107.seq - Viral sequence entries, part 107.
6942. gbvrl108.seq - Viral sequence entries, part 108.
6943. gbvrl109.seq - Viral sequence entries, part 109.
6944. gbvrl11.seq - Viral sequence entries, part 11.
6945. gbvrl110.seq - Viral sequence entries, part 110.
6946. gbvrl111.seq - Viral sequence entries, part 111.
6947. gbvrl112.seq - Viral sequence entries, part 112.
6948. gbvrl113.seq - Viral sequence entries, part 113.
6949. gbvrl114.seq - Viral sequence entries, part 114.
6950. gbvrl115.seq - Viral sequence entries, part 115.
6951. gbvrl116.seq - Viral sequence entries, part 116.
6952. gbvrl117.seq - Viral sequence entries, part 117.
6953. gbvrl118.seq - Viral sequence entries, part 118.
6954. gbvrl119.seq - Viral sequence entries, part 119.
6955. gbvrl12.seq - Viral sequence entries, part 12.
6956. gbvrl120.seq - Viral sequence entries, part 120.
6957. gbvrl121.seq - Viral sequence entries, part 121.
6958. gbvrl122.seq - Viral sequence entries, part 122.
6959. gbvrl123.seq - Viral sequence entries, part 123.
6960. gbvrl124.seq - Viral sequence entries, part 124.
6961. gbvrl125.seq - Viral sequence entries, part 125.
6962. gbvrl126.seq - Viral sequence entries, part 126.
6963. gbvrl127.seq - Viral sequence entries, part 127.
6964. gbvrl128.seq - Viral sequence entries, part 128.
6965. gbvrl129.seq - Viral sequence entries, part 129.
6966. gbvrl13.seq - Viral sequence entries, part 13.
6967. gbvrl130.seq - Viral sequence entries, part 130.
6968. gbvrl131.seq - Viral sequence entries, part 131.
6969. gbvrl132.seq - Viral sequence entries, part 132.
6970. gbvrl133.seq - Viral sequence entries, part 133.
6971. gbvrl134.seq - Viral sequence entries, part 134.
6972. gbvrl135.seq - Viral sequence entries, part 135.
6973. gbvrl136.seq - Viral sequence entries, part 136.
6974. gbvrl137.seq - Viral sequence entries, part 137.
6975. gbvrl138.seq - Viral sequence entries, part 138.
6976. gbvrl139.seq - Viral sequence entries, part 139.
6977. gbvrl14.seq - Viral sequence entries, part 14.
6978. gbvrl140.seq - Viral sequence entries, part 140.
6979. gbvrl141.seq - Viral sequence entries, part 141.
6980. gbvrl142.seq - Viral sequence entries, part 142.
6981. gbvrl143.seq - Viral sequence entries, part 143.
6982. gbvrl144.seq - Viral sequence entries, part 144.
6983. gbvrl145.seq - Viral sequence entries, part 145.
6984. gbvrl146.seq - Viral sequence entries, part 146.
6985. gbvrl147.seq - Viral sequence entries, part 147.
6986. gbvrl148.seq - Viral sequence entries, part 148.
6987. gbvrl149.seq - Viral sequence entries, part 149.
6988. gbvrl15.seq - Viral sequence entries, part 15.
6989. gbvrl150.seq - Viral sequence entries, part 150.
6990. gbvrl151.seq - Viral sequence entries, part 151.
6991. gbvrl152.seq - Viral sequence entries, part 152.
6992. gbvrl153.seq - Viral sequence entries, part 153.
6993. gbvrl154.seq - Viral sequence entries, part 154.
6994. gbvrl155.seq - Viral sequence entries, part 155.
6995. gbvrl156.seq - Viral sequence entries, part 156.
6996. gbvrl157.seq - Viral sequence entries, part 157.
6997. gbvrl158.seq - Viral sequence entries, part 158.
6998. gbvrl159.seq - Viral sequence entries, part 159.
6999. gbvrl16.seq - Viral sequence entries, part 16.
7000. gbvrl160.seq - Viral sequence entries, part 160.
7001. gbvrl161.seq - Viral sequence entries, part 161.
7002. gbvrl162.seq - Viral sequence entries, part 162.
7003. gbvrl163.seq - Viral sequence entries, part 163.
7004. gbvrl164.seq - Viral sequence entries, part 164.
7005. gbvrl165.seq - Viral sequence entries, part 165.
7006. gbvrl166.seq - Viral sequence entries, part 166.
7007. gbvrl167.seq - Viral sequence entries, part 167.
7008. gbvrl168.seq - Viral sequence entries, part 168.
7009. gbvrl169.seq - Viral sequence entries, part 169.
7010. gbvrl17.seq - Viral sequence entries, part 17.
7011. gbvrl170.seq - Viral sequence entries, part 170.
7012. gbvrl171.seq - Viral sequence entries, part 171.
7013. gbvrl172.seq - Viral sequence entries, part 172.
7014. gbvrl173.seq - Viral sequence entries, part 173.
7015. gbvrl174.seq - Viral sequence entries, part 174.
7016. gbvrl175.seq - Viral sequence entries, part 175.
7017. gbvrl176.seq - Viral sequence entries, part 176.
7018. gbvrl177.seq - Viral sequence entries, part 177.
7019. gbvrl178.seq - Viral sequence entries, part 178.
7020. gbvrl179.seq - Viral sequence entries, part 179.
7021. gbvrl18.seq - Viral sequence entries, part 18.
7022. gbvrl180.seq - Viral sequence entries, part 180.
7023. gbvrl181.seq - Viral sequence entries, part 181.
7024. gbvrl182.seq - Viral sequence entries, part 182.
7025. gbvrl183.seq - Viral sequence entries, part 183.
7026. gbvrl184.seq - Viral sequence entries, part 184.
7027. gbvrl185.seq - Viral sequence entries, part 185.
7028. gbvrl186.seq - Viral sequence entries, part 186.
7029. gbvrl187.seq - Viral sequence entries, part 187.
7030. gbvrl188.seq - Viral sequence entries, part 188.
7031. gbvrl189.seq - Viral sequence entries, part 189.
7032. gbvrl19.seq - Viral sequence entries, part 19.
7033. gbvrl190.seq - Viral sequence entries, part 190.
7034. gbvrl191.seq - Viral sequence entries, part 191.
7035. gbvrl192.seq - Viral sequence entries, part 192.
7036. gbvrl193.seq - Viral sequence entries, part 193.
7037. gbvrl194.seq - Viral sequence entries, part 194.
7038. gbvrl195.seq - Viral sequence entries, part 195.
7039. gbvrl196.seq - Viral sequence entries, part 196.
7040. gbvrl197.seq - Viral sequence entries, part 197.
7041. gbvrl198.seq - Viral sequence entries, part 198.
7042. gbvrl199.seq - Viral sequence entries, part 199.
7043. gbvrl2.seq - Viral sequence entries, part 2.
7044. gbvrl20.seq - Viral sequence entries, part 20.
7045. gbvrl200.seq - Viral sequence entries, part 200.
7046. gbvrl201.seq - Viral sequence entries, part 201.
7047. gbvrl202.seq - Viral sequence entries, part 202.
7048. gbvrl203.seq - Viral sequence entries, part 203.
7049. gbvrl204.seq - Viral sequence entries, part 204.
7050. gbvrl205.seq - Viral sequence entries, part 205.
7051. gbvrl206.seq - Viral sequence entries, part 206.
7052. gbvrl207.seq - Viral sequence entries, part 207.
7053. gbvrl208.seq - Viral sequence entries, part 208.
7054. gbvrl209.seq - Viral sequence entries, part 209.
7055. gbvrl21.seq - Viral sequence entries, part 21.
7056. gbvrl210.seq - Viral sequence entries, part 210.
7057. gbvrl211.seq - Viral sequence entries, part 211.
7058. gbvrl212.seq - Viral sequence entries, part 212.
7059. gbvrl213.seq - Viral sequence entries, part 213.
7060. gbvrl214.seq - Viral sequence entries, part 214.
7061. gbvrl215.seq - Viral sequence entries, part 215.
7062. gbvrl216.seq - Viral sequence entries, part 216.
7063. gbvrl217.seq - Viral sequence entries, part 217.
7064. gbvrl218.seq - Viral sequence entries, part 218.
7065. gbvrl219.seq - Viral sequence entries, part 219.
7066. gbvrl22.seq - Viral sequence entries, part 22.
7067. gbvrl220.seq - Viral sequence entries, part 220.
7068. gbvrl221.seq - Viral sequence entries, part 221.
7069. gbvrl222.seq - Viral sequence entries, part 222.
7070. gbvrl223.seq - Viral sequence entries, part 223.
7071. gbvrl224.seq - Viral sequence entries, part 224.
7072. gbvrl225.seq - Viral sequence entries, part 225.
7073. gbvrl226.seq - Viral sequence entries, part 226.
7074. gbvrl227.seq - Viral sequence entries, part 227.
7075. gbvrl228.seq - Viral sequence entries, part 228.
7076. gbvrl229.seq - Viral sequence entries, part 229.
7077. gbvrl23.seq - Viral sequence entries, part 23.
7078. gbvrl230.seq - Viral sequence entries, part 230.
7079. gbvrl231.seq - Viral sequence entries, part 231.
7080. gbvrl232.seq - Viral sequence entries, part 232.
7081. gbvrl233.seq - Viral sequence entries, part 233.
7082. gbvrl234.seq - Viral sequence entries, part 234.
7083. gbvrl235.seq - Viral sequence entries, part 235.
7084. gbvrl236.seq - Viral sequence entries, part 236.
7085. gbvrl237.seq - Viral sequence entries, part 237.
7086. gbvrl238.seq - Viral sequence entries, part 238.
7087. gbvrl239.seq - Viral sequence entries, part 239.
7088. gbvrl24.seq - Viral sequence entries, part 24.
7089. gbvrl240.seq - Viral sequence entries, part 240.
7090. gbvrl241.seq - Viral sequence entries, part 241.
7091. gbvrl242.seq - Viral sequence entries, part 242.
7092. gbvrl243.seq - Viral sequence entries, part 243.
7093. gbvrl244.seq - Viral sequence entries, part 244.
7094. gbvrl245.seq - Viral sequence entries, part 245.
7095. gbvrl246.seq - Viral sequence entries, part 246.
7096. gbvrl247.seq - Viral sequence entries, part 247.
7097. gbvrl248.seq - Viral sequence entries, part 248.
7098. gbvrl249.seq - Viral sequence entries, part 249.
7099. gbvrl25.seq - Viral sequence entries, part 25.
7100. gbvrl250.seq - Viral sequence entries, part 250.
7101. gbvrl251.seq - Viral sequence entries, part 251.
7102. gbvrl252.seq - Viral sequence entries, part 252.
7103. gbvrl253.seq - Viral sequence entries, part 253.
7104. gbvrl254.seq - Viral sequence entries, part 254.
7105. gbvrl255.seq - Viral sequence entries, part 255.
7106. gbvrl256.seq - Viral sequence entries, part 256.
7107. gbvrl257.seq - Viral sequence entries, part 257.
7108. gbvrl258.seq - Viral sequence entries, part 258.
7109. gbvrl259.seq - Viral sequence entries, part 259.
7110. gbvrl26.seq - Viral sequence entries, part 26.
7111. gbvrl260.seq - Viral sequence entries, part 260.
7112. gbvrl261.seq - Viral sequence entries, part 261.
7113. gbvrl262.seq - Viral sequence entries, part 262.
7114. gbvrl263.seq - Viral sequence entries, part 263.
7115. gbvrl264.seq - Viral sequence entries, part 264.
7116. gbvrl265.seq - Viral sequence entries, part 265.
7117. gbvrl266.seq - Viral sequence entries, part 266.
7118. gbvrl267.seq - Viral sequence entries, part 267.
7119. gbvrl268.seq - Viral sequence entries, part 268.
7120. gbvrl269.seq - Viral sequence entries, part 269.
7121. gbvrl27.seq - Viral sequence entries, part 27.
7122. gbvrl270.seq - Viral sequence entries, part 270.
7123. gbvrl271.seq - Viral sequence entries, part 271.
7124. gbvrl272.seq - Viral sequence entries, part 272.
7125. gbvrl273.seq - Viral sequence entries, part 273.
7126. gbvrl274.seq - Viral sequence entries, part 274.
7127. gbvrl275.seq - Viral sequence entries, part 275.
7128. gbvrl276.seq - Viral sequence entries, part 276.
7129. gbvrl277.seq - Viral sequence entries, part 277.
7130. gbvrl278.seq - Viral sequence entries, part 278.
7131. gbvrl279.seq - Viral sequence entries, part 279.
7132. gbvrl28.seq - Viral sequence entries, part 28.
7133. gbvrl280.seq - Viral sequence entries, part 280.
7134. gbvrl281.seq - Viral sequence entries, part 281.
7135. gbvrl282.seq - Viral sequence entries, part 282.
7136. gbvrl283.seq - Viral sequence entries, part 283.
7137. gbvrl284.seq - Viral sequence entries, part 284.
7138. gbvrl285.seq - Viral sequence entries, part 285.
7139. gbvrl286.seq - Viral sequence entries, part 286.
7140. gbvrl287.seq - Viral sequence entries, part 287.
7141. gbvrl288.seq - Viral sequence entries, part 288.
7142. gbvrl289.seq - Viral sequence entries, part 289.
7143. gbvrl29.seq - Viral sequence entries, part 29.
7144. gbvrl290.seq - Viral sequence entries, part 290.
7145. gbvrl291.seq - Viral sequence entries, part 291.
7146. gbvrl292.seq - Viral sequence entries, part 292.
7147. gbvrl293.seq - Viral sequence entries, part 293.
7148. gbvrl294.seq - Viral sequence entries, part 294.
7149. gbvrl295.seq - Viral sequence entries, part 295.
7150. gbvrl296.seq - Viral sequence entries, part 296.
7151. gbvrl297.seq - Viral sequence entries, part 297.
7152. gbvrl298.seq - Viral sequence entries, part 298.
7153. gbvrl299.seq - Viral sequence entries, part 299.
7154. gbvrl3.seq - Viral sequence entries, part 3.
7155. gbvrl30.seq - Viral sequence entries, part 30.
7156. gbvrl300.seq - Viral sequence entries, part 300.
7157. gbvrl301.seq - Viral sequence entries, part 301.
7158. gbvrl302.seq - Viral sequence entries, part 302.
7159. gbvrl303.seq - Viral sequence entries, part 303.
7160. gbvrl304.seq - Viral sequence entries, part 304.
7161. gbvrl305.seq - Viral sequence entries, part 305.
7162. gbvrl306.seq - Viral sequence entries, part 306.
7163. gbvrl307.seq - Viral sequence entries, part 307.
7164. gbvrl308.seq - Viral sequence entries, part 308.
7165. gbvrl309.seq - Viral sequence entries, part 309.
7166. gbvrl31.seq - Viral sequence entries, part 31.
7167. gbvrl310.seq - Viral sequence entries, part 310.
7168. gbvrl311.seq - Viral sequence entries, part 311.
7169. gbvrl312.seq - Viral sequence entries, part 312.
7170. gbvrl313.seq - Viral sequence entries, part 313.
7171. gbvrl314.seq - Viral sequence entries, part 314.
7172. gbvrl315.seq - Viral sequence entries, part 315.
7173. gbvrl316.seq - Viral sequence entries, part 316.
7174. gbvrl317.seq - Viral sequence entries, part 317.
7175. gbvrl318.seq - Viral sequence entries, part 318.
7176. gbvrl319.seq - Viral sequence entries, part 319.
7177. gbvrl32.seq - Viral sequence entries, part 32.
7178. gbvrl320.seq - Viral sequence entries, part 320.
7179. gbvrl321.seq - Viral sequence entries, part 321.
7180. gbvrl322.seq - Viral sequence entries, part 322.
7181. gbvrl323.seq - Viral sequence entries, part 323.
7182. gbvrl324.seq - Viral sequence entries, part 324.
7183. gbvrl325.seq - Viral sequence entries, part 325.
7184. gbvrl326.seq - Viral sequence entries, part 326.
7185. gbvrl327.seq - Viral sequence entries, part 327.
7186. gbvrl328.seq - Viral sequence entries, part 328.
7187. gbvrl329.seq - Viral sequence entries, part 329.
7188. gbvrl33.seq - Viral sequence entries, part 33.
7189. gbvrl330.seq - Viral sequence entries, part 330.
7190. gbvrl331.seq - Viral sequence entries, part 331.
7191. gbvrl332.seq - Viral sequence entries, part 332.
7192. gbvrl333.seq - Viral sequence entries, part 333.
7193. gbvrl334.seq - Viral sequence entries, part 334.
7194. gbvrl335.seq - Viral sequence entries, part 335.
7195. gbvrl336.seq - Viral sequence entries, part 336.
7196. gbvrl337.seq - Viral sequence entries, part 337.
7197. gbvrl338.seq - Viral sequence entries, part 338.
7198. gbvrl339.seq - Viral sequence entries, part 339.
7199. gbvrl34.seq - Viral sequence entries, part 34.
7200. gbvrl340.seq - Viral sequence entries, part 340.
7201. gbvrl341.seq - Viral sequence entries, part 341.
7202. gbvrl342.seq - Viral sequence entries, part 342.
7203. gbvrl343.seq - Viral sequence entries, part 343.
7204. gbvrl344.seq - Viral sequence entries, part 344.
7205. gbvrl345.seq - Viral sequence entries, part 345.
7206. gbvrl346.seq - Viral sequence entries, part 346.
7207. gbvrl347.seq - Viral sequence entries, part 347.
7208. gbvrl348.seq - Viral sequence entries, part 348.
7209. gbvrl349.seq - Viral sequence entries, part 349.
7210. gbvrl35.seq - Viral sequence entries, part 35.
7211. gbvrl350.seq - Viral sequence entries, part 350.
7212. gbvrl351.seq - Viral sequence entries, part 351.
7213. gbvrl352.seq - Viral sequence entries, part 352.
7214. gbvrl353.seq - Viral sequence entries, part 353.
7215. gbvrl354.seq - Viral sequence entries, part 354.
7216. gbvrl355.seq - Viral sequence entries, part 355.
7217. gbvrl356.seq - Viral sequence entries, part 356.
7218. gbvrl357.seq - Viral sequence entries, part 357.
7219. gbvrl358.seq - Viral sequence entries, part 358.
7220. gbvrl359.seq - Viral sequence entries, part 359.
7221. gbvrl36.seq - Viral sequence entries, part 36.
7222. gbvrl360.seq - Viral sequence entries, part 360.
7223. gbvrl361.seq - Viral sequence entries, part 361.
7224. gbvrl362.seq - Viral sequence entries, part 362.
7225. gbvrl363.seq - Viral sequence entries, part 363.
7226. gbvrl364.seq - Viral sequence entries, part 364.
7227. gbvrl365.seq - Viral sequence entries, part 365.
7228. gbvrl366.seq - Viral sequence entries, part 366.
7229. gbvrl367.seq - Viral sequence entries, part 367.
7230. gbvrl368.seq - Viral sequence entries, part 368.
7231. gbvrl369.seq - Viral sequence entries, part 369.
7232. gbvrl37.seq - Viral sequence entries, part 37.
7233. gbvrl370.seq - Viral sequence entries, part 370.
7234. gbvrl371.seq - Viral sequence entries, part 371.
7235. gbvrl372.seq - Viral sequence entries, part 372.
7236. gbvrl373.seq - Viral sequence entries, part 373.
7237. gbvrl374.seq - Viral sequence entries, part 374.
7238. gbvrl375.seq - Viral sequence entries, part 375.
7239. gbvrl376.seq - Viral sequence entries, part 376.
7240. gbvrl377.seq - Viral sequence entries, part 377.
7241. gbvrl378.seq - Viral sequence entries, part 378.
7242. gbvrl379.seq - Viral sequence entries, part 379.
7243. gbvrl38.seq - Viral sequence entries, part 38.
7244. gbvrl380.seq - Viral sequence entries, part 380.
7245. gbvrl381.seq - Viral sequence entries, part 381.
7246. gbvrl382.seq - Viral sequence entries, part 382.
7247. gbvrl383.seq - Viral sequence entries, part 383.
7248. gbvrl384.seq - Viral sequence entries, part 384.
7249. gbvrl385.seq - Viral sequence entries, part 385.
7250. gbvrl386.seq - Viral sequence entries, part 386.
7251. gbvrl387.seq - Viral sequence entries, part 387.
7252. gbvrl388.seq - Viral sequence entries, part 388.
7253. gbvrl389.seq - Viral sequence entries, part 389.
7254. gbvrl39.seq - Viral sequence entries, part 39.
7255. gbvrl390.seq - Viral sequence entries, part 390.
7256. gbvrl391.seq - Viral sequence entries, part 391.
7257. gbvrl392.seq - Viral sequence entries, part 392.
7258. gbvrl393.seq - Viral sequence entries, part 393.
7259. gbvrl394.seq - Viral sequence entries, part 394.
7260. gbvrl395.seq - Viral sequence entries, part 395.
7261. gbvrl396.seq - Viral sequence entries, part 396.
7262. gbvrl397.seq - Viral sequence entries, part 397.
7263. gbvrl398.seq - Viral sequence entries, part 398.
7264. gbvrl399.seq - Viral sequence entries, part 399.
7265. gbvrl4.seq - Viral sequence entries, part 4.
7266. gbvrl40.seq - Viral sequence entries, part 40.
7267. gbvrl400.seq - Viral sequence entries, part 400.
7268. gbvrl401.seq - Viral sequence entries, part 401.
7269. gbvrl402.seq - Viral sequence entries, part 402.
7270. gbvrl403.seq - Viral sequence entries, part 403.
7271. gbvrl404.seq - Viral sequence entries, part 404.
7272. gbvrl405.seq - Viral sequence entries, part 405.
7273. gbvrl406.seq - Viral sequence entries, part 406.
7274. gbvrl407.seq - Viral sequence entries, part 407.
7275. gbvrl408.seq - Viral sequence entries, part 408.
7276. gbvrl409.seq - Viral sequence entries, part 409.
7277. gbvrl41.seq - Viral sequence entries, part 41.
7278. gbvrl410.seq - Viral sequence entries, part 410.
7279. gbvrl411.seq - Viral sequence entries, part 411.
7280. gbvrl412.seq - Viral sequence entries, part 412.
7281. gbvrl413.seq - Viral sequence entries, part 413.
7282. gbvrl414.seq - Viral sequence entries, part 414.
7283. gbvrl415.seq - Viral sequence entries, part 415.
7284. gbvrl416.seq - Viral sequence entries, part 416.
7285. gbvrl417.seq - Viral sequence entries, part 417.
7286. gbvrl418.seq - Viral sequence entries, part 418.
7287. gbvrl419.seq - Viral sequence entries, part 419.
7288. gbvrl42.seq - Viral sequence entries, part 42.
7289. gbvrl420.seq - Viral sequence entries, part 420.
7290. gbvrl421.seq - Viral sequence entries, part 421.
7291. gbvrl422.seq - Viral sequence entries, part 422.
7292. gbvrl423.seq - Viral sequence entries, part 423.
7293. gbvrl424.seq - Viral sequence entries, part 424.
7294. gbvrl425.seq - Viral sequence entries, part 425.
7295. gbvrl426.seq - Viral sequence entries, part 426.
7296. gbvrl427.seq - Viral sequence entries, part 427.
7297. gbvrl428.seq - Viral sequence entries, part 428.
7298. gbvrl429.seq - Viral sequence entries, part 429.
7299. gbvrl43.seq - Viral sequence entries, part 43.
7300. gbvrl430.seq - Viral sequence entries, part 430.
7301. gbvrl431.seq - Viral sequence entries, part 431.
7302. gbvrl432.seq - Viral sequence entries, part 432.
7303. gbvrl433.seq - Viral sequence entries, part 433.
7304. gbvrl434.seq - Viral sequence entries, part 434.
7305. gbvrl435.seq - Viral sequence entries, part 435.
7306. gbvrl436.seq - Viral sequence entries, part 436.
7307. gbvrl437.seq - Viral sequence entries, part 437.
7308. gbvrl438.seq - Viral sequence entries, part 438.
7309. gbvrl439.seq - Viral sequence entries, part 439.
7310. gbvrl44.seq - Viral sequence entries, part 44.
7311. gbvrl440.seq - Viral sequence entries, part 440.
7312. gbvrl441.seq - Viral sequence entries, part 441.
7313. gbvrl442.seq - Viral sequence entries, part 442.
7314. gbvrl443.seq - Viral sequence entries, part 443.
7315. gbvrl444.seq - Viral sequence entries, part 444.
7316. gbvrl445.seq - Viral sequence entries, part 445.
7317. gbvrl446.seq - Viral sequence entries, part 446.
7318. gbvrl447.seq - Viral sequence entries, part 447.
7319. gbvrl448.seq - Viral sequence entries, part 448.
7320. gbvrl449.seq - Viral sequence entries, part 449.
7321. gbvrl45.seq - Viral sequence entries, part 45.
7322. gbvrl450.seq - Viral sequence entries, part 450.
7323. gbvrl451.seq - Viral sequence entries, part 451.
7324. gbvrl452.seq - Viral sequence entries, part 452.
7325. gbvrl453.seq - Viral sequence entries, part 453.
7326. gbvrl454.seq - Viral sequence entries, part 454.
7327. gbvrl455.seq - Viral sequence entries, part 455.
7328. gbvrl456.seq - Viral sequence entries, part 456.
7329. gbvrl457.seq - Viral sequence entries, part 457.
7330. gbvrl458.seq - Viral sequence entries, part 458.
7331. gbvrl459.seq - Viral sequence entries, part 459.
7332. gbvrl46.seq - Viral sequence entries, part 46.
7333. gbvrl460.seq - Viral sequence entries, part 460.
7334. gbvrl461.seq - Viral sequence entries, part 461.
7335. gbvrl462.seq - Viral sequence entries, part 462.
7336. gbvrl463.seq - Viral sequence entries, part 463.
7337. gbvrl464.seq - Viral sequence entries, part 464.
7338. gbvrl465.seq - Viral sequence entries, part 465.
7339. gbvrl466.seq - Viral sequence entries, part 466.
7340. gbvrl467.seq - Viral sequence entries, part 467.
7341. gbvrl468.seq - Viral sequence entries, part 468.
7342. gbvrl469.seq - Viral sequence entries, part 469.
7343. gbvrl47.seq - Viral sequence entries, part 47.
7344. gbvrl470.seq - Viral sequence entries, part 470.
7345. gbvrl471.seq - Viral sequence entries, part 471.
7346. gbvrl472.seq - Viral sequence entries, part 472.
7347. gbvrl473.seq - Viral sequence entries, part 473.
7348. gbvrl474.seq - Viral sequence entries, part 474.
7349. gbvrl475.seq - Viral sequence entries, part 475.
7350. gbvrl476.seq - Viral sequence entries, part 476.
7351. gbvrl477.seq - Viral sequence entries, part 477.
7352. gbvrl478.seq - Viral sequence entries, part 478.
7353. gbvrl479.seq - Viral sequence entries, part 479.
7354. gbvrl48.seq - Viral sequence entries, part 48.
7355. gbvrl480.seq - Viral sequence entries, part 480.
7356. gbvrl481.seq - Viral sequence entries, part 481.
7357. gbvrl482.seq - Viral sequence entries, part 482.
7358. gbvrl483.seq - Viral sequence entries, part 483.
7359. gbvrl484.seq - Viral sequence entries, part 484.
7360. gbvrl485.seq - Viral sequence entries, part 485.
7361. gbvrl486.seq - Viral sequence entries, part 486.
7362. gbvrl487.seq - Viral sequence entries, part 487.
7363. gbvrl488.seq - Viral sequence entries, part 488.
7364. gbvrl489.seq - Viral sequence entries, part 489.
7365. gbvrl49.seq - Viral sequence entries, part 49.
7366. gbvrl490.seq - Viral sequence entries, part 490.
7367. gbvrl491.seq - Viral sequence entries, part 491.
7368. gbvrl492.seq - Viral sequence entries, part 492.
7369. gbvrl493.seq - Viral sequence entries, part 493.
7370. gbvrl494.seq - Viral sequence entries, part 494.
7371. gbvrl495.seq - Viral sequence entries, part 495.
7372. gbvrl496.seq - Viral sequence entries, part 496.
7373. gbvrl497.seq - Viral sequence entries, part 497.
7374. gbvrl498.seq - Viral sequence entries, part 498.
7375. gbvrl499.seq - Viral sequence entries, part 499.
7376. gbvrl5.seq - Viral sequence entries, part 5.
7377. gbvrl50.seq - Viral sequence entries, part 50.
7378. gbvrl500.seq - Viral sequence entries, part 500.
7379. gbvrl501.seq - Viral sequence entries, part 501.
7380. gbvrl502.seq - Viral sequence entries, part 502.
7381. gbvrl503.seq - Viral sequence entries, part 503.
7382. gbvrl504.seq - Viral sequence entries, part 504.
7383. gbvrl505.seq - Viral sequence entries, part 505.
7384. gbvrl506.seq - Viral sequence entries, part 506.
7385. gbvrl507.seq - Viral sequence entries, part 507.
7386. gbvrl508.seq - Viral sequence entries, part 508.
7387. gbvrl509.seq - Viral sequence entries, part 509.
7388. gbvrl51.seq - Viral sequence entries, part 51.
7389. gbvrl510.seq - Viral sequence entries, part 510.
7390. gbvrl511.seq - Viral sequence entries, part 511.
7391. gbvrl512.seq - Viral sequence entries, part 512.
7392. gbvrl513.seq - Viral sequence entries, part 513.
7393. gbvrl514.seq - Viral sequence entries, part 514.
7394. gbvrl515.seq - Viral sequence entries, part 515.
7395. gbvrl516.seq - Viral sequence entries, part 516.
7396. gbvrl517.seq - Viral sequence entries, part 517.
7397. gbvrl518.seq - Viral sequence entries, part 518.
7398. gbvrl519.seq - Viral sequence entries, part 519.
7399. gbvrl52.seq - Viral sequence entries, part 52.
7400. gbvrl520.seq - Viral sequence entries, part 520.
7401. gbvrl521.seq - Viral sequence entries, part 521.
7402. gbvrl522.seq - Viral sequence entries, part 522.
7403. gbvrl523.seq - Viral sequence entries, part 523.
7404. gbvrl524.seq - Viral sequence entries, part 524.
7405. gbvrl525.seq - Viral sequence entries, part 525.
7406. gbvrl526.seq - Viral sequence entries, part 526.
7407. gbvrl527.seq - Viral sequence entries, part 527.
7408. gbvrl528.seq - Viral sequence entries, part 528.
7409. gbvrl529.seq - Viral sequence entries, part 529.
7410. gbvrl53.seq - Viral sequence entries, part 53.
7411. gbvrl530.seq - Viral sequence entries, part 530.
7412. gbvrl531.seq - Viral sequence entries, part 531.
7413. gbvrl532.seq - Viral sequence entries, part 532.
7414. gbvrl533.seq - Viral sequence entries, part 533.
7415. gbvrl534.seq - Viral sequence entries, part 534.
7416. gbvrl535.seq - Viral sequence entries, part 535.
7417. gbvrl536.seq - Viral sequence entries, part 536.
7418. gbvrl537.seq - Viral sequence entries, part 537.
7419. gbvrl538.seq - Viral sequence entries, part 538.
7420. gbvrl539.seq - Viral sequence entries, part 539.
7421. gbvrl54.seq - Viral sequence entries, part 54.
7422. gbvrl540.seq - Viral sequence entries, part 540.
7423. gbvrl541.seq - Viral sequence entries, part 541.
7424. gbvrl542.seq - Viral sequence entries, part 542.
7425. gbvrl543.seq - Viral sequence entries, part 543.
7426. gbvrl544.seq - Viral sequence entries, part 544.
7427. gbvrl545.seq - Viral sequence entries, part 545.
7428. gbvrl546.seq - Viral sequence entries, part 546.
7429. gbvrl547.seq - Viral sequence entries, part 547.
7430. gbvrl548.seq - Viral sequence entries, part 548.
7431. gbvrl549.seq - Viral sequence entries, part 549.
7432. gbvrl55.seq - Viral sequence entries, part 55.
7433. gbvrl550.seq - Viral sequence entries, part 550.
7434. gbvrl551.seq - Viral sequence entries, part 551.
7435. gbvrl552.seq - Viral sequence entries, part 552.
7436. gbvrl553.seq - Viral sequence entries, part 553.
7437. gbvrl554.seq - Viral sequence entries, part 554.
7438. gbvrl555.seq - Viral sequence entries, part 555.
7439. gbvrl556.seq - Viral sequence entries, part 556.
7440. gbvrl557.seq - Viral sequence entries, part 557.
7441. gbvrl558.seq - Viral sequence entries, part 558.
7442. gbvrl559.seq - Viral sequence entries, part 559.
7443. gbvrl56.seq - Viral sequence entries, part 56.
7444. gbvrl560.seq - Viral sequence entries, part 560.
7445. gbvrl561.seq - Viral sequence entries, part 561.
7446. gbvrl562.seq - Viral sequence entries, part 562.
7447. gbvrl563.seq - Viral sequence entries, part 563.
7448. gbvrl564.seq - Viral sequence entries, part 564.
7449. gbvrl565.seq - Viral sequence entries, part 565.
7450. gbvrl566.seq - Viral sequence entries, part 566.
7451. gbvrl567.seq - Viral sequence entries, part 567.
7452. gbvrl568.seq - Viral sequence entries, part 568.
7453. gbvrl569.seq - Viral sequence entries, part 569.
7454. gbvrl57.seq - Viral sequence entries, part 57.
7455. gbvrl570.seq - Viral sequence entries, part 570.
7456. gbvrl571.seq - Viral sequence entries, part 571.
7457. gbvrl572.seq - Viral sequence entries, part 572.
7458. gbvrl573.seq - Viral sequence entries, part 573.
7459. gbvrl574.seq - Viral sequence entries, part 574.
7460. gbvrl575.seq - Viral sequence entries, part 575.
7461. gbvrl576.seq - Viral sequence entries, part 576.
7462. gbvrl577.seq - Viral sequence entries, part 577.
7463. gbvrl578.seq - Viral sequence entries, part 578.
7464. gbvrl579.seq - Viral sequence entries, part 579.
7465. gbvrl58.seq - Viral sequence entries, part 58.
7466. gbvrl580.seq - Viral sequence entries, part 580.
7467. gbvrl581.seq - Viral sequence entries, part 581.
7468. gbvrl582.seq - Viral sequence entries, part 582.
7469. gbvrl583.seq - Viral sequence entries, part 583.
7470. gbvrl584.seq - Viral sequence entries, part 584.
7471. gbvrl585.seq - Viral sequence entries, part 585.
7472. gbvrl586.seq - Viral sequence entries, part 586.
7473. gbvrl587.seq - Viral sequence entries, part 587.
7474. gbvrl588.seq - Viral sequence entries, part 588.
7475. gbvrl589.seq - Viral sequence entries, part 589.
7476. gbvrl59.seq - Viral sequence entries, part 59.
7477. gbvrl590.seq - Viral sequence entries, part 590.
7478. gbvrl591.seq - Viral sequence entries, part 591.
7479. gbvrl592.seq - Viral sequence entries, part 592.
7480. gbvrl593.seq - Viral sequence entries, part 593.
7481. gbvrl594.seq - Viral sequence entries, part 594.
7482. gbvrl595.seq - Viral sequence entries, part 595.
7483. gbvrl596.seq - Viral sequence entries, part 596.
7484. gbvrl597.seq - Viral sequence entries, part 597.
7485. gbvrl598.seq - Viral sequence entries, part 598.
7486. gbvrl599.seq - Viral sequence entries, part 599.
7487. gbvrl6.seq - Viral sequence entries, part 6.
7488. gbvrl60.seq - Viral sequence entries, part 60.
7489. gbvrl600.seq - Viral sequence entries, part 600.
7490. gbvrl601.seq - Viral sequence entries, part 601.
7491. gbvrl602.seq - Viral sequence entries, part 602.
7492. gbvrl603.seq - Viral sequence entries, part 603.
7493. gbvrl604.seq - Viral sequence entries, part 604.
7494. gbvrl605.seq - Viral sequence entries, part 605.
7495. gbvrl606.seq - Viral sequence entries, part 606.
7496. gbvrl607.seq - Viral sequence entries, part 607.
7497. gbvrl608.seq - Viral sequence entries, part 608.
7498. gbvrl609.seq - Viral sequence entries, part 609.
7499. gbvrl61.seq - Viral sequence entries, part 61.
7500. gbvrl610.seq - Viral sequence entries, part 610.
7501. gbvrl611.seq - Viral sequence entries, part 611.
7502. gbvrl612.seq - Viral sequence entries, part 612.
7503. gbvrl613.seq - Viral sequence entries, part 613.
7504. gbvrl614.seq - Viral sequence entries, part 614.
7505. gbvrl615.seq - Viral sequence entries, part 615.
7506. gbvrl616.seq - Viral sequence entries, part 616.
7507. gbvrl617.seq - Viral sequence entries, part 617.
7508. gbvrl618.seq - Viral sequence entries, part 618.
7509. gbvrl619.seq - Viral sequence entries, part 619.
7510. gbvrl62.seq - Viral sequence entries, part 62.
7511. gbvrl620.seq - Viral sequence entries, part 620.
7512. gbvrl621.seq - Viral sequence entries, part 621.
7513. gbvrl622.seq - Viral sequence entries, part 622.
7514. gbvrl623.seq - Viral sequence entries, part 623.
7515. gbvrl624.seq - Viral sequence entries, part 624.
7516. gbvrl625.seq - Viral sequence entries, part 625.
7517. gbvrl626.seq - Viral sequence entries, part 626.
7518. gbvrl627.seq - Viral sequence entries, part 627.
7519. gbvrl628.seq - Viral sequence entries, part 628.
7520. gbvrl629.seq - Viral sequence entries, part 629.
7521. gbvrl63.seq - Viral sequence entries, part 63.
7522. gbvrl630.seq - Viral sequence entries, part 630.
7523. gbvrl631.seq - Viral sequence entries, part 631.
7524. gbvrl632.seq - Viral sequence entries, part 632.
7525. gbvrl633.seq - Viral sequence entries, part 633.
7526. gbvrl634.seq - Viral sequence entries, part 634.
7527. gbvrl635.seq - Viral sequence entries, part 635.
7528. gbvrl636.seq - Viral sequence entries, part 636.
7529. gbvrl637.seq - Viral sequence entries, part 637.
7530. gbvrl638.seq - Viral sequence entries, part 638.
7531. gbvrl639.seq - Viral sequence entries, part 639.
7532. gbvrl64.seq - Viral sequence entries, part 64.
7533. gbvrl640.seq - Viral sequence entries, part 640.
7534. gbvrl641.seq - Viral sequence entries, part 641.
7535. gbvrl642.seq - Viral sequence entries, part 642.
7536. gbvrl643.seq - Viral sequence entries, part 643.
7537. gbvrl644.seq - Viral sequence entries, part 644.
7538. gbvrl645.seq - Viral sequence entries, part 645.
7539. gbvrl646.seq - Viral sequence entries, part 646.
7540. gbvrl647.seq - Viral sequence entries, part 647.
7541. gbvrl648.seq - Viral sequence entries, part 648.
7542. gbvrl649.seq - Viral sequence entries, part 649.
7543. gbvrl65.seq - Viral sequence entries, part 65.
7544. gbvrl650.seq - Viral sequence entries, part 650.
7545. gbvrl651.seq - Viral sequence entries, part 651.
7546. gbvrl652.seq - Viral sequence entries, part 652.
7547. gbvrl653.seq - Viral sequence entries, part 653.
7548. gbvrl654.seq - Viral sequence entries, part 654.
7549. gbvrl655.seq - Viral sequence entries, part 655.
7550. gbvrl656.seq - Viral sequence entries, part 656.
7551. gbvrl657.seq - Viral sequence entries, part 657.
7552. gbvrl658.seq - Viral sequence entries, part 658.
7553. gbvrl659.seq - Viral sequence entries, part 659.
7554. gbvrl66.seq - Viral sequence entries, part 66.
7555. gbvrl660.seq - Viral sequence entries, part 660.
7556. gbvrl661.seq - Viral sequence entries, part 661.
7557. gbvrl662.seq - Viral sequence entries, part 662.
7558. gbvrl663.seq - Viral sequence entries, part 663.
7559. gbvrl664.seq - Viral sequence entries, part 664.
7560. gbvrl665.seq - Viral sequence entries, part 665.
7561. gbvrl666.seq - Viral sequence entries, part 666.
7562. gbvrl667.seq - Viral sequence entries, part 667.
7563. gbvrl668.seq - Viral sequence entries, part 668.
7564. gbvrl669.seq - Viral sequence entries, part 669.
7565. gbvrl67.seq - Viral sequence entries, part 67.
7566. gbvrl670.seq - Viral sequence entries, part 670.
7567. gbvrl671.seq - Viral sequence entries, part 671.
7568. gbvrl672.seq - Viral sequence entries, part 672.
7569. gbvrl673.seq - Viral sequence entries, part 673.
7570. gbvrl674.seq - Viral sequence entries, part 674.
7571. gbvrl675.seq - Viral sequence entries, part 675.
7572. gbvrl676.seq - Viral sequence entries, part 676.
7573. gbvrl677.seq - Viral sequence entries, part 677.
7574. gbvrl678.seq - Viral sequence entries, part 678.
7575. gbvrl679.seq - Viral sequence entries, part 679.
7576. gbvrl68.seq - Viral sequence entries, part 68.
7577. gbvrl680.seq - Viral sequence entries, part 680.
7578. gbvrl681.seq - Viral sequence entries, part 681.
7579. gbvrl682.seq - Viral sequence entries, part 682.
7580. gbvrl683.seq - Viral sequence entries, part 683.
7581. gbvrl684.seq - Viral sequence entries, part 684.
7582. gbvrl685.seq - Viral sequence entries, part 685.
7583. gbvrl686.seq - Viral sequence entries, part 686.
7584. gbvrl687.seq - Viral sequence entries, part 687.
7585. gbvrl688.seq - Viral sequence entries, part 688.
7586. gbvrl689.seq - Viral sequence entries, part 689.
7587. gbvrl69.seq - Viral sequence entries, part 69.
7588. gbvrl690.seq - Viral sequence entries, part 690.
7589. gbvrl691.seq - Viral sequence entries, part 691.
7590. gbvrl692.seq - Viral sequence entries, part 692.
7591. gbvrl693.seq - Viral sequence entries, part 693.
7592. gbvrl694.seq - Viral sequence entries, part 694.
7593. gbvrl695.seq - Viral sequence entries, part 695.
7594. gbvrl696.seq - Viral sequence entries, part 696.
7595. gbvrl697.seq - Viral sequence entries, part 697.
7596. gbvrl698.seq - Viral sequence entries, part 698.
7597. gbvrl699.seq - Viral sequence entries, part 699.
7598. gbvrl7.seq - Viral sequence entries, part 7.
7599. gbvrl70.seq - Viral sequence entries, part 70.
7600. gbvrl700.seq - Viral sequence entries, part 700.
7601. gbvrl701.seq - Viral sequence entries, part 701.
7602. gbvrl702.seq - Viral sequence entries, part 702.
7603. gbvrl703.seq - Viral sequence entries, part 703.
7604. gbvrl704.seq - Viral sequence entries, part 704.
7605. gbvrl705.seq - Viral sequence entries, part 705.
7606. gbvrl706.seq - Viral sequence entries, part 706.
7607. gbvrl707.seq - Viral sequence entries, part 707.
7608. gbvrl708.seq - Viral sequence entries, part 708.
7609. gbvrl709.seq - Viral sequence entries, part 709.
7610. gbvrl71.seq - Viral sequence entries, part 71.
7611. gbvrl710.seq - Viral sequence entries, part 710.
7612. gbvrl711.seq - Viral sequence entries, part 711.
7613. gbvrl712.seq - Viral sequence entries, part 712.
7614. gbvrl713.seq - Viral sequence entries, part 713.
7615. gbvrl714.seq - Viral sequence entries, part 714.
7616. gbvrl715.seq - Viral sequence entries, part 715.
7617. gbvrl716.seq - Viral sequence entries, part 716.
7618. gbvrl717.seq - Viral sequence entries, part 717.
7619. gbvrl718.seq - Viral sequence entries, part 718.
7620. gbvrl719.seq - Viral sequence entries, part 719.
7621. gbvrl72.seq - Viral sequence entries, part 72.
7622. gbvrl720.seq - Viral sequence entries, part 720.
7623. gbvrl721.seq - Viral sequence entries, part 721.
7624. gbvrl722.seq - Viral sequence entries, part 722.
7625. gbvrl723.seq - Viral sequence entries, part 723.
7626. gbvrl724.seq - Viral sequence entries, part 724.
7627. gbvrl725.seq - Viral sequence entries, part 725.
7628. gbvrl726.seq - Viral sequence entries, part 726.
7629. gbvrl727.seq - Viral sequence entries, part 727.
7630. gbvrl728.seq - Viral sequence entries, part 728.
7631. gbvrl729.seq - Viral sequence entries, part 729.
7632. gbvrl73.seq - Viral sequence entries, part 73.
7633. gbvrl730.seq - Viral sequence entries, part 730.
7634. gbvrl731.seq - Viral sequence entries, part 731.
7635. gbvrl732.seq - Viral sequence entries, part 732.
7636. gbvrl733.seq - Viral sequence entries, part 733.
7637. gbvrl734.seq - Viral sequence entries, part 734.
7638. gbvrl735.seq - Viral sequence entries, part 735.
7639. gbvrl736.seq - Viral sequence entries, part 736.
7640. gbvrl737.seq - Viral sequence entries, part 737.
7641. gbvrl738.seq - Viral sequence entries, part 738.
7642. gbvrl739.seq - Viral sequence entries, part 739.
7643. gbvrl74.seq - Viral sequence entries, part 74.
7644. gbvrl740.seq - Viral sequence entries, part 740.
7645. gbvrl741.seq - Viral sequence entries, part 741.
7646. gbvrl742.seq - Viral sequence entries, part 742.
7647. gbvrl743.seq - Viral sequence entries, part 743.
7648. gbvrl744.seq - Viral sequence entries, part 744.
7649. gbvrl745.seq - Viral sequence entries, part 745.
7650. gbvrl746.seq - Viral sequence entries, part 746.
7651. gbvrl747.seq - Viral sequence entries, part 747.
7652. gbvrl748.seq - Viral sequence entries, part 748.
7653. gbvrl749.seq - Viral sequence entries, part 749.
7654. gbvrl75.seq - Viral sequence entries, part 75.
7655. gbvrl750.seq - Viral sequence entries, part 750.
7656. gbvrl751.seq - Viral sequence entries, part 751.
7657. gbvrl752.seq - Viral sequence entries, part 752.
7658. gbvrl753.seq - Viral sequence entries, part 753.
7659. gbvrl754.seq - Viral sequence entries, part 754.
7660. gbvrl755.seq - Viral sequence entries, part 755.
7661. gbvrl756.seq - Viral sequence entries, part 756.
7662. gbvrl757.seq - Viral sequence entries, part 757.
7663. gbvrl758.seq - Viral sequence entries, part 758.
7664. gbvrl759.seq - Viral sequence entries, part 759.
7665. gbvrl76.seq - Viral sequence entries, part 76.
7666. gbvrl760.seq - Viral sequence entries, part 760.
7667. gbvrl761.seq - Viral sequence entries, part 761.
7668. gbvrl762.seq - Viral sequence entries, part 762.
7669. gbvrl763.seq - Viral sequence entries, part 763.
7670. gbvrl764.seq - Viral sequence entries, part 764.
7671. gbvrl765.seq - Viral sequence entries, part 765.
7672. gbvrl766.seq - Viral sequence entries, part 766.
7673. gbvrl767.seq - Viral sequence entries, part 767.
7674. gbvrl768.seq - Viral sequence entries, part 768.
7675. gbvrl769.seq - Viral sequence entries, part 769.
7676. gbvrl77.seq - Viral sequence entries, part 77.
7677. gbvrl770.seq - Viral sequence entries, part 770.
7678. gbvrl771.seq - Viral sequence entries, part 771.
7679. gbvrl772.seq - Viral sequence entries, part 772.
7680. gbvrl773.seq - Viral sequence entries, part 773.
7681. gbvrl774.seq - Viral sequence entries, part 774.
7682. gbvrl775.seq - Viral sequence entries, part 775.
7683. gbvrl776.seq - Viral sequence entries, part 776.
7684. gbvrl777.seq - Viral sequence entries, part 777.
7685. gbvrl778.seq - Viral sequence entries, part 778.
7686. gbvrl779.seq - Viral sequence entries, part 779.
7687. gbvrl78.seq - Viral sequence entries, part 78.
7688. gbvrl780.seq - Viral sequence entries, part 780.
7689. gbvrl781.seq - Viral sequence entries, part 781.
7690. gbvrl782.seq - Viral sequence entries, part 782.
7691. gbvrl783.seq - Viral sequence entries, part 783.
7692. gbvrl784.seq - Viral sequence entries, part 784.
7693. gbvrl785.seq - Viral sequence entries, part 785.
7694. gbvrl786.seq - Viral sequence entries, part 786.
7695. gbvrl787.seq - Viral sequence entries, part 787.
7696. gbvrl788.seq - Viral sequence entries, part 788.
7697. gbvrl789.seq - Viral sequence entries, part 789.
7698. gbvrl79.seq - Viral sequence entries, part 79.
7699. gbvrl790.seq - Viral sequence entries, part 790.
7700. gbvrl791.seq - Viral sequence entries, part 791.
7701. gbvrl792.seq - Viral sequence entries, part 792.
7702. gbvrl793.seq - Viral sequence entries, part 793.
7703. gbvrl794.seq - Viral sequence entries, part 794.
7704. gbvrl795.seq - Viral sequence entries, part 795.
7705. gbvrl796.seq - Viral sequence entries, part 796.
7706. gbvrl797.seq - Viral sequence entries, part 797.
7707. gbvrl798.seq - Viral sequence entries, part 798.
7708. gbvrl799.seq - Viral sequence entries, part 799.
7709. gbvrl8.seq - Viral sequence entries, part 8.
7710. gbvrl80.seq - Viral sequence entries, part 80.
7711. gbvrl800.seq - Viral sequence entries, part 800.
7712. gbvrl801.seq - Viral sequence entries, part 801.
7713. gbvrl802.seq - Viral sequence entries, part 802.
7714. gbvrl803.seq - Viral sequence entries, part 803.
7715. gbvrl804.seq - Viral sequence entries, part 804.
7716. gbvrl805.seq - Viral sequence entries, part 805.
7717. gbvrl806.seq - Viral sequence entries, part 806.
7718. gbvrl807.seq - Viral sequence entries, part 807.
7719. gbvrl808.seq - Viral sequence entries, part 808.
7720. gbvrl809.seq - Viral sequence entries, part 809.
7721. gbvrl81.seq - Viral sequence entries, part 81.
7722. gbvrl810.seq - Viral sequence entries, part 810.
7723. gbvrl811.seq - Viral sequence entries, part 811.
7724. gbvrl812.seq - Viral sequence entries, part 812.
7725. gbvrl813.seq - Viral sequence entries, part 813.
7726. gbvrl814.seq - Viral sequence entries, part 814.
7727. gbvrl815.seq - Viral sequence entries, part 815.
7728. gbvrl816.seq - Viral sequence entries, part 816.
7729. gbvrl817.seq - Viral sequence entries, part 817.
7730. gbvrl818.seq - Viral sequence entries, part 818.
7731. gbvrl819.seq - Viral sequence entries, part 819.
7732. gbvrl82.seq - Viral sequence entries, part 82.
7733. gbvrl820.seq - Viral sequence entries, part 820.
7734. gbvrl821.seq - Viral sequence entries, part 821.
7735. gbvrl822.seq - Viral sequence entries, part 822.
7736. gbvrl823.seq - Viral sequence entries, part 823.
7737. gbvrl824.seq - Viral sequence entries, part 824.
7738. gbvrl825.seq - Viral sequence entries, part 825.
7739. gbvrl826.seq - Viral sequence entries, part 826.
7740. gbvrl827.seq - Viral sequence entries, part 827.
7741. gbvrl828.seq - Viral sequence entries, part 828.
7742. gbvrl829.seq - Viral sequence entries, part 829.
7743. gbvrl83.seq - Viral sequence entries, part 83.
7744. gbvrl830.seq - Viral sequence entries, part 830.
7745. gbvrl831.seq - Viral sequence entries, part 831.
7746. gbvrl832.seq - Viral sequence entries, part 832.
7747. gbvrl833.seq - Viral sequence entries, part 833.
7748. gbvrl834.seq - Viral sequence entries, part 834.
7749. gbvrl835.seq - Viral sequence entries, part 835.
7750. gbvrl836.seq - Viral sequence entries, part 836.
7751. gbvrl837.seq - Viral sequence entries, part 837.
7752. gbvrl838.seq - Viral sequence entries, part 838.
7753. gbvrl839.seq - Viral sequence entries, part 839.
7754. gbvrl84.seq - Viral sequence entries, part 84.
7755. gbvrl840.seq - Viral sequence entries, part 840.
7756. gbvrl841.seq - Viral sequence entries, part 841.
7757. gbvrl842.seq - Viral sequence entries, part 842.
7758. gbvrl843.seq - Viral sequence entries, part 843.
7759. gbvrl844.seq - Viral sequence entries, part 844.
7760. gbvrl845.seq - Viral sequence entries, part 845.
7761. gbvrl846.seq - Viral sequence entries, part 846.
7762. gbvrl847.seq - Viral sequence entries, part 847.
7763. gbvrl848.seq - Viral sequence entries, part 848.
7764. gbvrl849.seq - Viral sequence entries, part 849.
7765. gbvrl85.seq - Viral sequence entries, part 85.
7766. gbvrl850.seq - Viral sequence entries, part 850.
7767. gbvrl851.seq - Viral sequence entries, part 851.
7768. gbvrl852.seq - Viral sequence entries, part 852.
7769. gbvrl853.seq - Viral sequence entries, part 853.
7770. gbvrl854.seq - Viral sequence entries, part 854.
7771. gbvrl855.seq - Viral sequence entries, part 855.
7772. gbvrl856.seq - Viral sequence entries, part 856.
7773. gbvrl857.seq - Viral sequence entries, part 857.
7774. gbvrl858.seq - Viral sequence entries, part 858.
7775. gbvrl859.seq - Viral sequence entries, part 859.
7776. gbvrl86.seq - Viral sequence entries, part 86.
7777. gbvrl860.seq - Viral sequence entries, part 860.
7778. gbvrl861.seq - Viral sequence entries, part 861.
7779. gbvrl862.seq - Viral sequence entries, part 862.
7780. gbvrl863.seq - Viral sequence entries, part 863.
7781. gbvrl864.seq - Viral sequence entries, part 864.
7782. gbvrl865.seq - Viral sequence entries, part 865.
7783. gbvrl866.seq - Viral sequence entries, part 866.
7784. gbvrl867.seq - Viral sequence entries, part 867.
7785. gbvrl868.seq - Viral sequence entries, part 868.
7786. gbvrl869.seq - Viral sequence entries, part 869.
7787. gbvrl87.seq - Viral sequence entries, part 87.
7788. gbvrl870.seq - Viral sequence entries, part 870.
7789. gbvrl871.seq - Viral sequence entries, part 871.
7790. gbvrl872.seq - Viral sequence entries, part 872.
7791. gbvrl873.seq - Viral sequence entries, part 873.
7792. gbvrl874.seq - Viral sequence entries, part 874.
7793. gbvrl875.seq - Viral sequence entries, part 875.
7794. gbvrl876.seq - Viral sequence entries, part 876.
7795. gbvrl877.seq - Viral sequence entries, part 877.
7796. gbvrl878.seq - Viral sequence entries, part 878.
7797. gbvrl879.seq - Viral sequence entries, part 879.
7798. gbvrl88.seq - Viral sequence entries, part 88.
7799. gbvrl880.seq - Viral sequence entries, part 880.
7800. gbvrl881.seq - Viral sequence entries, part 881.
7801. gbvrl882.seq - Viral sequence entries, part 882.
7802. gbvrl883.seq - Viral sequence entries, part 883.
7803. gbvrl884.seq - Viral sequence entries, part 884.
7804. gbvrl885.seq - Viral sequence entries, part 885.
7805. gbvrl886.seq - Viral sequence entries, part 886.
7806. gbvrl887.seq - Viral sequence entries, part 887.
7807. gbvrl888.seq - Viral sequence entries, part 888.
7808. gbvrl889.seq - Viral sequence entries, part 889.
7809. gbvrl89.seq - Viral sequence entries, part 89.
7810. gbvrl890.seq - Viral sequence entries, part 890.
7811. gbvrl891.seq - Viral sequence entries, part 891.
7812. gbvrl892.seq - Viral sequence entries, part 892.
7813. gbvrl893.seq - Viral sequence entries, part 893.
7814. gbvrl894.seq - Viral sequence entries, part 894.
7815. gbvrl895.seq - Viral sequence entries, part 895.
7816. gbvrl896.seq - Viral sequence entries, part 896.
7817. gbvrl897.seq - Viral sequence entries, part 897.
7818. gbvrl898.seq - Viral sequence entries, part 898.
7819. gbvrl899.seq - Viral sequence entries, part 899.
7820. gbvrl9.seq - Viral sequence entries, part 9.
7821. gbvrl90.seq - Viral sequence entries, part 90.
7822. gbvrl900.seq - Viral sequence entries, part 900.
7823. gbvrl901.seq - Viral sequence entries, part 901.
7824. gbvrl902.seq - Viral sequence entries, part 902.
7825. gbvrl903.seq - Viral sequence entries, part 903.
7826. gbvrl904.seq - Viral sequence entries, part 904.
7827. gbvrl905.seq - Viral sequence entries, part 905.
7828. gbvrl906.seq - Viral sequence entries, part 906.
7829. gbvrl907.seq - Viral sequence entries, part 907.
7830. gbvrl908.seq - Viral sequence entries, part 908.
7831. gbvrl909.seq - Viral sequence entries, part 909.
7832. gbvrl91.seq - Viral sequence entries, part 91.
7833. gbvrl910.seq - Viral sequence entries, part 910.
7834. gbvrl911.seq - Viral sequence entries, part 911.
7835. gbvrl912.seq - Viral sequence entries, part 912.
7836. gbvrl913.seq - Viral sequence entries, part 913.
7837. gbvrl914.seq - Viral sequence entries, part 914.
7838. gbvrl915.seq - Viral sequence entries, part 915.
7839. gbvrl916.seq - Viral sequence entries, part 916.
7840. gbvrl917.seq - Viral sequence entries, part 917.
7841. gbvrl918.seq - Viral sequence entries, part 918.
7842. gbvrl919.seq - Viral sequence entries, part 919.
7843. gbvrl92.seq - Viral sequence entries, part 92.
7844. gbvrl920.seq - Viral sequence entries, part 920.
7845. gbvrl921.seq - Viral sequence entries, part 921.
7846. gbvrl922.seq - Viral sequence entries, part 922.
7847. gbvrl923.seq - Viral sequence entries, part 923.
7848. gbvrl924.seq - Viral sequence entries, part 924.
7849. gbvrl925.seq - Viral sequence entries, part 925.
7850. gbvrl926.seq - Viral sequence entries, part 926.
7851. gbvrl927.seq - Viral sequence entries, part 927.
7852. gbvrl928.seq - Viral sequence entries, part 928.
7853. gbvrl929.seq - Viral sequence entries, part 929.
7854. gbvrl93.seq - Viral sequence entries, part 93.
7855. gbvrl930.seq - Viral sequence entries, part 930.
7856. gbvrl931.seq - Viral sequence entries, part 931.
7857. gbvrl932.seq - Viral sequence entries, part 932.
7858. gbvrl933.seq - Viral sequence entries, part 933.
7859. gbvrl934.seq - Viral sequence entries, part 934.
7860. gbvrl935.seq - Viral sequence entries, part 935.
7861. gbvrl936.seq - Viral sequence entries, part 936.
7862. gbvrl937.seq - Viral sequence entries, part 937.
7863. gbvrl938.seq - Viral sequence entries, part 938.
7864. gbvrl939.seq - Viral sequence entries, part 939.
7865. gbvrl94.seq - Viral sequence entries, part 94.
7866. gbvrl940.seq - Viral sequence entries, part 940.
7867. gbvrl941.seq - Viral sequence entries, part 941.
7868. gbvrl942.seq - Viral sequence entries, part 942.
7869. gbvrl943.seq - Viral sequence entries, part 943.
7870. gbvrl944.seq - Viral sequence entries, part 944.
7871. gbvrl945.seq - Viral sequence entries, part 945.
7872. gbvrl946.seq - Viral sequence entries, part 946.
7873. gbvrl947.seq - Viral sequence entries, part 947.
7874. gbvrl948.seq - Viral sequence entries, part 948.
7875. gbvrl949.seq - Viral sequence entries, part 949.
7876. gbvrl95.seq - Viral sequence entries, part 95.
7877. gbvrl950.seq - Viral sequence entries, part 950.
7878. gbvrl951.seq - Viral sequence entries, part 951.
7879. gbvrl952.seq - Viral sequence entries, part 952.
7880. gbvrl953.seq - Viral sequence entries, part 953.
7881. gbvrl954.seq - Viral sequence entries, part 954.
7882. gbvrl955.seq - Viral sequence entries, part 955.
7883. gbvrl956.seq - Viral sequence entries, part 956.
7884. gbvrl957.seq - Viral sequence entries, part 957.
7885. gbvrl958.seq - Viral sequence entries, part 958.
7886. gbvrl959.seq - Viral sequence entries, part 959.
7887. gbvrl96.seq - Viral sequence entries, part 96.
7888. gbvrl960.seq - Viral sequence entries, part 960.
7889. gbvrl961.seq - Viral sequence entries, part 961.
7890. gbvrl962.seq - Viral sequence entries, part 962.
7891. gbvrl963.seq - Viral sequence entries, part 963.
7892. gbvrl964.seq - Viral sequence entries, part 964.
7893. gbvrl965.seq - Viral sequence entries, part 965.
7894. gbvrl966.seq - Viral sequence entries, part 966.
7895. gbvrl967.seq - Viral sequence entries, part 967.
7896. gbvrl968.seq - Viral sequence entries, part 968.
7897. gbvrl969.seq - Viral sequence entries, part 969.
7898. gbvrl97.seq - Viral sequence entries, part 97.
7899. gbvrl970.seq - Viral sequence entries, part 970.
7900. gbvrl971.seq - Viral sequence entries, part 971.
7901. gbvrl972.seq - Viral sequence entries, part 972.
7902. gbvrl973.seq - Viral sequence entries, part 973.
7903. gbvrl974.seq - Viral sequence entries, part 974.
7904. gbvrl975.seq - Viral sequence entries, part 975.
7905. gbvrl976.seq - Viral sequence entries, part 976.
7906. gbvrl977.seq - Viral sequence entries, part 977.
7907. gbvrl978.seq - Viral sequence entries, part 978.
7908. gbvrl979.seq - Viral sequence entries, part 979.
7909. gbvrl98.seq - Viral sequence entries, part 98.
7910. gbvrl980.seq - Viral sequence entries, part 980.
7911. gbvrl981.seq - Viral sequence entries, part 981.
7912. gbvrl982.seq - Viral sequence entries, part 982.
7913. gbvrl983.seq - Viral sequence entries, part 983.
7914. gbvrl984.seq - Viral sequence entries, part 984.
7915. gbvrl985.seq - Viral sequence entries, part 985.
7916. gbvrl986.seq - Viral sequence entries, part 986.
7917. gbvrl987.seq - Viral sequence entries, part 987.
7918. gbvrl988.seq - Viral sequence entries, part 988.
7919. gbvrl989.seq - Viral sequence entries, part 989.
7920. gbvrl99.seq - Viral sequence entries, part 99.
7921. gbvrl990.seq - Viral sequence entries, part 990.
7922. gbvrl991.seq - Viral sequence entries, part 991.
7923. gbvrl992.seq - Viral sequence entries, part 992.
7924. gbvrl993.seq - Viral sequence entries, part 993.
7925. gbvrl994.seq - Viral sequence entries, part 994.
7926. gbvrl995.seq - Viral sequence entries, part 995.
7927. gbvrl996.seq - Viral sequence entries, part 996.
7928. gbvrl997.seq - Viral sequence entries, part 997.
7929. gbvrl998.seq - Viral sequence entries, part 998.
7930. gbvrl999.seq - Viral sequence entries, part 999.
7931. gbvrt1.seq - Other vertebrate sequence entries, part 1.
7932. gbvrt10.seq - Other vertebrate sequence entries, part 10.
7933. gbvrt100.seq - Other vertebrate sequence entries, part 100.
7934. gbvrt101.seq - Other vertebrate sequence entries, part 101.
7935. gbvrt102.seq - Other vertebrate sequence entries, part 102.
7936. gbvrt103.seq - Other vertebrate sequence entries, part 103.
7937. gbvrt104.seq - Other vertebrate sequence entries, part 104.
7938. gbvrt105.seq - Other vertebrate sequence entries, part 105.
7939. gbvrt106.seq - Other vertebrate sequence entries, part 106.
7940. gbvrt107.seq - Other vertebrate sequence entries, part 107.
7941. gbvrt108.seq - Other vertebrate sequence entries, part 108.
7942. gbvrt109.seq - Other vertebrate sequence entries, part 109.
7943. gbvrt11.seq - Other vertebrate sequence entries, part 11.
7944. gbvrt110.seq - Other vertebrate sequence entries, part 110.
7945. gbvrt111.seq - Other vertebrate sequence entries, part 111.
7946. gbvrt112.seq - Other vertebrate sequence entries, part 112.
7947. gbvrt113.seq - Other vertebrate sequence entries, part 113.
7948. gbvrt114.seq - Other vertebrate sequence entries, part 114.
7949. gbvrt115.seq - Other vertebrate sequence entries, part 115.
7950. gbvrt116.seq - Other vertebrate sequence entries, part 116.
7951. gbvrt117.seq - Other vertebrate sequence entries, part 117.
7952. gbvrt118.seq - Other vertebrate sequence entries, part 118.
7953. gbvrt119.seq - Other vertebrate sequence entries, part 119.
7954. gbvrt12.seq - Other vertebrate sequence entries, part 12.
7955. gbvrt120.seq - Other vertebrate sequence entries, part 120.
7956. gbvrt121.seq - Other vertebrate sequence entries, part 121.
7957. gbvrt122.seq - Other vertebrate sequence entries, part 122.
7958. gbvrt123.seq - Other vertebrate sequence entries, part 123.
7959. gbvrt124.seq - Other vertebrate sequence entries, part 124.
7960. gbvrt125.seq - Other vertebrate sequence entries, part 125.
7961. gbvrt126.seq - Other vertebrate sequence entries, part 126.
7962. gbvrt127.seq - Other vertebrate sequence entries, part 127.
7963. gbvrt128.seq - Other vertebrate sequence entries, part 128.
7964. gbvrt129.seq - Other vertebrate sequence entries, part 129.
7965. gbvrt13.seq - Other vertebrate sequence entries, part 13.
7966. gbvrt130.seq - Other vertebrate sequence entries, part 130.
7967. gbvrt131.seq - Other vertebrate sequence entries, part 131.
7968. gbvrt132.seq - Other vertebrate sequence entries, part 132.
7969. gbvrt133.seq - Other vertebrate sequence entries, part 133.
7970. gbvrt134.seq - Other vertebrate sequence entries, part 134.
7971. gbvrt135.seq - Other vertebrate sequence entries, part 135.
7972. gbvrt136.seq - Other vertebrate sequence entries, part 136.
7973. gbvrt137.seq - Other vertebrate sequence entries, part 137.
7974. gbvrt138.seq - Other vertebrate sequence entries, part 138.
7975. gbvrt139.seq - Other vertebrate sequence entries, part 139.
7976. gbvrt14.seq - Other vertebrate sequence entries, part 14.
7977. gbvrt140.seq - Other vertebrate sequence entries, part 140.
7978. gbvrt141.seq - Other vertebrate sequence entries, part 141.
7979. gbvrt142.seq - Other vertebrate sequence entries, part 142.
7980. gbvrt143.seq - Other vertebrate sequence entries, part 143.
7981. gbvrt144.seq - Other vertebrate sequence entries, part 144.
7982. gbvrt145.seq - Other vertebrate sequence entries, part 145.
7983. gbvrt146.seq - Other vertebrate sequence entries, part 146.
7984. gbvrt147.seq - Other vertebrate sequence entries, part 147.
7985. gbvrt148.seq - Other vertebrate sequence entries, part 148.
7986. gbvrt149.seq - Other vertebrate sequence entries, part 149.
7987. gbvrt15.seq - Other vertebrate sequence entries, part 15.
7988. gbvrt150.seq - Other vertebrate sequence entries, part 150.
7989. gbvrt151.seq - Other vertebrate sequence entries, part 151.
7990. gbvrt152.seq - Other vertebrate sequence entries, part 152.
7991. gbvrt153.seq - Other vertebrate sequence entries, part 153.
7992. gbvrt154.seq - Other vertebrate sequence entries, part 154.
7993. gbvrt155.seq - Other vertebrate sequence entries, part 155.
7994. gbvrt156.seq - Other vertebrate sequence entries, part 156.
7995. gbvrt157.seq - Other vertebrate sequence entries, part 157.
7996. gbvrt158.seq - Other vertebrate sequence entries, part 158.
7997. gbvrt159.seq - Other vertebrate sequence entries, part 159.
7998. gbvrt16.seq - Other vertebrate sequence entries, part 16.
7999. gbvrt160.seq - Other vertebrate sequence entries, part 160.
8000. gbvrt161.seq - Other vertebrate sequence entries, part 161.
8001. gbvrt162.seq - Other vertebrate sequence entries, part 162.
8002. gbvrt163.seq - Other vertebrate sequence entries, part 163.
8003. gbvrt164.seq - Other vertebrate sequence entries, part 164.
8004. gbvrt165.seq - Other vertebrate sequence entries, part 165.
8005. gbvrt166.seq - Other vertebrate sequence entries, part 166.
8006. gbvrt167.seq - Other vertebrate sequence entries, part 167.
8007. gbvrt168.seq - Other vertebrate sequence entries, part 168.
8008. gbvrt169.seq - Other vertebrate sequence entries, part 169.
8009. gbvrt17.seq - Other vertebrate sequence entries, part 17.
8010. gbvrt170.seq - Other vertebrate sequence entries, part 170.
8011. gbvrt171.seq - Other vertebrate sequence entries, part 171.
8012. gbvrt172.seq - Other vertebrate sequence entries, part 172.
8013. gbvrt173.seq - Other vertebrate sequence entries, part 173.
8014. gbvrt174.seq - Other vertebrate sequence entries, part 174.
8015. gbvrt175.seq - Other vertebrate sequence entries, part 175.
8016. gbvrt176.seq - Other vertebrate sequence entries, part 176.
8017. gbvrt177.seq - Other vertebrate sequence entries, part 177.
8018. gbvrt178.seq - Other vertebrate sequence entries, part 178.
8019. gbvrt179.seq - Other vertebrate sequence entries, part 179.
8020. gbvrt18.seq - Other vertebrate sequence entries, part 18.
8021. gbvrt180.seq - Other vertebrate sequence entries, part 180.
8022. gbvrt181.seq - Other vertebrate sequence entries, part 181.
8023. gbvrt182.seq - Other vertebrate sequence entries, part 182.
8024. gbvrt183.seq - Other vertebrate sequence entries, part 183.
8025. gbvrt184.seq - Other vertebrate sequence entries, part 184.
8026. gbvrt185.seq - Other vertebrate sequence entries, part 185.
8027. gbvrt186.seq - Other vertebrate sequence entries, part 186.
8028. gbvrt187.seq - Other vertebrate sequence entries, part 187.
8029. gbvrt188.seq - Other vertebrate sequence entries, part 188.
8030. gbvrt189.seq - Other vertebrate sequence entries, part 189.
8031. gbvrt19.seq - Other vertebrate sequence entries, part 19.
8032. gbvrt190.seq - Other vertebrate sequence entries, part 190.
8033. gbvrt191.seq - Other vertebrate sequence entries, part 191.
8034. gbvrt192.seq - Other vertebrate sequence entries, part 192.
8035. gbvrt193.seq - Other vertebrate sequence entries, part 193.
8036. gbvrt194.seq - Other vertebrate sequence entries, part 194.
8037. gbvrt195.seq - Other vertebrate sequence entries, part 195.
8038. gbvrt196.seq - Other vertebrate sequence entries, part 196.
8039. gbvrt197.seq - Other vertebrate sequence entries, part 197.
8040. gbvrt198.seq - Other vertebrate sequence entries, part 198.
8041. gbvrt199.seq - Other vertebrate sequence entries, part 199.
8042. gbvrt2.seq - Other vertebrate sequence entries, part 2.
8043. gbvrt20.seq - Other vertebrate sequence entries, part 20.
8044. gbvrt200.seq - Other vertebrate sequence entries, part 200.
8045. gbvrt201.seq - Other vertebrate sequence entries, part 201.
8046. gbvrt202.seq - Other vertebrate sequence entries, part 202.
8047. gbvrt203.seq - Other vertebrate sequence entries, part 203.
8048. gbvrt204.seq - Other vertebrate sequence entries, part 204.
8049. gbvrt205.seq - Other vertebrate sequence entries, part 205.
8050. gbvrt206.seq - Other vertebrate sequence entries, part 206.
8051. gbvrt207.seq - Other vertebrate sequence entries, part 207.
8052. gbvrt208.seq - Other vertebrate sequence entries, part 208.
8053. gbvrt209.seq - Other vertebrate sequence entries, part 209.
8054. gbvrt21.seq - Other vertebrate sequence entries, part 21.
8055. gbvrt210.seq - Other vertebrate sequence entries, part 210.
8056. gbvrt211.seq - Other vertebrate sequence entries, part 211.
8057. gbvrt212.seq - Other vertebrate sequence entries, part 212.
8058. gbvrt213.seq - Other vertebrate sequence entries, part 213.
8059. gbvrt214.seq - Other vertebrate sequence entries, part 214.
8060. gbvrt215.seq - Other vertebrate sequence entries, part 215.
8061. gbvrt216.seq - Other vertebrate sequence entries, part 216.
8062. gbvrt217.seq - Other vertebrate sequence entries, part 217.
8063. gbvrt218.seq - Other vertebrate sequence entries, part 218.
8064. gbvrt219.seq - Other vertebrate sequence entries, part 219.
8065. gbvrt22.seq - Other vertebrate sequence entries, part 22.
8066. gbvrt220.seq - Other vertebrate sequence entries, part 220.
8067. gbvrt221.seq - Other vertebrate sequence entries, part 221.
8068. gbvrt222.seq - Other vertebrate sequence entries, part 222.
8069. gbvrt223.seq - Other vertebrate sequence entries, part 223.
8070. gbvrt224.seq - Other vertebrate sequence entries, part 224.
8071. gbvrt225.seq - Other vertebrate sequence entries, part 225.
8072. gbvrt226.seq - Other vertebrate sequence entries, part 226.
8073. gbvrt227.seq - Other vertebrate sequence entries, part 227.
8074. gbvrt228.seq - Other vertebrate sequence entries, part 228.
8075. gbvrt229.seq - Other vertebrate sequence entries, part 229.
8076. gbvrt23.seq - Other vertebrate sequence entries, part 23.
8077. gbvrt230.seq - Other vertebrate sequence entries, part 230.
8078. gbvrt231.seq - Other vertebrate sequence entries, part 231.
8079. gbvrt232.seq - Other vertebrate sequence entries, part 232.
8080. gbvrt233.seq - Other vertebrate sequence entries, part 233.
8081. gbvrt234.seq - Other vertebrate sequence entries, part 234.
8082. gbvrt235.seq - Other vertebrate sequence entries, part 235.
8083. gbvrt236.seq - Other vertebrate sequence entries, part 236.
8084. gbvrt237.seq - Other vertebrate sequence entries, part 237.
8085. gbvrt238.seq - Other vertebrate sequence entries, part 238.
8086. gbvrt239.seq - Other vertebrate sequence entries, part 239.
8087. gbvrt24.seq - Other vertebrate sequence entries, part 24.
8088. gbvrt240.seq - Other vertebrate sequence entries, part 240.
8089. gbvrt241.seq - Other vertebrate sequence entries, part 241.
8090. gbvrt242.seq - Other vertebrate sequence entries, part 242.
8091. gbvrt243.seq - Other vertebrate sequence entries, part 243.
8092. gbvrt244.seq - Other vertebrate sequence entries, part 244.
8093. gbvrt245.seq - Other vertebrate sequence entries, part 245.
8094. gbvrt246.seq - Other vertebrate sequence entries, part 246.
8095. gbvrt247.seq - Other vertebrate sequence entries, part 247.
8096. gbvrt248.seq - Other vertebrate sequence entries, part 248.
8097. gbvrt249.seq - Other vertebrate sequence entries, part 249.
8098. gbvrt25.seq - Other vertebrate sequence entries, part 25.
8099. gbvrt250.seq - Other vertebrate sequence entries, part 250.
8100. gbvrt251.seq - Other vertebrate sequence entries, part 251.
8101. gbvrt252.seq - Other vertebrate sequence entries, part 252.
8102. gbvrt253.seq - Other vertebrate sequence entries, part 253.
8103. gbvrt254.seq - Other vertebrate sequence entries, part 254.
8104. gbvrt255.seq - Other vertebrate sequence entries, part 255.
8105. gbvrt256.seq - Other vertebrate sequence entries, part 256.
8106. gbvrt257.seq - Other vertebrate sequence entries, part 257.
8107. gbvrt258.seq - Other vertebrate sequence entries, part 258.
8108. gbvrt259.seq - Other vertebrate sequence entries, part 259.
8109. gbvrt26.seq - Other vertebrate sequence entries, part 26.
8110. gbvrt260.seq - Other vertebrate sequence entries, part 260.
8111. gbvrt261.seq - Other vertebrate sequence entries, part 261.
8112. gbvrt262.seq - Other vertebrate sequence entries, part 262.
8113. gbvrt263.seq - Other vertebrate sequence entries, part 263.
8114. gbvrt264.seq - Other vertebrate sequence entries, part 264.
8115. gbvrt265.seq - Other vertebrate sequence entries, part 265.
8116. gbvrt266.seq - Other vertebrate sequence entries, part 266.
8117. gbvrt267.seq - Other vertebrate sequence entries, part 267.
8118. gbvrt268.seq - Other vertebrate sequence entries, part 268.
8119. gbvrt269.seq - Other vertebrate sequence entries, part 269.
8120. gbvrt27.seq - Other vertebrate sequence entries, part 27.
8121. gbvrt270.seq - Other vertebrate sequence entries, part 270.
8122. gbvrt271.seq - Other vertebrate sequence entries, part 271.
8123. gbvrt272.seq - Other vertebrate sequence entries, part 272.
8124. gbvrt273.seq - Other vertebrate sequence entries, part 273.
8125. gbvrt274.seq - Other vertebrate sequence entries, part 274.
8126. gbvrt275.seq - Other vertebrate sequence entries, part 275.
8127. gbvrt276.seq - Other vertebrate sequence entries, part 276.
8128. gbvrt277.seq - Other vertebrate sequence entries, part 277.
8129. gbvrt278.seq - Other vertebrate sequence entries, part 278.
8130. gbvrt279.seq - Other vertebrate sequence entries, part 279.
8131. gbvrt28.seq - Other vertebrate sequence entries, part 28.
8132. gbvrt280.seq - Other vertebrate sequence entries, part 280.
8133. gbvrt281.seq - Other vertebrate sequence entries, part 281.
8134. gbvrt282.seq - Other vertebrate sequence entries, part 282.
8135. gbvrt283.seq - Other vertebrate sequence entries, part 283.
8136. gbvrt284.seq - Other vertebrate sequence entries, part 284.
8137. gbvrt285.seq - Other vertebrate sequence entries, part 285.
8138. gbvrt286.seq - Other vertebrate sequence entries, part 286.
8139. gbvrt287.seq - Other vertebrate sequence entries, part 287.
8140. gbvrt288.seq - Other vertebrate sequence entries, part 288.
8141. gbvrt289.seq - Other vertebrate sequence entries, part 289.
8142. gbvrt29.seq - Other vertebrate sequence entries, part 29.
8143. gbvrt290.seq - Other vertebrate sequence entries, part 290.
8144. gbvrt291.seq - Other vertebrate sequence entries, part 291.
8145. gbvrt292.seq - Other vertebrate sequence entries, part 292.
8146. gbvrt293.seq - Other vertebrate sequence entries, part 293.
8147. gbvrt294.seq - Other vertebrate sequence entries, part 294.
8148. gbvrt295.seq - Other vertebrate sequence entries, part 295.
8149. gbvrt296.seq - Other vertebrate sequence entries, part 296.
8150. gbvrt297.seq - Other vertebrate sequence entries, part 297.
8151. gbvrt298.seq - Other vertebrate sequence entries, part 298.
8152. gbvrt299.seq - Other vertebrate sequence entries, part 299.
8153. gbvrt3.seq - Other vertebrate sequence entries, part 3.
8154. gbvrt30.seq - Other vertebrate sequence entries, part 30.
8155. gbvrt300.seq - Other vertebrate sequence entries, part 300.
8156. gbvrt301.seq - Other vertebrate sequence entries, part 301.
8157. gbvrt302.seq - Other vertebrate sequence entries, part 302.
8158. gbvrt303.seq - Other vertebrate sequence entries, part 303.
8159. gbvrt304.seq - Other vertebrate sequence entries, part 304.
8160. gbvrt305.seq - Other vertebrate sequence entries, part 305.
8161. gbvrt306.seq - Other vertebrate sequence entries, part 306.
8162. gbvrt307.seq - Other vertebrate sequence entries, part 307.
8163. gbvrt308.seq - Other vertebrate sequence entries, part 308.
8164. gbvrt309.seq - Other vertebrate sequence entries, part 309.
8165. gbvrt31.seq - Other vertebrate sequence entries, part 31.
8166. gbvrt310.seq - Other vertebrate sequence entries, part 310.
8167. gbvrt311.seq - Other vertebrate sequence entries, part 311.
8168. gbvrt312.seq - Other vertebrate sequence entries, part 312.
8169. gbvrt313.seq - Other vertebrate sequence entries, part 313.
8170. gbvrt314.seq - Other vertebrate sequence entries, part 314.
8171. gbvrt315.seq - Other vertebrate sequence entries, part 315.
8172. gbvrt316.seq - Other vertebrate sequence entries, part 316.
8173. gbvrt317.seq - Other vertebrate sequence entries, part 317.
8174. gbvrt318.seq - Other vertebrate sequence entries, part 318.
8175. gbvrt319.seq - Other vertebrate sequence entries, part 319.
8176. gbvrt32.seq - Other vertebrate sequence entries, part 32.
8177. gbvrt320.seq - Other vertebrate sequence entries, part 320.
8178. gbvrt321.seq - Other vertebrate sequence entries, part 321.
8179. gbvrt322.seq - Other vertebrate sequence entries, part 322.
8180. gbvrt323.seq - Other vertebrate sequence entries, part 323.
8181. gbvrt324.seq - Other vertebrate sequence entries, part 324.
8182. gbvrt325.seq - Other vertebrate sequence entries, part 325.
8183. gbvrt326.seq - Other vertebrate sequence entries, part 326.
8184. gbvrt327.seq - Other vertebrate sequence entries, part 327.
8185. gbvrt328.seq - Other vertebrate sequence entries, part 328.
8186. gbvrt329.seq - Other vertebrate sequence entries, part 329.
8187. gbvrt33.seq - Other vertebrate sequence entries, part 33.
8188. gbvrt330.seq - Other vertebrate sequence entries, part 330.
8189. gbvrt331.seq - Other vertebrate sequence entries, part 331.
8190. gbvrt332.seq - Other vertebrate sequence entries, part 332.
8191. gbvrt333.seq - Other vertebrate sequence entries, part 333.
8192. gbvrt334.seq - Other vertebrate sequence entries, part 334.
8193. gbvrt335.seq - Other vertebrate sequence entries, part 335.
8194. gbvrt336.seq - Other vertebrate sequence entries, part 336.
8195. gbvrt337.seq - Other vertebrate sequence entries, part 337.
8196. gbvrt338.seq - Other vertebrate sequence entries, part 338.
8197. gbvrt339.seq - Other vertebrate sequence entries, part 339.
8198. gbvrt34.seq - Other vertebrate sequence entries, part 34.
8199. gbvrt340.seq - Other vertebrate sequence entries, part 340.
8200. gbvrt341.seq - Other vertebrate sequence entries, part 341.
8201. gbvrt342.seq - Other vertebrate sequence entries, part 342.
8202. gbvrt343.seq - Other vertebrate sequence entries, part 343.
8203. gbvrt344.seq - Other vertebrate sequence entries, part 344.
8204. gbvrt345.seq - Other vertebrate sequence entries, part 345.
8205. gbvrt346.seq - Other vertebrate sequence entries, part 346.
8206. gbvrt347.seq - Other vertebrate sequence entries, part 347.
8207. gbvrt348.seq - Other vertebrate sequence entries, part 348.
8208. gbvrt349.seq - Other vertebrate sequence entries, part 349.
8209. gbvrt35.seq - Other vertebrate sequence entries, part 35.
8210. gbvrt350.seq - Other vertebrate sequence entries, part 350.
8211. gbvrt351.seq - Other vertebrate sequence entries, part 351.
8212. gbvrt352.seq - Other vertebrate sequence entries, part 352.
8213. gbvrt353.seq - Other vertebrate sequence entries, part 353.
8214. gbvrt354.seq - Other vertebrate sequence entries, part 354.
8215. gbvrt355.seq - Other vertebrate sequence entries, part 355.
8216. gbvrt356.seq - Other vertebrate sequence entries, part 356.
8217. gbvrt357.seq - Other vertebrate sequence entries, part 357.
8218. gbvrt358.seq - Other vertebrate sequence entries, part 358.
8219. gbvrt359.seq - Other vertebrate sequence entries, part 359.
8220. gbvrt36.seq - Other vertebrate sequence entries, part 36.
8221. gbvrt360.seq - Other vertebrate sequence entries, part 360.
8222. gbvrt361.seq - Other vertebrate sequence entries, part 361.
8223. gbvrt362.seq - Other vertebrate sequence entries, part 362.
8224. gbvrt363.seq - Other vertebrate sequence entries, part 363.
8225. gbvrt364.seq - Other vertebrate sequence entries, part 364.
8226. gbvrt365.seq - Other vertebrate sequence entries, part 365.
8227. gbvrt366.seq - Other vertebrate sequence entries, part 366.
8228. gbvrt367.seq - Other vertebrate sequence entries, part 367.
8229. gbvrt368.seq - Other vertebrate sequence entries, part 368.
8230. gbvrt369.seq - Other vertebrate sequence entries, part 369.
8231. gbvrt37.seq - Other vertebrate sequence entries, part 37.
8232. gbvrt370.seq - Other vertebrate sequence entries, part 370.
8233. gbvrt371.seq - Other vertebrate sequence entries, part 371.
8234. gbvrt372.seq - Other vertebrate sequence entries, part 372.
8235. gbvrt373.seq - Other vertebrate sequence entries, part 373.
8236. gbvrt374.seq - Other vertebrate sequence entries, part 374.
8237. gbvrt375.seq - Other vertebrate sequence entries, part 375.
8238. gbvrt376.seq - Other vertebrate sequence entries, part 376.
8239. gbvrt377.seq - Other vertebrate sequence entries, part 377.
8240. gbvrt378.seq - Other vertebrate sequence entries, part 378.
8241. gbvrt379.seq - Other vertebrate sequence entries, part 379.
8242. gbvrt38.seq - Other vertebrate sequence entries, part 38.
8243. gbvrt380.seq - Other vertebrate sequence entries, part 380.
8244. gbvrt381.seq - Other vertebrate sequence entries, part 381.
8245. gbvrt382.seq - Other vertebrate sequence entries, part 382.
8246. gbvrt383.seq - Other vertebrate sequence entries, part 383.
8247. gbvrt384.seq - Other vertebrate sequence entries, part 384.
8248. gbvrt385.seq - Other vertebrate sequence entries, part 385.
8249. gbvrt386.seq - Other vertebrate sequence entries, part 386.
8250. gbvrt387.seq - Other vertebrate sequence entries, part 387.
8251. gbvrt388.seq - Other vertebrate sequence entries, part 388.
8252. gbvrt389.seq - Other vertebrate sequence entries, part 389.
8253. gbvrt39.seq - Other vertebrate sequence entries, part 39.
8254. gbvrt390.seq - Other vertebrate sequence entries, part 390.
8255. gbvrt391.seq - Other vertebrate sequence entries, part 391.
8256. gbvrt392.seq - Other vertebrate sequence entries, part 392.
8257. gbvrt393.seq - Other vertebrate sequence entries, part 393.
8258. gbvrt394.seq - Other vertebrate sequence entries, part 394.
8259. gbvrt395.seq - Other vertebrate sequence entries, part 395.
8260. gbvrt396.seq - Other vertebrate sequence entries, part 396.
8261. gbvrt397.seq - Other vertebrate sequence entries, part 397.
8262. gbvrt398.seq - Other vertebrate sequence entries, part 398.
8263. gbvrt399.seq - Other vertebrate sequence entries, part 399.
8264. gbvrt4.seq - Other vertebrate sequence entries, part 4.
8265. gbvrt40.seq - Other vertebrate sequence entries, part 40.
8266. gbvrt400.seq - Other vertebrate sequence entries, part 400.
8267. gbvrt401.seq - Other vertebrate sequence entries, part 401.
8268. gbvrt402.seq - Other vertebrate sequence entries, part 402.
8269. gbvrt403.seq - Other vertebrate sequence entries, part 403.
8270. gbvrt404.seq - Other vertebrate sequence entries, part 404.
8271. gbvrt405.seq - Other vertebrate sequence entries, part 405.
8272. gbvrt406.seq - Other vertebrate sequence entries, part 406.
8273. gbvrt407.seq - Other vertebrate sequence entries, part 407.
8274. gbvrt408.seq - Other vertebrate sequence entries, part 408.
8275. gbvrt409.seq - Other vertebrate sequence entries, part 409.
8276. gbvrt41.seq - Other vertebrate sequence entries, part 41.
8277. gbvrt410.seq - Other vertebrate sequence entries, part 410.
8278. gbvrt411.seq - Other vertebrate sequence entries, part 411.
8279. gbvrt412.seq - Other vertebrate sequence entries, part 412.
8280. gbvrt413.seq - Other vertebrate sequence entries, part 413.
8281. gbvrt414.seq - Other vertebrate sequence entries, part 414.
8282. gbvrt415.seq - Other vertebrate sequence entries, part 415.
8283. gbvrt416.seq - Other vertebrate sequence entries, part 416.
8284. gbvrt417.seq - Other vertebrate sequence entries, part 417.
8285. gbvrt418.seq - Other vertebrate sequence entries, part 418.
8286. gbvrt419.seq - Other vertebrate sequence entries, part 419.
8287. gbvrt42.seq - Other vertebrate sequence entries, part 42.
8288. gbvrt420.seq - Other vertebrate sequence entries, part 420.
8289. gbvrt421.seq - Other vertebrate sequence entries, part 421.
8290. gbvrt422.seq - Other vertebrate sequence entries, part 422.
8291. gbvrt423.seq - Other vertebrate sequence entries, part 423.
8292. gbvrt424.seq - Other vertebrate sequence entries, part 424.
8293. gbvrt425.seq - Other vertebrate sequence entries, part 425.
8294. gbvrt426.seq - Other vertebrate sequence entries, part 426.
8295. gbvrt427.seq - Other vertebrate sequence entries, part 427.
8296. gbvrt428.seq - Other vertebrate sequence entries, part 428.
8297. gbvrt429.seq - Other vertebrate sequence entries, part 429.
8298. gbvrt43.seq - Other vertebrate sequence entries, part 43.
8299. gbvrt430.seq - Other vertebrate sequence entries, part 430.
8300. gbvrt431.seq - Other vertebrate sequence entries, part 431.
8301. gbvrt432.seq - Other vertebrate sequence entries, part 432.
8302. gbvrt433.seq - Other vertebrate sequence entries, part 433.
8303. gbvrt434.seq - Other vertebrate sequence entries, part 434.
8304. gbvrt435.seq - Other vertebrate sequence entries, part 435.
8305. gbvrt436.seq - Other vertebrate sequence entries, part 436.
8306. gbvrt437.seq - Other vertebrate sequence entries, part 437.
8307. gbvrt438.seq - Other vertebrate sequence entries, part 438.
8308. gbvrt439.seq - Other vertebrate sequence entries, part 439.
8309. gbvrt44.seq - Other vertebrate sequence entries, part 44.
8310. gbvrt440.seq - Other vertebrate sequence entries, part 440.
8311. gbvrt441.seq - Other vertebrate sequence entries, part 441.
8312. gbvrt442.seq - Other vertebrate sequence entries, part 442.
8313. gbvrt443.seq - Other vertebrate sequence entries, part 443.
8314. gbvrt444.seq - Other vertebrate sequence entries, part 444.
8315. gbvrt445.seq - Other vertebrate sequence entries, part 445.
8316. gbvrt446.seq - Other vertebrate sequence entries, part 446.
8317. gbvrt447.seq - Other vertebrate sequence entries, part 447.
8318. gbvrt448.seq - Other vertebrate sequence entries, part 448.
8319. gbvrt449.seq - Other vertebrate sequence entries, part 449.
8320. gbvrt45.seq - Other vertebrate sequence entries, part 45.
8321. gbvrt450.seq - Other vertebrate sequence entries, part 450.
8322. gbvrt451.seq - Other vertebrate sequence entries, part 451.
8323. gbvrt452.seq - Other vertebrate sequence entries, part 452.
8324. gbvrt453.seq - Other vertebrate sequence entries, part 453.
8325. gbvrt454.seq - Other vertebrate sequence entries, part 454.
8326. gbvrt455.seq - Other vertebrate sequence entries, part 455.
8327. gbvrt456.seq - Other vertebrate sequence entries, part 456.
8328. gbvrt457.seq - Other vertebrate sequence entries, part 457.
8329. gbvrt458.seq - Other vertebrate sequence entries, part 458.
8330. gbvrt459.seq - Other vertebrate sequence entries, part 459.
8331. gbvrt46.seq - Other vertebrate sequence entries, part 46.
8332. gbvrt460.seq - Other vertebrate sequence entries, part 460.
8333. gbvrt461.seq - Other vertebrate sequence entries, part 461.
8334. gbvrt462.seq - Other vertebrate sequence entries, part 462.
8335. gbvrt463.seq - Other vertebrate sequence entries, part 463.
8336. gbvrt464.seq - Other vertebrate sequence entries, part 464.
8337. gbvrt465.seq - Other vertebrate sequence entries, part 465.
8338. gbvrt466.seq - Other vertebrate sequence entries, part 466.
8339. gbvrt467.seq - Other vertebrate sequence entries, part 467.
8340. gbvrt468.seq - Other vertebrate sequence entries, part 468.
8341. gbvrt469.seq - Other vertebrate sequence entries, part 469.
8342. gbvrt47.seq - Other vertebrate sequence entries, part 47.
8343. gbvrt470.seq - Other vertebrate sequence entries, part 470.
8344. gbvrt471.seq - Other vertebrate sequence entries, part 471.
8345. gbvrt472.seq - Other vertebrate sequence entries, part 472.
8346. gbvrt473.seq - Other vertebrate sequence entries, part 473.
8347. gbvrt474.seq - Other vertebrate sequence entries, part 474.
8348. gbvrt475.seq - Other vertebrate sequence entries, part 475.
8349. gbvrt476.seq - Other vertebrate sequence entries, part 476.
8350. gbvrt477.seq - Other vertebrate sequence entries, part 477.
8351. gbvrt478.seq - Other vertebrate sequence entries, part 478.
8352. gbvrt479.seq - Other vertebrate sequence entries, part 479.
8353. gbvrt48.seq - Other vertebrate sequence entries, part 48.
8354. gbvrt480.seq - Other vertebrate sequence entries, part 480.
8355. gbvrt481.seq - Other vertebrate sequence entries, part 481.
8356. gbvrt482.seq - Other vertebrate sequence entries, part 482.
8357. gbvrt483.seq - Other vertebrate sequence entries, part 483.
8358. gbvrt484.seq - Other vertebrate sequence entries, part 484.
8359. gbvrt49.seq - Other vertebrate sequence entries, part 49.
8360. gbvrt5.seq - Other vertebrate sequence entries, part 5.
8361. gbvrt50.seq - Other vertebrate sequence entries, part 50.
8362. gbvrt51.seq - Other vertebrate sequence entries, part 51.
8363. gbvrt52.seq - Other vertebrate sequence entries, part 52.
8364. gbvrt53.seq - Other vertebrate sequence entries, part 53.
8365. gbvrt54.seq - Other vertebrate sequence entries, part 54.
8366. gbvrt55.seq - Other vertebrate sequence entries, part 55.
8367. gbvrt56.seq - Other vertebrate sequence entries, part 56.
8368. gbvrt57.seq - Other vertebrate sequence entries, part 57.
8369. gbvrt58.seq - Other vertebrate sequence entries, part 58.
8370. gbvrt59.seq - Other vertebrate sequence entries, part 59.
8371. gbvrt6.seq - Other vertebrate sequence entries, part 6.
8372. gbvrt60.seq - Other vertebrate sequence entries, part 60.
8373. gbvrt61.seq - Other vertebrate sequence entries, part 61.
8374. gbvrt62.seq - Other vertebrate sequence entries, part 62.
8375. gbvrt63.seq - Other vertebrate sequence entries, part 63.
8376. gbvrt64.seq - Other vertebrate sequence entries, part 64.
8377. gbvrt65.seq - Other vertebrate sequence entries, part 65.
8378. gbvrt66.seq - Other vertebrate sequence entries, part 66.
8379. gbvrt67.seq - Other vertebrate sequence entries, part 67.
8380. gbvrt68.seq - Other vertebrate sequence entries, part 68.
8381. gbvrt69.seq - Other vertebrate sequence entries, part 69.
8382. gbvrt7.seq - Other vertebrate sequence entries, part 7.
8383. gbvrt70.seq - Other vertebrate sequence entries, part 70.
8384. gbvrt71.seq - Other vertebrate sequence entries, part 71.
8385. gbvrt72.seq - Other vertebrate sequence entries, part 72.
8386. gbvrt73.seq - Other vertebrate sequence entries, part 73.
8387. gbvrt74.seq - Other vertebrate sequence entries, part 74.
8388. gbvrt75.seq - Other vertebrate sequence entries, part 75.
8389. gbvrt76.seq - Other vertebrate sequence entries, part 76.
8390. gbvrt77.seq - Other vertebrate sequence entries, part 77.
8391. gbvrt78.seq - Other vertebrate sequence entries, part 78.
8392. gbvrt79.seq - Other vertebrate sequence entries, part 79.
8393. gbvrt8.seq - Other vertebrate sequence entries, part 8.
8394. gbvrt80.seq - Other vertebrate sequence entries, part 80.
8395. gbvrt81.seq - Other vertebrate sequence entries, part 81.
8396. gbvrt82.seq - Other vertebrate sequence entries, part 82.
8397. gbvrt83.seq - Other vertebrate sequence entries, part 83.
8398. gbvrt84.seq - Other vertebrate sequence entries, part 84.
8399. gbvrt85.seq - Other vertebrate sequence entries, part 85.
8400. gbvrt86.seq - Other vertebrate sequence entries, part 86.
8401. gbvrt87.seq - Other vertebrate sequence entries, part 87.
8402. gbvrt88.seq - Other vertebrate sequence entries, part 88.
8403. gbvrt89.seq - Other vertebrate sequence entries, part 89.
8404. gbvrt9.seq - Other vertebrate sequence entries, part 9.
8405. gbvrt90.seq - Other vertebrate sequence entries, part 90.
8406. gbvrt91.seq - Other vertebrate sequence entries, part 91.
8407. gbvrt92.seq - Other vertebrate sequence entries, part 92.
8408. gbvrt93.seq - Other vertebrate sequence entries, part 93.
8409. gbvrt94.seq - Other vertebrate sequence entries, part 94.
8410. gbvrt95.seq - Other vertebrate sequence entries, part 95.
8411. gbvrt96.seq - Other vertebrate sequence entries, part 96.
8412. gbvrt97.seq - Other vertebrate sequence entries, part 97.
8413. gbvrt98.seq - Other vertebrate sequence entries, part 98.
8414. gbvrt99.seq - Other vertebrate sequence entries, part 99.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 258.0 flatfiles require roughly 3992 GB,
including the sequence files and the *.txt files.
The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
496241101 gbbct1.seq
494252260 gbbct10.seq
495814844 gbbct100.seq
480796820 gbbct1000.se
497715135 gbbct1001.se
50153914 gbbct1002.se
496306831 gbbct1003.se
497542026 gbbct1004.se
499039676 gbbct1005.se
243471358 gbbct1006.se
492627215 gbbct1007.se
496920897 gbbct1008.se
498726005 gbbct1009.se
498718759 gbbct101.seq
498558255 gbbct1010.se
105681494 gbbct1011.se
499380128 gbbct1012.se
499045536 gbbct1013.se
496138230 gbbct1014.se
480917189 gbbct1015.se
51241208 gbbct1016.se
107871708 gbbct1017.se
499999868 gbbct1018.se
499999638 gbbct1019.se
499103887 gbbct102.seq
419322867 gbbct1020.se
499961763 gbbct1021.se
499337029 gbbct1022.se
499998021 gbbct1023.se
499837691 gbbct1024.se
493066901 gbbct1025.se
160462021 gbbct1026.se
496764111 gbbct1027.se
498809575 gbbct1028.se
497701955 gbbct1029.se
261686726 gbbct103.seq
497288384 gbbct1030.se
497076187 gbbct1031.se
490313192 gbbct1032.se
147313851 gbbct1033.se
498338739 gbbct1034.se
498433841 gbbct1035.se
495474043 gbbct1036.se
497231916 gbbct1037.se
122463870 gbbct1038.se
499023843 gbbct1039.se
498131287 gbbct104.seq
494495174 gbbct1040.se
496926721 gbbct1041.se
491130026 gbbct1042.se
498653661 gbbct1043.se
499979298 gbbct1044.se
29639934 gbbct1045.se
499519598 gbbct105.seq
498963442 gbbct106.seq
488108603 gbbct107.seq
397950750 gbbct108.seq
498261614 gbbct109.seq
498490577 gbbct11.seq
492775885 gbbct110.seq
495523592 gbbct111.seq
300972567 gbbct112.seq
491271704 gbbct113.seq
498541527 gbbct114.seq
498106214 gbbct115.seq
92795209 gbbct116.seq
489628483 gbbct117.seq
499324230 gbbct118.seq
499931720 gbbct119.seq
497844515 gbbct12.seq
389028534 gbbct120.seq
499874269 gbbct121.seq
499836580 gbbct122.seq
499886211 gbbct123.seq
499926790 gbbct124.seq
13835705 gbbct125.seq
493589468 gbbct126.seq
494743943 gbbct127.seq
495417090 gbbct128.seq
491069782 gbbct129.seq
33498510 gbbct13.seq
195549944 gbbct130.seq
494137325 gbbct131.seq
492532713 gbbct132.seq
493222696 gbbct133.seq
497234652 gbbct134.seq
99480571 gbbct135.seq
499011110 gbbct136.seq
494100520 gbbct137.seq
498830214 gbbct138.seq
333294159 gbbct139.seq
487420526 gbbct14.seq
490710401 gbbct140.seq
498618665 gbbct141.seq
488692929 gbbct142.seq
494287749 gbbct143.seq
18986455 gbbct144.seq
495983649 gbbct145.seq
489371949 gbbct146.seq
487156697 gbbct147.seq
496236444 gbbct148.seq
497104631 gbbct149.seq
487741973 gbbct15.seq
488626816 gbbct150.seq
425698526 gbbct151.seq
498289543 gbbct152.seq
489448215 gbbct153.seq
499735001 gbbct154.seq
461302578 gbbct155.seq
495776236 gbbct156.seq
493829919 gbbct157.seq
491661534 gbbct158.seq
498685717 gbbct159.seq
494172943 gbbct16.seq
499806144 gbbct160.seq
147979388 gbbct161.seq
497197592 gbbct162.seq
494838868 gbbct163.seq
493252149 gbbct164.seq
494938562 gbbct165.seq
404787642 gbbct166.seq
489367719 gbbct167.seq
490447295 gbbct168.seq
488202247 gbbct169.seq
494426612 gbbct17.seq
496590180 gbbct170.seq
497571156 gbbct171.seq
443840945 gbbct172.seq
496930744 gbbct173.seq
494967761 gbbct174.seq
487709184 gbbct175.seq
490190213 gbbct176.seq
496549067 gbbct177.seq
496436684 gbbct178.seq
204323486 gbbct179.seq
128500932 gbbct18.seq
494705227 gbbct180.seq
491514326 gbbct181.seq
499168832 gbbct182.seq
486267941 gbbct183.seq
497456534 gbbct184.seq
491062226 gbbct185.seq
495175628 gbbct186.seq
498913498 gbbct187.seq
23086762 gbbct188.seq
493968471 gbbct189.seq
494541128 gbbct19.seq
491061938 gbbct190.seq
494911004 gbbct191.seq
495985799 gbbct192.seq
204649716 gbbct193.seq
493675946 gbbct194.seq
491173639 gbbct195.seq
499375502 gbbct196.seq
273476043 gbbct197.seq
495005792 gbbct198.seq
495932756 gbbct199.seq
496211469 gbbct2.seq
496123472 gbbct20.seq
489789976 gbbct200.seq
303707270 gbbct201.seq
499227728 gbbct202.seq
499996866 gbbct203.seq
495765195 gbbct204.seq
496021886 gbbct205.seq
78326746 gbbct206.seq
498036931 gbbct207.seq
499411139 gbbct208.seq
492695626 gbbct209.seq
490072401 gbbct21.seq
498015700 gbbct210.seq
490659501 gbbct211.seq
223651078 gbbct212.seq
498767435 gbbct213.seq
497238753 gbbct214.seq
494572643 gbbct215.seq
497330392 gbbct216.seq
275862694 gbbct217.seq
495095452 gbbct218.seq
495971840 gbbct219.seq
499143021 gbbct22.seq
496465165 gbbct220.seq
499477133 gbbct221.seq
258503230 gbbct222.seq
499816819 gbbct223.seq
497425903 gbbct224.seq
497029407 gbbct225.seq
497534555 gbbct226.seq
440229874 gbbct227.seq
499335068 gbbct228.seq
499194801 gbbct229.seq
147824787 gbbct23.seq
491641879 gbbct230.seq
492379084 gbbct231.seq
499896235 gbbct232.seq
493328699 gbbct233.seq
411207392 gbbct234.seq
497109684 gbbct235.seq
493797230 gbbct236.seq
496714946 gbbct237.seq
378276833 gbbct238.seq
484833405 gbbct239.seq
492482053 gbbct24.seq
495933660 gbbct240.seq
496841588 gbbct241.seq
499799734 gbbct242.seq
241101614 gbbct243.seq
494770125 gbbct244.seq
490933033 gbbct245.seq
491178264 gbbct246.seq
207236529 gbbct247.seq
493892730 gbbct248.seq
496233151 gbbct249.seq
490124725 gbbct25.seq
499658513 gbbct250.seq
495112805 gbbct251.seq
184138816 gbbct252.seq
494063188 gbbct253.seq
488281809 gbbct254.seq
489824741 gbbct255.seq
488530592 gbbct256.seq
157432032 gbbct257.seq
483160902 gbbct258.seq
493212872 gbbct259.seq
498215112 gbbct26.seq
489922676 gbbct260.seq
495741984 gbbct261.seq
65305187 gbbct262.seq
492193975 gbbct263.seq
487559489 gbbct264.seq
492444546 gbbct265.seq
467375886 gbbct266.seq
498159017 gbbct267.seq
490705586 gbbct268.seq
496101821 gbbct269.seq
492065538 gbbct27.seq
494853071 gbbct270.seq
496630909 gbbct271.seq
145951585 gbbct272.seq
492031399 gbbct273.seq
498468913 gbbct274.seq
484960307 gbbct275.seq
462509857 gbbct276.seq
497610573 gbbct277.seq
496248013 gbbct278.seq
496576110 gbbct279.seq
484403607 gbbct28.seq
492200318 gbbct280.seq
79411871 gbbct281.seq
496061710 gbbct282.seq
492890776 gbbct283.seq
496405538 gbbct284.seq
492436771 gbbct285.seq
491980814 gbbct286.seq
499779517 gbbct287.seq
493162864 gbbct288.seq
301876934 gbbct289.seq
60915698 gbbct29.seq
491163439 gbbct290.seq
488410892 gbbct291.seq
499068858 gbbct292.seq
423342840 gbbct293.seq
497188760 gbbct294.seq
496648115 gbbct295.seq
496913433 gbbct296.seq
469193865 gbbct297.seq
495339097 gbbct298.seq
499422165 gbbct299.seq
306965748 gbbct3.seq
490496973 gbbct30.seq
499643473 gbbct300.seq
499684846 gbbct301.seq
41768798 gbbct302.seq
496934507 gbbct303.seq
495160491 gbbct304.seq
499828705 gbbct305.seq
494345225 gbbct306.seq
96357788 gbbct307.seq
498905666 gbbct308.seq
490840163 gbbct309.seq
493807118 gbbct31.seq
495726066 gbbct310.seq
488834247 gbbct311.seq
489385997 gbbct312.seq
489621383 gbbct313.seq
394578864 gbbct314.seq
492233209 gbbct315.seq
490787305 gbbct316.seq
493826685 gbbct317.seq
499495355 gbbct318.seq
419419915 gbbct319.seq
480651846 gbbct32.seq
493089434 gbbct320.seq
494093409 gbbct321.seq
489966741 gbbct322.seq
493459402 gbbct323.seq
449948014 gbbct324.seq
498703691 gbbct325.seq
497743974 gbbct326.seq
489574438 gbbct327.seq
495982538 gbbct328.seq
498393188 gbbct329.seq
497455838 gbbct33.seq
23849985 gbbct330.seq
498785676 gbbct331.seq
497116268 gbbct332.seq
497441848 gbbct333.seq
497888944 gbbct334.seq
404399390 gbbct335.seq
491217158 gbbct336.seq
490815971 gbbct337.seq
491231601 gbbct338.seq
495603083 gbbct339.seq
156444887 gbbct34.seq
499559349 gbbct340.seq
172565087 gbbct341.seq
495566508 gbbct342.seq
494438770 gbbct343.seq
495091042 gbbct344.seq
498263560 gbbct345.seq
263588689 gbbct346.seq
498444518 gbbct347.seq
488346394 gbbct348.seq
490825977 gbbct349.seq
489377654 gbbct35.seq
490001722 gbbct350.seq
498584108 gbbct351.seq
34513818 gbbct352.seq
494686700 gbbct353.seq
492315531 gbbct354.seq
497177727 gbbct355.seq
498199974 gbbct356.seq
496450825 gbbct357.seq
499463041 gbbct358.seq
496402137 gbbct359.seq
495704309 gbbct36.seq
380192188 gbbct360.seq
497476174 gbbct361.seq
497184589 gbbct362.seq
490324935 gbbct363.seq
499750219 gbbct364.seq
494815524 gbbct365.seq
494368852 gbbct366.seq
296175547 gbbct367.seq
499934220 gbbct368.seq
494918401 gbbct369.seq
493304628 gbbct37.seq
499105295 gbbct370.seq
489422027 gbbct371.seq
497843962 gbbct372.seq
63763834 gbbct373.seq
499660345 gbbct374.seq
493536254 gbbct375.seq
493525083 gbbct376.seq
488163954 gbbct377.seq
499090333 gbbct378.seq
499519156 gbbct379.seq
497629897 gbbct38.seq
498494475 gbbct380.seq
44978842 gbbct381.seq
496486894 gbbct382.seq
499584365 gbbct383.seq
493277877 gbbct384.seq
498905652 gbbct385.seq
239477237 gbbct386.seq
498729343 gbbct387.seq
490199157 gbbct388.seq
491454197 gbbct389.seq
344665847 gbbct39.seq
499237446 gbbct390.seq
169554493 gbbct391.seq
497759841 gbbct392.seq
496982014 gbbct393.seq
492202069 gbbct394.seq
496555435 gbbct395.seq
497898531 gbbct396.seq
488975488 gbbct397.seq
489542434 gbbct398.seq
252733250 gbbct399.seq
394753536 gbbct4.seq
486859066 gbbct40.seq
497028059 gbbct400.seq
495273111 gbbct401.seq
489177325 gbbct402.seq
490129819 gbbct403.seq
492334481 gbbct404.seq
492636940 gbbct405.seq
472304767 gbbct406.seq
489741626 gbbct407.seq
489855451 gbbct408.seq
487046950 gbbct409.seq
493687634 gbbct41.seq
487809563 gbbct410.seq
489424902 gbbct411.seq
285123476 gbbct412.seq
496006267 gbbct413.seq
499738859 gbbct414.seq
498949447 gbbct415.seq
499696916 gbbct416.seq
499675367 gbbct417.seq
493594960 gbbct418.seq
281241163 gbbct419.seq
498207174 gbbct42.seq
492474806 gbbct420.seq
493348219 gbbct421.seq
488235737 gbbct422.seq
499804088 gbbct423.seq
497607941 gbbct424.seq
493329202 gbbct425.seq
489094924 gbbct426.seq
218287198 gbbct427.seq
497624057 gbbct428.seq
499092518 gbbct429.seq
499436046 gbbct43.seq
495168504 gbbct430.seq
498411623 gbbct431.seq
494851599 gbbct432.seq
97103164 gbbct433.seq
484011110 gbbct434.seq
499765651 gbbct435.seq
496608361 gbbct436.seq
492466540 gbbct437.seq
492815902 gbbct438.seq
499952027 gbbct439.seq
116594191 gbbct44.seq
486127973 gbbct440.seq
496090339 gbbct441.seq
496388697 gbbct442.seq
308316949 gbbct443.seq
495477408 gbbct444.seq
492644393 gbbct445.seq
497637802 gbbct446.seq
486496048 gbbct447.seq
411106651 gbbct448.seq
492341455 gbbct449.seq
499427339 gbbct45.seq
496407771 gbbct450.seq
493158623 gbbct451.seq
488758804 gbbct452.seq
164173209 gbbct453.seq
494159514 gbbct454.seq
494444974 gbbct455.seq
493700863 gbbct456.seq
499969675 gbbct457.seq
27014882 gbbct458.seq
493433738 gbbct459.seq
489001679 gbbct46.seq
492700729 gbbct460.seq
497334211 gbbct461.seq
497146734 gbbct462.seq
497594418 gbbct463.seq
328581930 gbbct464.seq
498313678 gbbct465.seq
498681410 gbbct466.seq
499281241 gbbct467.seq
489146175 gbbct468.seq
496938154 gbbct469.seq
493930026 gbbct47.seq
497700245 gbbct470.seq
326142728 gbbct471.seq
497824572 gbbct472.seq
492957915 gbbct473.seq
499833109 gbbct474.seq
493523696 gbbct475.seq
86825136 gbbct476.seq
485664252 gbbct477.seq
492762413 gbbct478.seq
493976820 gbbct479.seq
422790519 gbbct48.seq
498624920 gbbct480.seq
495051074 gbbct481.seq
483776187 gbbct482.seq
492628986 gbbct483.seq
497575580 gbbct484.seq
491147927 gbbct485.seq
495372480 gbbct486.seq
172098633 gbbct487.seq
488399361 gbbct488.seq
497609771 gbbct489.seq
495539968 gbbct49.seq
493602123 gbbct490.seq
499477169 gbbct491.seq
490837891 gbbct492.seq
457708752 gbbct493.seq
494383928 gbbct494.seq
493402330 gbbct495.seq
495774412 gbbct496.seq
498340162 gbbct497.seq
225257034 gbbct498.seq
499853338 gbbct499.seq
440881083 gbbct5.seq
496309051 gbbct50.seq
493893832 gbbct500.seq
494717321 gbbct501.seq
494636761 gbbct502.seq
66755510 gbbct503.seq
499644869 gbbct504.seq
495493908 gbbct505.seq
496184888 gbbct506.seq
493693775 gbbct507.seq
189607601 gbbct508.seq
490781428 gbbct509.seq
495640398 gbbct51.seq
491825581 gbbct510.seq
497965134 gbbct511.seq
493465752 gbbct512.seq
495756445 gbbct513.seq
489031294 gbbct514.seq
324241289 gbbct515.seq
496815387 gbbct516.seq
495894736 gbbct517.seq
496919221 gbbct518.seq
498915354 gbbct519.seq
496665624 gbbct52.seq
490956192 gbbct520.seq
487289399 gbbct521.seq
499232971 gbbct522.seq
20072397 gbbct523.seq
496504166 gbbct524.seq
494196865 gbbct525.seq
489587853 gbbct526.seq
497825225 gbbct527.seq
129292438 gbbct528.seq
495729672 gbbct529.seq
489285815 gbbct53.seq
499951839 gbbct530.seq
491684752 gbbct531.seq
493977412 gbbct532.seq
156474307 gbbct533.seq
489613743 gbbct534.seq
496013526 gbbct535.seq
497792053 gbbct536.seq
492186062 gbbct537.seq
493342388 gbbct538.seq
497350421 gbbct539.seq
496512805 gbbct54.seq
489375163 gbbct540.seq
200235524 gbbct541.seq
498069918 gbbct542.seq
491392809 gbbct543.seq
493157751 gbbct544.seq
499563313 gbbct545.seq
497624432 gbbct546.seq
499917967 gbbct547.seq
52010506 gbbct548.seq
498600295 gbbct549.seq
340583562 gbbct55.seq
499966912 gbbct550.seq
498301065 gbbct551.seq
489056192 gbbct552.seq
497247067 gbbct553.seq
182974922 gbbct554.seq
499605223 gbbct555.seq
498413363 gbbct556.seq
494321141 gbbct557.seq
488737991 gbbct558.seq
493654191 gbbct559.seq
21423001 gbbct56.seq
492441672 gbbct560.seq
227319570 gbbct561.seq
489360452 gbbct562.seq
496232132 gbbct563.seq
499644043 gbbct564.seq
499053517 gbbct565.seq
344855568 gbbct566.seq
497665663 gbbct567.seq
498846279 gbbct568.seq
496910342 gbbct569.seq
38670727 gbbct57.seq
497597094 gbbct570.seq
490846285 gbbct571.seq
441215744 gbbct572.seq
499932786 gbbct573.seq
492753892 gbbct574.seq
490407067 gbbct575.seq
497293274 gbbct576.seq
496382627 gbbct577.seq
65191689 gbbct578.seq
491480381 gbbct579.seq
499548136 gbbct58.seq
498032816 gbbct580.seq
496802029 gbbct581.seq
499998074 gbbct582.seq
492895223 gbbct583.seq
84038456 gbbct584.seq
498299128 gbbct585.seq
497665413 gbbct586.seq
495789144 gbbct587.seq
498920661 gbbct588.seq
490859449 gbbct589.seq
484470122 gbbct59.seq
497455436 gbbct590.seq
291276480 gbbct591.seq
499291931 gbbct592.seq
496184725 gbbct593.seq
497683761 gbbct594.seq
494237521 gbbct595.seq
493055724 gbbct596.seq
370271817 gbbct597.seq
496708522 gbbct598.seq
497463199 gbbct599.seq
102348177 gbbct6.seq
495470250 gbbct60.seq
497716036 gbbct600.seq
499783400 gbbct601.seq
498704314 gbbct602.seq
493520927 gbbct603.seq
412974908 gbbct604.seq
497836994 gbbct605.seq
489403527 gbbct606.seq
493049658 gbbct607.seq
497002285 gbbct608.seq
497776487 gbbct609.seq
480119338 gbbct61.seq
365135097 gbbct610.seq
495689833 gbbct611.seq
497846768 gbbct612.seq
496499719 gbbct613.seq
499486113 gbbct614.seq
308153190 gbbct615.seq
494009509 gbbct616.seq
494634341 gbbct617.seq
493680575 gbbct618.seq
495249561 gbbct619.seq
499782323 gbbct62.seq
336973710 gbbct620.seq
490780670 gbbct621.seq
491958302 gbbct622.seq
494533969 gbbct623.seq
496675503 gbbct624.seq
498054875 gbbct625.seq
492141129 gbbct626.seq
492200118 gbbct627.seq
260293738 gbbct628.seq
498744177 gbbct629.seq
499379725 gbbct63.seq
496347086 gbbct630.seq
497967870 gbbct631.seq
499466490 gbbct632.seq
488319559 gbbct633.seq
498810393 gbbct634.seq
492145711 gbbct635.seq
495613924 gbbct636.seq
499638486 gbbct637.seq
497662636 gbbct638.seq
494330627 gbbct639.seq
496319155 gbbct64.seq
490292590 gbbct640.seq
184104568 gbbct641.seq
489897268 gbbct642.seq
487794761 gbbct643.seq
490412388 gbbct644.seq
498964740 gbbct645.seq
86369099 gbbct646.seq
494346868 gbbct647.seq
497781130 gbbct648.seq
493732161 gbbct649.seq
493547564 gbbct65.seq
498905950 gbbct650.seq
490031347 gbbct651.seq
53951819 gbbct652.seq
492741701 gbbct653.seq
499845563 gbbct654.seq
499763806 gbbct655.seq
496790691 gbbct656.seq
493465897 gbbct657.seq
154427803 gbbct658.seq
483663160 gbbct659.seq
496582196 gbbct66.seq
498882254 gbbct660.seq
488127506 gbbct661.seq
495179308 gbbct662.seq
85152487 gbbct663.seq
492651932 gbbct664.seq
490980096 gbbct665.seq
489246744 gbbct666.seq
499239895 gbbct667.seq
428838234 gbbct668.seq
494596873 gbbct669.seq
328859563 gbbct67.seq
489081027 gbbct670.seq
494847475 gbbct671.seq
492569689 gbbct672.seq
248977229 gbbct673.seq
492971725 gbbct674.seq
499137379 gbbct675.seq
499551466 gbbct676.seq
494410376 gbbct677.seq
498268588 gbbct678.seq
415835033 gbbct679.seq
496358896 gbbct68.seq
498585011 gbbct680.seq
497874889 gbbct681.seq
488404699 gbbct682.seq
494091530 gbbct683.seq
428215526 gbbct684.seq
495687092 gbbct685.seq
495588266 gbbct686.seq
498239790 gbbct687.seq
489905336 gbbct688.seq
496000503 gbbct689.seq
491310643 gbbct69.seq
490434408 gbbct690.seq
497452305 gbbct691.seq
119869954 gbbct692.seq
489500728 gbbct693.seq
499400864 gbbct694.seq
489883836 gbbct695.seq
491499364 gbbct696.seq
497510258 gbbct697.seq
149306247 gbbct698.seq
489374489 gbbct699.seq
282571942 gbbct7.seq
499896947 gbbct70.seq
497451108 gbbct700.seq
496794592 gbbct701.seq
493494360 gbbct702.seq
384506381 gbbct703.seq
497699913 gbbct704.seq
488532823 gbbct705.seq
498993926 gbbct706.seq
491309823 gbbct707.seq
488614400 gbbct708.seq
497599214 gbbct709.seq
492176821 gbbct71.seq
278252739 gbbct710.seq
499130249 gbbct711.seq
496018987 gbbct712.seq
497461004 gbbct713.seq
498976847 gbbct714.seq
200306245 gbbct715.seq
495669235 gbbct716.seq
496736764 gbbct717.seq
499472623 gbbct718.seq
496906539 gbbct719.seq
495817474 gbbct72.seq
265602948 gbbct720.seq
489239688 gbbct721.seq
495250207 gbbct722.seq
496364572 gbbct723.seq
498966757 gbbct724.seq
498471678 gbbct725.seq
498901258 gbbct726.seq
196660177 gbbct727.seq
491706492 gbbct728.seq
498111677 gbbct729.seq
356563030 gbbct73.seq
498941051 gbbct730.seq
494543699 gbbct731.seq
497093295 gbbct732.seq
434899859 gbbct733.seq
496927908 gbbct734.seq
499598277 gbbct735.seq
498953975 gbbct736.seq
495530526 gbbct737.seq
264655339 gbbct738.seq
493929931 gbbct739.seq
499974746 gbbct74.seq
498576732 gbbct740.seq
498051138 gbbct741.seq
499598046 gbbct742.seq
226814323 gbbct743.seq
493216568 gbbct744.seq
499473125 gbbct745.seq
497057366 gbbct746.seq
498073396 gbbct747.seq
492582914 gbbct748.seq
373304571 gbbct749.seq
492293310 gbbct75.seq
492931446 gbbct750.seq
492021963 gbbct751.seq
498652586 gbbct752.seq
499980018 gbbct753.seq
494363884 gbbct754.seq
497168551 gbbct755.seq
490315509 gbbct756.seq
59321058 gbbct757.seq
492675721 gbbct758.seq
495490245 gbbct759.seq
489450345 gbbct76.seq
499868170 gbbct760.seq
498441000 gbbct761.seq
498057550 gbbct762.seq
457103844 gbbct763.seq
493723299 gbbct764.seq
489427543 gbbct765.seq
493543573 gbbct766.seq
499904919 gbbct767.seq
492366323 gbbct768.seq
147332336 gbbct769.seq
497371783 gbbct77.seq
493624806 gbbct770.seq
495504226 gbbct771.seq
499573690 gbbct772.seq
497909072 gbbct773.seq
492953746 gbbct774.seq
372003105 gbbct775.seq
494279761 gbbct776.seq
499880264 gbbct777.seq
486018381 gbbct778.seq
499983691 gbbct779.seq
499930518 gbbct78.seq
498403329 gbbct780.seq
494361191 gbbct781.seq
237536222 gbbct782.seq
499874278 gbbct783.seq
497976550 gbbct784.seq
484214461 gbbct785.seq
491978696 gbbct786.seq
137842023 gbbct787.seq
475197796 gbbct788.seq
489749607 gbbct789.seq
495180673 gbbct79.seq
499221000 gbbct790.seq
498397732 gbbct791.seq
113736284 gbbct792.seq
495181148 gbbct793.seq
499983744 gbbct794.seq
499737975 gbbct795.seq
494858412 gbbct796.seq
144089808 gbbct797.seq
491812002 gbbct798.seq
496686184 gbbct799.seq
493056976 gbbct8.seq
112142536 gbbct80.seq
499389042 gbbct800.seq
481060999 gbbct801.seq
499688714 gbbct802.seq
88447818 gbbct803.seq
488652341 gbbct804.seq
489814941 gbbct805.seq
495691716 gbbct806.seq
497968084 gbbct807.seq
414029256 gbbct808.seq
496271321 gbbct809.seq
498097184 gbbct81.seq
496995140 gbbct810.seq
496305207 gbbct811.seq
492395486 gbbct812.seq
496704950 gbbct813.seq
409649172 gbbct814.seq
494280477 gbbct815.seq
496563524 gbbct816.seq
495366113 gbbct817.seq
498391514 gbbct818.seq
496957434 gbbct819.seq
499071354 gbbct82.seq
488927931 gbbct820.seq
304951676 gbbct821.seq
488631829 gbbct822.seq
496429387 gbbct823.seq
494586716 gbbct824.seq
497606822 gbbct825.seq
484493107 gbbct826.seq
78036616 gbbct827.seq
493018852 gbbct828.seq
495302543 gbbct829.seq
496564068 gbbct83.seq
489143812 gbbct830.seq
491333964 gbbct831.seq
480233625 gbbct832.seq
175201164 gbbct833.seq
499092641 gbbct834.seq
496510365 gbbct835.seq
497718544 gbbct836.seq
489190437 gbbct837.seq
493487558 gbbct838.seq
242509873 gbbct839.seq
497567909 gbbct84.seq
497328312 gbbct840.seq
489645502 gbbct841.seq
498161856 gbbct842.seq
498959908 gbbct843.seq
489259473 gbbct844.seq
483826963 gbbct845.seq
494427385 gbbct846.seq
495035121 gbbct847.seq
491119581 gbbct848.seq
492214378 gbbct849.seq
499752728 gbbct85.seq
491509735 gbbct850.seq
59947175 gbbct851.seq
474770545 gbbct852.seq
493659069 gbbct853.seq
495352697 gbbct854.seq
493185049 gbbct855.seq
491928100 gbbct856.seq
380145933 gbbct857.seq
491609792 gbbct858.seq
499633087 gbbct859.seq
490382246 gbbct86.seq
488832718 gbbct860.seq
486028854 gbbct861.seq
491413144 gbbct862.seq
123164606 gbbct863.seq
496623342 gbbct864.seq
492557469 gbbct865.seq
495404208 gbbct866.seq
497162730 gbbct867.seq
495362060 gbbct868.seq
496155925 gbbct869.seq
257413042 gbbct87.seq
474105855 gbbct870.seq
495141342 gbbct871.seq
496584187 gbbct872.seq
476964292 gbbct873.seq
497252285 gbbct874.seq
179638779 gbbct875.seq
499387910 gbbct876.seq
499176175 gbbct877.seq
499971777 gbbct878.seq
489832515 gbbct879.seq
499969489 gbbct88.seq
494750146 gbbct880.seq
490379122 gbbct881.seq
343089174 gbbct882.seq
491472701 gbbct883.seq
497174740 gbbct884.seq
483898363 gbbct885.seq
493897872 gbbct886.seq
497721226 gbbct887.seq
14051986 gbbct888.seq
499429408 gbbct889.seq
495193976 gbbct89.seq
493812369 gbbct890.seq
494193321 gbbct891.seq
495337068 gbbct892.seq
495321233 gbbct893.seq
265251432 gbbct894.seq
498146547 gbbct895.seq
496816292 gbbct896.seq
492243999 gbbct897.seq
490400681 gbbct898.seq
497848465 gbbct899.seq
493341944 gbbct9.seq
486287671 gbbct90.seq
499651763 gbbct900.seq
68570730 gbbct901.seq
496386991 gbbct902.seq
493591155 gbbct903.seq
493300897 gbbct904.seq
487599546 gbbct905.seq
499871547 gbbct906.seq
152492 gbbct907.seq
498669515 gbbct908.seq
497062913 gbbct909.seq
493211142 gbbct91.seq
490049848 gbbct910.seq
490149824 gbbct911.seq
115167626 gbbct912.seq
498591768 gbbct913.seq
490551253 gbbct914.seq
494287213 gbbct915.seq
494871169 gbbct916.seq
271930272 gbbct917.seq
489935343 gbbct918.seq
497895169 gbbct919.seq
464468094 gbbct92.seq
492559172 gbbct920.seq
499557268 gbbct921.seq
174449883 gbbct922.seq
498577838 gbbct923.seq
492730899 gbbct924.seq
490317729 gbbct925.seq
487483632 gbbct926.seq
487481884 gbbct927.seq
498454659 gbbct928.seq
496317252 gbbct929.seq
490192808 gbbct93.seq
499752651 gbbct930.seq
126932133 gbbct931.seq
489770747 gbbct932.seq
492268114 gbbct933.seq
489569438 gbbct934.seq
490559827 gbbct935.seq
278528542 gbbct936.seq
489150929 gbbct937.seq
494387007 gbbct938.seq
498395860 gbbct939.seq
489868611 gbbct94.seq
497742114 gbbct940.seq
111595418 gbbct941.seq
492006187 gbbct942.seq
488721760 gbbct943.seq
486497870 gbbct944.seq
499968571 gbbct945.seq
226621851 gbbct946.seq
305005184 gbbct947.seq
6890748 gbbct948.seq
14164030 gbbct949.seq
497985073 gbbct95.seq
22794637 gbbct950.seq
44489505 gbbct951.seq
86613460 gbbct952.seq
168495035 gbbct953.seq
499999885 gbbct954.seq
492452170 gbbct955.seq
498178206 gbbct956.seq
499250246 gbbct957.seq
498143624 gbbct958.seq
499998524 gbbct959.seq
498936947 gbbct96.seq
131030593 gbbct960.seq
499999060 gbbct961.seq
492608840 gbbct962.seq
494513953 gbbct963.seq
499979277 gbbct964.seq
208753040 gbbct965.seq
499998945 gbbct966.seq
290456601 gbbct967.seq
499996345 gbbct968.seq
85303454 gbbct969.seq
306897241 gbbct97.seq
499997116 gbbct970.seq
125259405 gbbct971.seq
499997801 gbbct972.seq
43547529 gbbct973.seq
148183823 gbbct974.seq
491679129 gbbct975.seq
489099842 gbbct976.seq
113898115 gbbct977.seq
497084256 gbbct978.seq
489910696 gbbct979.seq
491474485 gbbct98.seq
494007425 gbbct980.seq
497933046 gbbct981.seq
497254622 gbbct982.seq
488464409 gbbct983.seq
305471125 gbbct984.seq
495496631 gbbct985.seq
498005981 gbbct986.seq
498178013 gbbct987.seq
168612683 gbbct988.seq
472461247 gbbct989.seq
494310693 gbbct99.seq
498353054 gbbct990.seq
494354833 gbbct991.seq
496897969 gbbct992.seq
150527859 gbbct993.seq
487524218 gbbct994.seq
499384879 gbbct995.seq
499022760 gbbct996.seq
273332260 gbbct997.seq
498499361 gbbct998.seq
497461802 gbbct999.seq
633506 gbchg.txt
499986339 gbcon1.seq
499936889 gbcon10.seq
499997927 gbcon100.seq
499998763 gbcon101.seq
266690984 gbcon102.seq
499999053 gbcon103.seq
499996704 gbcon104.seq
169667376 gbcon105.seq
498620427 gbcon106.seq
497628623 gbcon107.seq
499998794 gbcon108.seq
499919473 gbcon109.seq
498613756 gbcon11.seq
278371112 gbcon110.seq
499974305 gbcon111.seq
499998492 gbcon112.seq
301865254 gbcon113.seq
500000149 gbcon114.seq
499999637 gbcon115.seq
132520347 gbcon116.seq
499979980 gbcon117.seq
499998210 gbcon118.seq
499873622 gbcon119.seq
499918762 gbcon12.seq
277072431 gbcon120.seq
499999876 gbcon121.seq
499999395 gbcon122.seq
222253215 gbcon123.seq
45836617 gbcon124.seq
499997550 gbcon125.seq
499997048 gbcon126.seq
447038623 gbcon127.seq
499999732 gbcon128.seq
500000159 gbcon129.seq
498755170 gbcon13.seq
499995979 gbcon130.seq
196180276 gbcon131.seq
499995599 gbcon132.seq
499999036 gbcon133.seq
238748401 gbcon134.seq
499998058 gbcon135.seq
467658925 gbcon136.seq
499998966 gbcon137.seq
499999105 gbcon138.seq
260277714 gbcon139.seq
498698611 gbcon14.seq
500000116 gbcon140.seq
499999217 gbcon141.seq
498207707 gbcon142.seq
499999367 gbcon143.seq
499999246 gbcon144.seq
181331698 gbcon145.seq
499998259 gbcon146.seq
499998534 gbcon147.seq
23267891 gbcon148.seq
499895508 gbcon149.seq
497489318 gbcon15.seq
499998608 gbcon150.seq
410183306 gbcon151.seq
499978337 gbcon152.seq
499984769 gbcon153.seq
378760506 gbcon154.seq
499995981 gbcon155.seq
499995734 gbcon156.seq
265279813 gbcon157.seq
499999808 gbcon158.seq
499998096 gbcon159.seq
170068320 gbcon16.seq
78092623 gbcon160.seq
500000141 gbcon161.seq
499756967 gbcon162.seq
499997753 gbcon163.seq
143068669 gbcon164.seq
499889851 gbcon165.seq
499990720 gbcon166.seq
499985012 gbcon167.seq
336382886 gbcon168.seq
499997937 gbcon169.seq
499767946 gbcon17.seq
499999984 gbcon170.seq
188501739 gbcon171.seq
499998956 gbcon172.seq
499998775 gbcon173.seq
499999478 gbcon174.seq
274172100 gbcon175.seq
499999711 gbcon176.seq
499998667 gbcon177.seq
499614846 gbcon178.seq
499997930 gbcon179.seq
497443295 gbcon18.seq
146641660 gbcon180.seq
499999965 gbcon181.seq
499999725 gbcon182.seq
135132838 gbcon183.seq
499997148 gbcon184.seq
499998666 gbcon185.seq
499997859 gbcon186.seq
298459106 gbcon187.seq
499978124 gbcon188.seq
499997354 gbcon189.seq
496867203 gbcon19.seq
474676327 gbcon190.seq
499996896 gbcon191.seq
499991545 gbcon192.seq
380634045 gbcon193.seq
499914217 gbcon194.seq
499995804 gbcon195.seq
499999620 gbcon196.seq
139334593 gbcon197.seq
499998392 gbcon198.seq
499997881 gbcon199.seq
499999147 gbcon2.seq
498719416 gbcon20.seq
38637152 gbcon200.seq
499998672 gbcon201.seq
499998964 gbcon202.seq
499991855 gbcon203.seq
499999319 gbcon204.seq
499926829 gbcon205.seq
277777094 gbcon206.seq
499999940 gbcon207.seq
484917287 gbcon208.seq
499990509 gbcon209.seq
499904825 gbcon21.seq
499888357 gbcon210.seq
499998270 gbcon211.seq
4350642 gbcon212.seq
499999375 gbcon213.seq
499999019 gbcon214.seq
499997621 gbcon215.seq
13869368 gbcon216.seq
499960645 gbcon217.seq
499977895 gbcon218.seq
499998549 gbcon219.seq
14774905 gbcon22.seq
276951509 gbcon220.seq
499908665 gbcon221.seq
499856643 gbcon222.seq
499996414 gbcon223.seq
244496731 gbcon224.seq
499888099 gbcon225.seq
499999255 gbcon226.seq
499688252 gbcon227.seq
345759611 gbcon228.seq
499678868 gbcon229.seq
499998788 gbcon23.seq
499918621 gbcon230.seq
499999897 gbcon231.seq
150052843 gbcon232.seq
499856788 gbcon233.seq
499997801 gbcon234.seq
499993639 gbcon235.seq
498686484 gbcon236.seq
317209761 gbcon237.seq
499998935 gbcon24.seq
499999534 gbcon25.seq
84517707 gbcon26.seq
499999901 gbcon27.seq
499498313 gbcon28.seq
498850800 gbcon29.seq
499998957 gbcon3.seq
318196954 gbcon30.seq
499998397 gbcon31.seq
135784709 gbcon32.seq
126581536 gbcon33.seq
499918920 gbcon34.seq
499998468 gbcon35.seq
27859502 gbcon36.seq
499999414 gbcon37.seq
499998297 gbcon38.seq
444126376 gbcon39.seq
106336744 gbcon4.seq
499999754 gbcon40.seq
499996186 gbcon41.seq
499996876 gbcon42.seq
43314086 gbcon43.seq
499997302 gbcon44.seq
499996762 gbcon45.seq
278164332 gbcon46.seq
499999359 gbcon47.seq
499996983 gbcon48.seq
271759840 gbcon49.seq
499940282 gbcon5.seq
499993774 gbcon50.seq
499997972 gbcon51.seq
386626626 gbcon52.seq
499998746 gbcon53.seq
499998567 gbcon54.seq
177827600 gbcon55.seq
499999775 gbcon56.seq
499998019 gbcon57.seq
240103744 gbcon58.seq
499999949 gbcon59.seq
494454779 gbcon6.seq
499999067 gbcon60.seq
337031547 gbcon61.seq
499998864 gbcon62.seq
499994811 gbcon63.seq
299682797 gbcon64.seq
500000005 gbcon65.seq
499997545 gbcon66.seq
261117917 gbcon67.seq
499995467 gbcon68.seq
499999403 gbcon69.seq
494751662 gbcon7.seq
188551188 gbcon70.seq
499996910 gbcon71.seq
499996842 gbcon72.seq
365761631 gbcon73.seq
499997884 gbcon74.seq
499996070 gbcon75.seq
387269601 gbcon76.seq
499993101 gbcon77.seq
473419617 gbcon78.seq
174082386 gbcon79.seq
499999694 gbcon8.seq
499962181 gbcon80.seq
23946021 gbcon81.seq
499983752 gbcon82.seq
204662746 gbcon83.seq
199581426 gbcon84.seq
499970249 gbcon85.seq
499996813 gbcon86.seq
338368827 gbcon87.seq
499606703 gbcon88.seq
495956208 gbcon89.seq
61944721 gbcon9.seq
499889397 gbcon90.seq
204922712 gbcon91.seq
499944761 gbcon92.seq
499998804 gbcon93.seq
499750314 gbcon94.seq
167922790 gbcon95.seq
500000258 gbcon96.seq
500000165 gbcon97.seq
131524692 gbcon98.seq
499990588 gbcon99.seq
181583 gbdel.txt
499999953 gbenv1.seq
489563408 gbenv10.seq
495326555 gbenv11.seq
496957712 gbenv12.seq
498563178 gbenv13.seq
499998816 gbenv14.seq
191394893 gbenv15.seq
499996608 gbenv16.seq
499997852 gbenv17.seq
53941397 gbenv18.seq
499999002 gbenv19.seq
499998486 gbenv2.seq
499997567 gbenv20.seq
499998809 gbenv21.seq
499998773 gbenv22.seq
5226034 gbenv23.seq
499998255 gbenv24.seq
499999773 gbenv25.seq
190625300 gbenv26.seq
499983916 gbenv27.seq
499999609 gbenv28.seq
499998233 gbenv29.seq
456005085 gbenv3.seq
84235819 gbenv30.seq
499998545 gbenv31.seq
499996862 gbenv32.seq
177747382 gbenv33.seq
500000104 gbenv34.seq
499997419 gbenv35.seq
499996774 gbenv36.seq
46480041 gbenv37.seq
499998714 gbenv38.seq
499999626 gbenv39.seq
498295155 gbenv4.seq
192930953 gbenv40.seq
499999630 gbenv41.seq
499998643 gbenv42.seq
334985879 gbenv43.seq
499999835 gbenv44.seq
499996803 gbenv45.seq
471567446 gbenv46.seq
499998543 gbenv47.seq
499997679 gbenv48.seq
338693290 gbenv49.seq
495774225 gbenv5.seq
500000073 gbenv50.seq
500000198 gbenv51.seq
394550509 gbenv52.seq
499998688 gbenv53.seq
500000059 gbenv54.seq
345575147 gbenv55.seq
499999527 gbenv56.seq
499998730 gbenv57.seq
238003113 gbenv58.seq
499999235 gbenv59.seq
497093662 gbenv6.seq
499999402 gbenv60.seq
391431703 gbenv61.seq
499998668 gbenv62.seq
499997893 gbenv63.seq
499998760 gbenv64.seq
154509958 gbenv65.seq
499997733 gbenv66.seq
499998664 gbenv67.seq
500000079 gbenv68.seq
222937410 gbenv69.seq
498615742 gbenv7.seq
499997381 gbenv70.seq
499941922 gbenv71.seq
315129608 gbenv72.seq
499975767 gbenv73.seq
499999434 gbenv74.seq
477843023 gbenv75.seq
499999099 gbenv76.seq
493956982 gbenv77.seq
497099907 gbenv78.seq
499945210 gbenv79.seq
131809507 gbenv8.seq
171976313 gbenv80.seq
497122399 gbenv9.seq
499999886 gbest1.seq
499999635 gbest10.seq
499997424 gbest100.seq
500000102 gbest101.seq
499997928 gbest102.seq
499999586 gbest103.seq
27058254 gbest104.seq
499996554 gbest105.seq
499997290 gbest106.seq
499999575 gbest107.seq
499999528 gbest108.seq
9862063 gbest109.seq
499997770 gbest11.seq
500000213 gbest110.seq
499997713 gbest111.seq
499998641 gbest112.seq
499999145 gbest113.seq
21766373 gbest114.seq
500000014 gbest115.seq
499999751 gbest116.seq
499996861 gbest117.seq
18205696 gbest118.seq
499998016 gbest119.seq
475347609 gbest12.seq
499998546 gbest120.seq
499997661 gbest121.seq
69242600 gbest122.seq
499997996 gbest123.seq
499996364 gbest124.seq
223780385 gbest125.seq
499997461 gbest126.seq
499998633 gbest127.seq
195307357 gbest128.seq
499997173 gbest129.seq
499999122 gbest13.seq
499998792 gbest130.seq
499995025 gbest131.seq
499996839 gbest132.seq
85321549 gbest133.seq
499999011 gbest134.seq
500000103 gbest135.seq
499997620 gbest136.seq
499998847 gbest137.seq
103557175 gbest138.seq
499999885 gbest139.seq
249987097 gbest14.seq
499996904 gbest140.seq
500000218 gbest141.seq
499998495 gbest142.seq
28439876 gbest143.seq
499998499 gbest144.seq
499995866 gbest145.seq
499997128 gbest146.seq
499998371 gbest147.seq
30830682 gbest148.seq
499998615 gbest149.seq
499998582 gbest15.seq
500000160 gbest150.seq
499997750 gbest151.seq
324374809 gbest152.seq
499997344 gbest153.seq
499999008 gbest154.seq
499996792 gbest155.seq
499998093 gbest156.seq
26483164 gbest157.seq
500000031 gbest158.seq
499999571 gbest159.seq
499998229 gbest16.seq
499998740 gbest160.seq
499999772 gbest161.seq
11191143 gbest162.seq
499999738 gbest163.seq
499999513 gbest164.seq
499999792 gbest165.seq
499998438 gbest166.seq
86376407 gbest167.seq
500000180 gbest168.seq
499996624 gbest169.seq
421200379 gbest17.seq
499997982 gbest170.seq
499996832 gbest171.seq
120388331 gbest172.seq
499998796 gbest173.seq
499999076 gbest174.seq
500000124 gbest175.seq
500000114 gbest176.seq
65991139 gbest177.seq
499999609 gbest178.seq
403619645 gbest179.seq
500000212 gbest18.seq
500000063 gbest180.seq
500000137 gbest181.seq
499998032 gbest182.seq
499996516 gbest183.seq
42970207 gbest184.seq
499999115 gbest185.seq
499999094 gbest186.seq
499999271 gbest187.seq
499997793 gbest188.seq
42245476 gbest189.seq
499997392 gbest19.seq
499998700 gbest190.seq
499999296 gbest191.seq
499999092 gbest192.seq
500000084 gbest193.seq
11591845 gbest194.seq
499996962 gbest195.seq
499998729 gbest196.seq
499997401 gbest197.seq
499998525 gbest198.seq
28665019 gbest199.seq
499997555 gbest2.seq
262827667 gbest20.seq
499998890 gbest200.seq
499999939 gbest201.seq
500000077 gbest202.seq
499998043 gbest203.seq
34247817 gbest204.seq
13610371 gbest205.seq
500000052 gbest206.seq
500000039 gbest207.seq
328917985 gbest208.seq
499997954 gbest209.seq
499999305 gbest21.seq
500000064 gbest210.seq
321738245 gbest211.seq
499999454 gbest212.seq
499997334 gbest213.seq
267676365 gbest214.seq
499997450 gbest215.seq
499999542 gbest216.seq
270148029 gbest217.seq
499996173 gbest218.seq
499998682 gbest219.seq
499998133 gbest22.seq
499996701 gbest220.seq
500000034 gbest221.seq
52041103 gbest222.seq
499999123 gbest223.seq
499999816 gbest224.seq
499998079 gbest225.seq
499993980 gbest226.seq
47777384 gbest227.seq
499998310 gbest228.seq
499999275 gbest229.seq
244498539 gbest23.seq
176584566 gbest230.seq
500000143 gbest231.seq
499999766 gbest232.seq
499999388 gbest233.seq
478350574 gbest234.seq
499997785 gbest235.seq
499999603 gbest236.seq
499997429 gbest237.seq
462328784 gbest238.seq
499999067 gbest239.seq
499997973 gbest24.seq
499999466 gbest240.seq
499997812 gbest241.seq
495965189 gbest242.seq
499999965 gbest243.seq
499998071 gbest244.seq
499999534 gbest245.seq
499997094 gbest246.seq
25247852 gbest247.seq
499999568 gbest248.seq
499999137 gbest249.seq
500000249 gbest25.seq
497314236 gbest250.seq
499999018 gbest251.seq
499998363 gbest252.seq
499998003 gbest253.seq
499998855 gbest254.seq
21635727 gbest255.seq
499997327 gbest256.seq
499995735 gbest257.seq
499995987 gbest258.seq
499998682 gbest259.seq
499999489 gbest26.seq
76751341 gbest260.seq
499998298 gbest261.seq
499998862 gbest262.seq
499999803 gbest263.seq
499999748 gbest264.seq
15153140 gbest265.seq
499999709 gbest266.seq
499999528 gbest267.seq
499996240 gbest268.seq
499999976 gbest269.seq
500000205 gbest27.seq
61175538 gbest270.seq
499998700 gbest271.seq
499999812 gbest272.seq
499998907 gbest273.seq
122786557 gbest274.seq
499996420 gbest275.seq
499996347 gbest276.seq
499996697 gbest277.seq
499997998 gbest278.seq
54096018 gbest279.seq
49054642 gbest28.seq
499997300 gbest280.seq
499998093 gbest281.seq
499998043 gbest282.seq
499998230 gbest283.seq
57212436 gbest284.seq
499999206 gbest285.seq
499999297 gbest286.seq
499995779 gbest287.seq
499998776 gbest288.seq
12647131 gbest289.seq
499998393 gbest29.seq
500000262 gbest290.seq
499999019 gbest291.seq
499998375 gbest292.seq
499998356 gbest293.seq
25130664 gbest294.seq
499999905 gbest295.seq
499999169 gbest296.seq
485630902 gbest297.seq
499998242 gbest298.seq
499997484 gbest299.seq
499998861 gbest3.seq
499999804 gbest30.seq
499999992 gbest300.seq
499999761 gbest301.seq
5975334 gbest302.seq
499998628 gbest303.seq
499998004 gbest304.seq
499998183 gbest305.seq
499998614 gbest306.seq
8752709 gbest307.seq
499999082 gbest308.seq
499999747 gbest309.seq
499997642 gbest31.seq
499997747 gbest310.seq
425300390 gbest311.seq
499999283 gbest312.seq
500000116 gbest313.seq
499997968 gbest314.seq
499999801 gbest315.seq
1811805 gbest316.seq
499999089 gbest317.seq
499999575 gbest318.seq
469139945 gbest319.seq
487083596 gbest32.seq
499999477 gbest320.seq
499997881 gbest321.seq
499998849 gbest322.seq
499999177 gbest323.seq
40428221 gbest324.seq
499997688 gbest325.seq
499998667 gbest326.seq
499998460 gbest327.seq
494327711 gbest328.seq
499998393 gbest329.seq
499996778 gbest33.seq
499997590 gbest330.seq
499999154 gbest331.seq
500000100 gbest332.seq
57561412 gbest333.seq
500000164 gbest334.seq
500000124 gbest335.seq
499998630 gbest336.seq
469754446 gbest337.seq
499996848 gbest338.seq
499997513 gbest339.seq
499998706 gbest34.seq
499999142 gbest340.seq
499998193 gbest341.seq
19805885 gbest342.seq
499997920 gbest343.seq
493673138 gbest344.seq
499997344 gbest345.seq
499998393 gbest346.seq
500000034 gbest347.seq
500000073 gbest348.seq
7042931 gbest349.seq
500000165 gbest35.seq
499999575 gbest350.seq
499999980 gbest351.seq
499999578 gbest352.seq
445507381 gbest353.seq
499999670 gbest354.seq
499999568 gbest355.seq
500000244 gbest356.seq
385830792 gbest357.seq
499999372 gbest358.seq
499999677 gbest359.seq
465822601 gbest36.seq
499998309 gbest360.seq
499997583 gbest361.seq
23515852 gbest362.seq
499999898 gbest363.seq
499999146 gbest364.seq
499999067 gbest365.seq
500000175 gbest366.seq
60455485 gbest367.seq
166258344 gbest368.seq
499999253 gbest369.seq
500000221 gbest37.seq
499999145 gbest370.seq
499997410 gbest371.seq
499999501 gbest372.seq
87762815 gbest373.seq
499997671 gbest374.seq
499999212 gbest375.seq
499996947 gbest376.seq
499997464 gbest377.seq
167276287 gbest378.seq
499996810 gbest379.seq
499998451 gbest38.seq
499998009 gbest380.seq
499999556 gbest381.seq
499999559 gbest382.seq
155492929 gbest383.seq
499999225 gbest384.seq
500000080 gbest385.seq
499996997 gbest386.seq
496992966 gbest387.seq
499998244 gbest388.seq
499997393 gbest389.seq
499999976 gbest39.seq
499997868 gbest390.seq
68565600 gbest391.seq
499998199 gbest392.seq
499995697 gbest393.seq
499997473 gbest394.seq
499998850 gbest395.seq
84720974 gbest396.seq
499996726 gbest397.seq
499997638 gbest398.seq
499999194 gbest399.seq
434902865 gbest4.seq
499997651 gbest40.seq
499998580 gbest400.seq
88026758 gbest401.seq
499997789 gbest402.seq
499998566 gbest403.seq
499999548 gbest404.seq
499998233 gbest405.seq
49239860 gbest406.seq
499999872 gbest407.seq
499999311 gbest408.seq
499999930 gbest409.seq
191428295 gbest41.seq
499999455 gbest410.seq
89134158 gbest411.seq
499997354 gbest412.seq
499999916 gbest413.seq
499995769 gbest414.seq
499993348 gbest415.seq
124836692 gbest416.seq
499999009 gbest417.seq
328120595 gbest418.seq
499997537 gbest419.seq
499997364 gbest42.seq
499999392 gbest420.seq
499999368 gbest421.seq
499999290 gbest422.seq
60418424 gbest423.seq
499999712 gbest424.seq
499999639 gbest425.seq
499997596 gbest426.seq
410464048 gbest427.seq
499997260 gbest428.seq
499999283 gbest429.seq
499997237 gbest43.seq
335979604 gbest430.seq
499997448 gbest431.seq
500000055 gbest432.seq
261735757 gbest433.seq
499999054 gbest434.seq
499999565 gbest435.seq
457029835 gbest436.seq
499997677 gbest437.seq
499997592 gbest438.seq
305631978 gbest439.seq
499997245 gbest44.seq
499996212 gbest440.seq
499998106 gbest441.seq
336207493 gbest442.seq
499998798 gbest443.seq
499999337 gbest444.seq
188594473 gbest445.seq
499998567 gbest446.seq
499997513 gbest447.seq
120724820 gbest448.seq
499998099 gbest449.seq
499996431 gbest45.seq
499998378 gbest450.seq
144958145 gbest451.seq
499997877 gbest452.seq
499999922 gbest453.seq
146697887 gbest454.seq
499998626 gbest455.seq
499997991 gbest456.seq
499998447 gbest457.seq
499999775 gbest458.seq
801517 gbest459.seq
189558363 gbest46.seq
499999562 gbest460.seq
499998109 gbest461.seq
500000069 gbest462.seq
499999491 gbest463.seq
23547900 gbest464.seq
170019681 gbest465.seq
499998234 gbest466.seq
499997948 gbest467.seq
499998330 gbest468.seq
499998840 gbest469.seq
499997254 gbest47.seq
28589640 gbest470.seq
499999508 gbest471.seq
499999012 gbest472.seq
499998631 gbest473.seq
499997270 gbest474.seq
68554444 gbest475.seq
499997202 gbest476.seq
499997120 gbest477.seq
499997133 gbest478.seq
499996553 gbest479.seq
499997861 gbest48.seq
58819344 gbest480.seq
499999478 gbest481.seq
499998894 gbest482.seq
499998253 gbest483.seq
499998834 gbest484.seq
36878159 gbest485.seq
499997365 gbest486.seq
499998770 gbest487.seq
499998271 gbest488.seq
499998109 gbest489.seq
499998648 gbest49.seq
74523863 gbest490.seq
499999195 gbest491.seq
499999368 gbest492.seq
499998525 gbest493.seq
208394234 gbest494.seq
499996334 gbest495.seq
499999918 gbest496.seq
499998673 gbest497.seq
499998447 gbest498.seq
93716532 gbest499.seq
499999604 gbest5.seq
477022884 gbest50.seq
499998191 gbest500.seq
499999459 gbest501.seq
499996812 gbest502.seq
499999994 gbest503.seq
57685887 gbest504.seq
499995678 gbest505.seq
499998789 gbest506.seq
499992702 gbest507.seq
499997561 gbest508.seq
144035608 gbest509.seq
499999137 gbest51.seq
499998165 gbest510.seq
499996677 gbest511.seq
499997275 gbest512.seq
499999485 gbest513.seq
144813181 gbest514.seq
499998357 gbest515.seq
499998528 gbest516.seq
500000008 gbest517.seq
499999379 gbest518.seq
20831412 gbest519.seq
356399962 gbest52.seq
174271459 gbest520.seq
500000045 gbest521.seq
500000167 gbest522.seq
86404104 gbest523.seq
499998243 gbest524.seq
499999107 gbest525.seq
76884582 gbest526.seq
499999644 gbest527.seq
499999397 gbest528.seq
499997123 gbest529.seq
499997197 gbest53.seq
499996576 gbest530.seq
101183181 gbest531.seq
499998563 gbest532.seq
499999862 gbest533.seq
499998938 gbest534.seq
499999923 gbest535.seq
11156072 gbest536.seq
499998167 gbest537.seq
499998641 gbest538.seq
499997727 gbest539.seq
499999759 gbest54.seq
478138570 gbest540.seq
499999636 gbest541.seq
499999141 gbest542.seq
499997428 gbest543.seq
418221001 gbest544.seq
499999742 gbest545.seq
500000106 gbest546.seq
499999793 gbest547.seq
499998376 gbest548.seq
83233267 gbest549.seq
499997752 gbest55.seq
499999613 gbest550.seq
499999398 gbest551.seq
499999882 gbest552.seq
499997233 gbest553.seq
32975971 gbest554.seq
499996586 gbest555.seq
499998720 gbest556.seq
499999177 gbest557.seq
500000191 gbest558.seq
44529511 gbest559.seq
483694647 gbest56.seq
499998311 gbest560.seq
499999739 gbest561.seq
499998866 gbest562.seq
499999777 gbest563.seq
12024764 gbest564.seq
499997844 gbest565.seq
499998568 gbest566.seq
393292620 gbest567.seq
500000061 gbest568.seq
499999771 gbest569.seq
500000017 gbest57.seq
110254440 gbest570.seq
499998740 gbest571.seq
499998382 gbest572.seq
50523126 gbest573.seq
499999830 gbest574.seq
499997898 gbest575.seq
499999491 gbest576.seq
499998593 gbest577.seq
294338068 gbest578.seq
499999533 gbest58.seq
500000156 gbest59.seq
499998716 gbest6.seq
464399310 gbest60.seq
499999821 gbest61.seq
499998690 gbest62.seq
499998613 gbest63.seq
500000006 gbest64.seq
7795899 gbest65.seq
499997879 gbest66.seq
499997947 gbest67.seq
499999722 gbest68.seq
484302223 gbest69.seq
499996736 gbest7.seq
499999502 gbest70.seq
499996969 gbest71.seq
499998145 gbest72.seq
500000007 gbest73.seq
10257936 gbest74.seq
123414980 gbest75.seq
499999298 gbest76.seq
499998245 gbest77.seq
499998907 gbest78.seq
499999038 gbest79.seq
469442002 gbest8.seq
6590015 gbest80.seq
499998041 gbest81.seq
499995370 gbest82.seq
499997091 gbest83.seq
500000235 gbest84.seq
47028589 gbest85.seq
500000165 gbest86.seq
499999018 gbest87.seq
499996860 gbest88.seq
499998671 gbest89.seq
499998427 gbest9.seq
53783169 gbest90.seq
499998173 gbest91.seq
499999170 gbest92.seq
499996091 gbest93.seq
472256473 gbest94.seq
499999347 gbest95.seq
499999956 gbest96.seq
499996717 gbest97.seq
499913849 gbest98.seq
35244903 gbest99.seq
499997910 gbgss1.seq
55726731 gbgss10.seq
499997670 gbgss100.seq
45810173 gbgss101.seq
499998092 gbgss102.seq
499998065 gbgss103.seq
499997907 gbgss104.seq
468721568 gbgss105.seq
499997879 gbgss106.seq
499999105 gbgss107.seq
499998583 gbgss108.seq
499999879 gbgss109.seq
499999685 gbgss11.seq
42543282 gbgss110.seq
499997770 gbgss111.seq
499999222 gbgss112.seq
499999399 gbgss113.seq
319587338 gbgss114.seq
499997568 gbgss115.seq
499999109 gbgss116.seq
499998390 gbgss117.seq
499998207 gbgss118.seq
105488645 gbgss119.seq
499998785 gbgss12.seq
499997351 gbgss120.seq
499997815 gbgss121.seq
499997392 gbgss122.seq
499998819 gbgss123.seq
8930221 gbgss124.seq
499999955 gbgss125.seq
499999961 gbgss126.seq
499998682 gbgss127.seq
451764718 gbgss128.seq
499998361 gbgss129.seq
499999479 gbgss13.seq
499999211 gbgss130.seq
499997711 gbgss131.seq
499998622 gbgss132.seq
29785783 gbgss133.seq
499997877 gbgss134.seq
209679641 gbgss135.seq
500000110 gbgss136.seq
499999602 gbgss137.seq
499997969 gbgss138.seq
500000125 gbgss139.seq
499998835 gbgss14.seq
14831686 gbgss140.seq
499996726 gbgss141.seq
499997951 gbgss142.seq
499999528 gbgss143.seq
499997001 gbgss144.seq
16786266 gbgss145.seq
499997786 gbgss146.seq
499996974 gbgss147.seq
499999546 gbgss148.seq
499996547 gbgss149.seq
4967295 gbgss15.seq
2045398 gbgss150.seq
499997382 gbgss151.seq
499998165 gbgss152.seq
499998480 gbgss153.seq
499997367 gbgss154.seq
6835799 gbgss155.seq
373333029 gbgss156.seq
500000248 gbgss157.seq
499999179 gbgss158.seq
499999179 gbgss159.seq
499997800 gbgss16.seq
456782349 gbgss160.seq
500000255 gbgss161.seq
499999754 gbgss162.seq
499998642 gbgss163.seq
458300845 gbgss164.seq
499997998 gbgss165.seq
499999955 gbgss166.seq
499998714 gbgss167.seq
456858700 gbgss168.seq
499996207 gbgss169.seq
499999691 gbgss17.seq
499998104 gbgss170.seq
499998398 gbgss171.seq
364091904 gbgss172.seq
500000047 gbgss173.seq
500000062 gbgss174.seq
215814169 gbgss175.seq
500000172 gbgss176.seq
499997918 gbgss177.seq
68464120 gbgss178.seq
499999079 gbgss179.seq
500000078 gbgss18.seq
499999336 gbgss180.seq
499998518 gbgss181.seq
499999975 gbgss182.seq
49671428 gbgss183.seq
500000207 gbgss184.seq
499998668 gbgss185.seq
499998448 gbgss186.seq
500000134 gbgss187.seq
41156795 gbgss188.seq
499999015 gbgss189.seq
483120869 gbgss19.seq
499999977 gbgss190.seq
57632314 gbgss191.seq
499998791 gbgss192.seq
499996639 gbgss193.seq
499997685 gbgss194.seq
496087090 gbgss195.seq
499999000 gbgss196.seq
499999717 gbgss197.seq
499997473 gbgss198.seq
499997724 gbgss199.seq
499997209 gbgss2.seq
500000074 gbgss20.seq
55766098 gbgss200.seq
499998432 gbgss201.seq
499999372 gbgss202.seq
499999127 gbgss203.seq
480794721 gbgss204.seq
499999696 gbgss205.seq
499998040 gbgss206.seq
55217889 gbgss207.seq
499999671 gbgss208.seq
499999336 gbgss209.seq
326435210 gbgss21.seq
499999851 gbgss210.seq
483131912 gbgss211.seq
499997699 gbgss212.seq
499997346 gbgss213.seq
499999763 gbgss214.seq
487715331 gbgss215.seq
499998512 gbgss216.seq
499999622 gbgss217.seq
499998482 gbgss218.seq
475206737 gbgss219.seq
499996936 gbgss22.seq
499999842 gbgss220.seq
499997438 gbgss221.seq
499998669 gbgss222.seq
6150907 gbgss223.seq
499999723 gbgss224.seq
499999684 gbgss225.seq
499998774 gbgss226.seq
264589422 gbgss227.seq
499998669 gbgss228.seq
500000259 gbgss229.seq
499999113 gbgss23.seq
499998395 gbgss230.seq
429771704 gbgss231.seq
499998680 gbgss232.seq
499997883 gbgss233.seq
499999992 gbgss234.seq
471956638 gbgss235.seq
499999119 gbgss236.seq
500000046 gbgss237.seq
499997749 gbgss238.seq
419219562 gbgss239.seq
499998818 gbgss24.seq
499999020 gbgss240.seq
499999603 gbgss241.seq
500000129 gbgss242.seq
499997618 gbgss243.seq
18225276 gbgss244.seq
315572447 gbgss245.seq
499997744 gbgss246.seq
499999389 gbgss247.seq
499998492 gbgss248.seq
467298948 gbgss249.seq
499999064 gbgss25.seq
499999379 gbgss250.seq
499998253 gbgss251.seq
499998873 gbgss252.seq
499997827 gbgss253.seq
36132488 gbgss254.seq
499998608 gbgss255.seq
499999218 gbgss256.seq
499998113 gbgss257.seq
499998912 gbgss258.seq
22042461 gbgss259.seq
49836535 gbgss26.seq
499997682 gbgss260.seq
499997479 gbgss261.seq
499997847 gbgss262.seq
1966395 gbgss263.seq
500000132 gbgss264.seq
499998920 gbgss265.seq
499998061 gbgss266.seq
499491070 gbgss267.seq
499999723 gbgss268.seq
499998484 gbgss269.seq
499996335 gbgss27.seq
476820066 gbgss270.seq
499996842 gbgss28.seq
499997374 gbgss29.seq
499996818 gbgss3.seq
499999793 gbgss30.seq
31342385 gbgss31.seq
499998298 gbgss32.seq
499999440 gbgss33.seq
499999232 gbgss34.seq
475323728 gbgss35.seq
499997988 gbgss36.seq
499998016 gbgss37.seq
499999097 gbgss38.seq
499998525 gbgss39.seq
499999484 gbgss4.seq
12514272 gbgss40.seq
499998729 gbgss41.seq
499997515 gbgss42.seq
168548526 gbgss43.seq
499997525 gbgss44.seq
499997753 gbgss45.seq
499999140 gbgss46.seq
486883580 gbgss47.seq
499998195 gbgss48.seq
499997635 gbgss49.seq
41480505 gbgss5.seq
499997904 gbgss50.seq
443945964 gbgss51.seq
499998446 gbgss52.seq
500000163 gbgss53.seq
499998431 gbgss54.seq
421055741 gbgss55.seq
499998235 gbgss56.seq
499999740 gbgss57.seq
500000154 gbgss58.seq
427947401 gbgss59.seq
499999218 gbgss6.seq
67665344 gbgss60.seq
499997014 gbgss61.seq
499998970 gbgss62.seq
499999072 gbgss63.seq
492396804 gbgss64.seq
499999868 gbgss65.seq
499998563 gbgss66.seq
499998282 gbgss67.seq
499998811 gbgss68.seq
2280772 gbgss69.seq
499997502 gbgss7.seq
500000229 gbgss70.seq
499999619 gbgss71.seq
500000260 gbgss72.seq
419366282 gbgss73.seq
500000010 gbgss74.seq
499997041 gbgss75.seq
499997295 gbgss76.seq
34859199 gbgss77.seq
499997046 gbgss78.seq
499999706 gbgss79.seq
499998527 gbgss8.seq
499999172 gbgss80.seq
490143115 gbgss81.seq
499999721 gbgss82.seq
500000164 gbgss83.seq
499998945 gbgss84.seq
499998992 gbgss85.seq
4092019 gbgss86.seq
499998541 gbgss87.seq
499997719 gbgss88.seq
499999151 gbgss89.seq
499998470 gbgss9.seq
499996902 gbgss90.seq
34174279 gbgss91.seq
499998289 gbgss92.seq
499998886 gbgss93.seq
499998172 gbgss94.seq
465185709 gbgss95.seq
244248654 gbgss96.seq
499999492 gbgss97.seq
499998457 gbgss98.seq
500000176 gbgss99.seq
499999046 gbhtc1.seq
499988632 gbhtc2.seq
499995070 gbhtc3.seq
331480491 gbhtc4.seq
499997691 gbhtc5.seq
439770801 gbhtc6.seq
499998938 gbhtc7.seq
215403202 gbhtc8.seq
499949323 gbhtg1.seq
499980488 gbhtg10.seq
485100216 gbhtg11.seq
499977040 gbhtg12.seq
499847878 gbhtg13.seq
499963905 gbhtg14.seq
499701543 gbhtg15.seq
474637795 gbhtg16.seq
499709797 gbhtg17.seq
499810685 gbhtg18.seq
499965491 gbhtg19.seq
499847286 gbhtg2.seq
499990701 gbhtg20.seq
473198726 gbhtg21.seq
499919006 gbhtg22.seq
499970126 gbhtg23.seq
499100457 gbhtg24.seq
499962926 gbhtg25.seq
484453569 gbhtg26.seq
499959716 gbhtg27.seq
499868029 gbhtg28.seq
268058563 gbhtg29.seq
499869352 gbhtg3.seq
499922791 gbhtg30.seq
499807238 gbhtg31.seq
224934479 gbhtg32.seq
499945569 gbhtg33.seq
499927151 gbhtg34.seq
265477063 gbhtg35.seq
499867320 gbhtg36.seq
499972802 gbhtg37.seq
223152146 gbhtg38.seq
499806592 gbhtg39.seq
499846790 gbhtg4.seq
499974839 gbhtg40.seq
234952893 gbhtg41.seq
499825905 gbhtg42.seq
499886151 gbhtg43.seq
202125817 gbhtg44.seq
499805593 gbhtg45.seq
499927302 gbhtg46.seq
205797145 gbhtg47.seq
499976951 gbhtg48.seq
499932272 gbhtg49.seq
499934597 gbhtg5.seq
193865096 gbhtg50.seq
499927926 gbhtg51.seq
499933183 gbhtg52.seq
161356215 gbhtg53.seq
499991294 gbhtg54.seq
499991025 gbhtg55.seq
252731202 gbhtg56.seq
499944374 gbhtg57.seq
499991551 gbhtg58.seq
499843752 gbhtg59.seq
507366 gbhtg6.seq
167235174 gbhtg60.seq
499934849 gbhtg61.seq
499926029 gbhtg62.seq
499881302 gbhtg63.seq
468570824 gbhtg64.seq
499882387 gbhtg65.seq
499975194 gbhtg66.seq
499952537 gbhtg67.seq
499955759 gbhtg68.seq
499868574 gbhtg69.seq
499821962 gbhtg7.seq
417842665 gbhtg70.seq
499731470 gbhtg71.seq
499823072 gbhtg72.seq
385408676 gbhtg73.seq
499947980 gbhtg74.seq
499966538 gbhtg75.seq
383565105 gbhtg76.seq
499960780 gbhtg77.seq
499985236 gbhtg78.seq
499783878 gbhtg79.seq
499933840 gbhtg8.seq
499757763 gbhtg80.seq
499919685 gbhtg81.seq
307812337 gbhtg82.seq
499899726 gbhtg9.seq
499869439 gbinv1.seq
448191281 gbinv10.seq
498462897 gbinv100.seq
299174363 gbinv1000.se
422084648 gbinv1001.se
482494823 gbinv1002.se
365475370 gbinv1003.se
455578184 gbinv1004.se
349492812 gbinv1005.se
476634584 gbinv1006.se
468337011 gbinv1007.se
479253825 gbinv1008.se
466281232 gbinv1009.se
461069453 gbinv101.seq
169424717 gbinv1010.se
491880345 gbinv1011.se
480699422 gbinv1012.se
466860325 gbinv1013.se
499811192 gbinv1014.se
91086877 gbinv1015.se
468973768 gbinv1016.se
400459426 gbinv1017.se
2729769835 gbinv1018.se
1951209798 gbinv1019.se
308472155 gbinv102.seq
1255792906 gbinv1020.se
898357565 gbinv1021.se
708100576 gbinv1022.se
682258938 gbinv1023.se
603731371 gbinv1024.se
441414339 gbinv1025.se
420874955 gbinv1026.se
364086765 gbinv1027.se
301244939 gbinv1028.se
281934492 gbinv1029.se
476966407 gbinv103.seq
496007176 gbinv1030.se
465427121 gbinv1031.se
64629178 gbinv1032.se
464317098 gbinv1033.se
481015217 gbinv1034.se
495520063 gbinv1035.se
318684601 gbinv1036.se
481288702 gbinv1037.se
485191239 gbinv1038.se
489426703 gbinv1039.se
491653376 gbinv104.seq
448136762 gbinv1040.se
470740251 gbinv1041.se
459272447 gbinv1042.se
495221156 gbinv1043.se
293517225 gbinv1044.se
491531607 gbinv1045.se
484466364 gbinv1046.se
496616157 gbinv1047.se
243887807 gbinv1048.se
442993412 gbinv1049.se
363427026 gbinv105.seq
489594973 gbinv1050.se
473669853 gbinv1051.se
317058683 gbinv1052.se
496827832 gbinv1053.se
475806379 gbinv1054.se
483717479 gbinv1055.se
279303308 gbinv1056.se
442658448 gbinv1057.se
154113444 gbinv1058.se
479808194 gbinv1059.se
350760262 gbinv106.seq
344925105 gbinv1060.se
389948491 gbinv1061.se
495757112 gbinv1062.se
486177963 gbinv1063.se
474805896 gbinv1064.se
332242655 gbinv1065.se
470382100 gbinv1066.se
467266108 gbinv1067.se
443778631 gbinv1068.se
437109989 gbinv1069.se
297540018 gbinv107.seq
476924489 gbinv1070.se
491135272 gbinv1071.se
490968147 gbinv1072.se
346229875 gbinv1073.se
496167175 gbinv1074.se
491556023 gbinv1075.se
497588780 gbinv1076.se
487095100 gbinv1077.se
487204794 gbinv1078.se
476212892 gbinv1079.se
381801556 gbinv108.seq
485178393 gbinv1080.se
488738035 gbinv1081.se
156107164 gbinv1082.se
497392167 gbinv1083.se
482749954 gbinv1084.se
496261622 gbinv1085.se
494251519 gbinv1086.se
53213160 gbinv1087.se
442918226 gbinv1088.se
496050726 gbinv1089.se
379062900 gbinv109.seq
497897538 gbinv1090.se
481565834 gbinv1091.se
75736927 gbinv1092.se
496194879 gbinv1093.se
464036016 gbinv1094.se
428298459 gbinv1095.se
382943578 gbinv1096.se
379596877 gbinv1097.se
342671608 gbinv1098.se
493967462 gbinv1099.se
460975353 gbinv11.seq
334858600 gbinv110.seq
478563134 gbinv1100.se
148303346 gbinv1101.se
480732928 gbinv1102.se
469448865 gbinv1103.se
488160790 gbinv1104.se
392890907 gbinv1105.se
481357065 gbinv1106.se
493413425 gbinv1107.se
487451909 gbinv1108.se
394846711 gbinv1109.se
295805525 gbinv111.seq
488239358 gbinv1110.se
483834908 gbinv1111.se
490561398 gbinv1112.se
316655906 gbinv1113.se
464946114 gbinv1114.se
492014258 gbinv1115.se
471770137 gbinv1116.se
461978252 gbinv1117.se
379959406 gbinv1118.se
408768843 gbinv1119.se
268327299 gbinv112.seq
472794533 gbinv1120.se
321062867 gbinv1121.se
353308729 gbinv1122.se
483874842 gbinv1123.se
484350001 gbinv1124.se
489067895 gbinv1125.se
329008329 gbinv1126.se
476668232 gbinv1127.se
480994325 gbinv1128.se
495891814 gbinv1129.se
240539146 gbinv113.seq
483360160 gbinv1130.se
132911965 gbinv1131.se
487210140 gbinv1132.se
448992266 gbinv1133.se
498695833 gbinv1134.se
444078900 gbinv1135.se
215956096 gbinv1136.se
487810620 gbinv1137.se
482286892 gbinv1138.se
497441252 gbinv1139.se
499999544 gbinv114.seq
467821328 gbinv1140.se
154246756 gbinv1141.se
466393483 gbinv1142.se
489416936 gbinv1143.se
498094362 gbinv1144.se
484048889 gbinv1145.se
107559872 gbinv1146.se
496101873 gbinv1147.se
486677933 gbinv1148.se
491324260 gbinv1149.se
267230526 gbinv115.seq
473165407 gbinv1150.se
140712569 gbinv1151.se
498375180 gbinv1152.se
479763923 gbinv1153.se
484976323 gbinv1154.se
482273285 gbinv1155.se
478828590 gbinv1156.se
491989005 gbinv1157.se
447463190 gbinv1158.se
487986285 gbinv1159.se
499995138 gbinv116.seq
346424265 gbinv1160.se
460874738 gbinv1161.se
470352434 gbinv1162.se
496569150 gbinv1163.se
495212210 gbinv1164.se
443889162 gbinv1165.se
496692637 gbinv1166.se
473301815 gbinv1167.se
493531126 gbinv1168.se
483258684 gbinv1169.se
406787637 gbinv117.seq
403143105 gbinv1170.se
492287961 gbinv1171.se
492993389 gbinv1172.se
329034299 gbinv1173.se
461827784 gbinv1174.se
482686927 gbinv1175.se
99362650 gbinv1176.se
443724048 gbinv1177.se
367763998 gbinv1178.se
353268604 gbinv1179.se
497590858 gbinv118.seq
350260612 gbinv1180.se
341599132 gbinv1181.se
461028723 gbinv1182.se
495674250 gbinv1183.se
283813945 gbinv1184.se
495723890 gbinv1185.se
495292964 gbinv1186.se
476664181 gbinv1187.se
446428554 gbinv1188.se
382810689 gbinv1189.se
491626308 gbinv119.seq
448082904 gbinv1190.se
453192257 gbinv1191.se
484511211 gbinv1192.se
284284487 gbinv1193.se
476862131 gbinv1194.se
464518126 gbinv1195.se
496023268 gbinv1196.se
484057968 gbinv1197.se
64752815 gbinv1198.se
453621523 gbinv1199.se
470405378 gbinv12.seq
468890974 gbinv120.seq
477654378 gbinv1200.se
484267949 gbinv1201.se
455437646 gbinv1202.se
89115533 gbinv1203.se
483404516 gbinv1204.se
390899518 gbinv1205.se
452325242 gbinv1206.se
384613513 gbinv1207.se
229526122 gbinv1208.se
486921431 gbinv1209.se
480496392 gbinv121.seq
496712223 gbinv1210.se
435108906 gbinv1211.se
287148864 gbinv1212.se
277496405 gbinv1213.se
488197542 gbinv1214.se
493608297 gbinv1215.se
489917099 gbinv1216.se
468604289 gbinv1217.se
78075814 gbinv1218.se
463954346 gbinv1219.se
96954550 gbinv122.seq
444065721 gbinv1220.se
463448466 gbinv1221.se
479934750 gbinv1222.se
498795321 gbinv1223.se
472901111 gbinv1224.se
163240230 gbinv1225.se
487102736 gbinv1226.se
492609813 gbinv1227.se
481436962 gbinv1228.se
460938379 gbinv1229.se
495716317 gbinv123.seq
478440248 gbinv1230.se
498750906 gbinv1231.se
164930006 gbinv1232.se
492943115 gbinv1233.se
490618893 gbinv1234.se
492915933 gbinv1235.se
480868563 gbinv1236.se
489548617 gbinv1237.se
493048930 gbinv1238.se
481728782 gbinv1239.se
459725127 gbinv124.seq
491049473 gbinv1240.se
497816475 gbinv1241.se
349702816 gbinv1242.se
480059395 gbinv1243.se
384338991 gbinv1244.se
495415147 gbinv1245.se
494914864 gbinv1246.se
464264813 gbinv1247.se
412697818 gbinv1248.se
493232928 gbinv1249.se
481987025 gbinv125.seq
486605755 gbinv1250.se
476585175 gbinv1251.se
199064605 gbinv1252.se
490754089 gbinv1253.se
472244532 gbinv1254.se
489706010 gbinv1255.se
464236921 gbinv1256.se
467204993 gbinv1257.se
499827123 gbinv1258.se
345613253 gbinv1259.se
494130819 gbinv126.seq
483921508 gbinv1260.se
478586227 gbinv1261.se
94225785 gbinv1262.se
472428904 gbinv1263.se
497885447 gbinv1264.se
457902545 gbinv1265.se
498796484 gbinv1266.se
467125389 gbinv1267.se
497244361 gbinv1268.se
487538660 gbinv1269.se
170883605 gbinv127.seq
499913920 gbinv1270.se
406549774 gbinv1271.se
430451685 gbinv1272.se
472260007 gbinv1273.se
475352175 gbinv1274.se
452223380 gbinv1275.se
497325130 gbinv1276.se
494398316 gbinv1277.se
54910173 gbinv1278.se
492423538 gbinv1279.se
473739682 gbinv128.seq
491678341 gbinv1280.se
467975788 gbinv1281.se
477888370 gbinv1282.se
439149787 gbinv1283.se
107820209 gbinv1284.se
491773954 gbinv1285.se
479110373 gbinv1286.se
496707613 gbinv1287.se
498528229 gbinv1288.se
462735347 gbinv1289.se
489734098 gbinv129.seq
402849455 gbinv1290.se
491032865 gbinv1291.se
476073140 gbinv1292.se
456931139 gbinv1293.se
478083309 gbinv1294.se
457571010 gbinv1295.se
490220501 gbinv1296.se
26121678 gbinv1297.se
481108642 gbinv1298.se
343565210 gbinv1299.se
485779138 gbinv13.seq
481853020 gbinv130.seq
496752688 gbinv1300.se
480731694 gbinv1301.se
478492919 gbinv1302.se
487731779 gbinv1303.se
76362062 gbinv1304.se
436222895 gbinv1305.se
469121536 gbinv1306.se
488318181 gbinv1307.se
457907158 gbinv1308.se
288589895 gbinv1309.se
480575065 gbinv131.seq
413758380 gbinv1310.se
227750852 gbinv1311.se
499653408 gbinv1312.se
263948525 gbinv1313.se
490736102 gbinv1314.se
499126557 gbinv1315.se
490773865 gbinv1316.se
480867825 gbinv1317.se
488870121 gbinv1318.se
158318713 gbinv1319.se
175803748 gbinv132.seq
494916186 gbinv1320.se
471135774 gbinv1321.se
484279868 gbinv1322.se
469898457 gbinv1323.se
461055681 gbinv1324.se
273724334 gbinv1325.se
281877207 gbinv1326.se
479356634 gbinv1327.se
463004791 gbinv1328.se
225686207 gbinv1329.se
495896541 gbinv133.seq
489637921 gbinv1330.se
496465279 gbinv1331.se
484561817 gbinv1332.se
477308789 gbinv1333.se
258133115 gbinv1334.se
493072880 gbinv1335.se
490208988 gbinv1336.se
492809523 gbinv1337.se
474012633 gbinv1338.se
200353570 gbinv1339.se
496714826 gbinv134.seq
477986454 gbinv1340.se
491870466 gbinv1341.se
472046257 gbinv1342.se
484787948 gbinv1343.se
240176778 gbinv1344.se
481405748 gbinv1345.se
492731277 gbinv1346.se
480851291 gbinv1347.se
381859195 gbinv1348.se
479236800 gbinv1349.se
484083643 gbinv135.seq
489743792 gbinv1350.se
497574828 gbinv1351.se
381267248 gbinv1352.se
450448665 gbinv1353.se
484530441 gbinv1354.se
394299446 gbinv1355.se
425501799 gbinv1356.se
115618359 gbinv1357.se
431451977 gbinv1358.se
498054878 gbinv1359.se
472142529 gbinv136.seq
479298950 gbinv1360.se
467089340 gbinv1361.se
70651447 gbinv1362.se
278258267 gbinv1363.se
440773903 gbinv1364.se
470493499 gbinv1365.se
476778459 gbinv1366.se
486736873 gbinv1367.se
223420398 gbinv1368.se
471322661 gbinv1369.se
487970521 gbinv137.seq
489692789 gbinv1370.se
493687885 gbinv1371.se
389895514 gbinv1372.se
489638363 gbinv1373.se
35794018 gbinv1374.se
115155809 gbinv1375.se
615537581 gbinv1376.se
272202298 gbinv1377.se
480149302 gbinv1378.se
476834871 gbinv1379.se
473212644 gbinv138.seq
477140077 gbinv1380.se
491640835 gbinv1381.se
403386359 gbinv1382.se
297511488 gbinv1383.se
400332784 gbinv1384.se
498823027 gbinv1385.se
483203009 gbinv1386.se
482735960 gbinv1387.se
489718628 gbinv1388.se
494917649 gbinv1389.se
119585424 gbinv139.seq
464038534 gbinv1390.se
489339776 gbinv1391.se
491072844 gbinv1392.se
485392941 gbinv1393.se
485744007 gbinv1394.se
436679593 gbinv1395.se
104870652 gbinv1396.se
487890253 gbinv1397.se
491469693 gbinv1398.se
492207810 gbinv1399.se
459258045 gbinv14.seq
483414568 gbinv140.seq
277662520 gbinv1400.se
465038797 gbinv1401.se
484906173 gbinv1402.se
455274642 gbinv1403.se
319919307 gbinv1404.se
441284320 gbinv1405.se
415113809 gbinv1406.se
401299897 gbinv1407.se
395865604 gbinv1408.se
258909090 gbinv1409.se
490356176 gbinv141.seq
514655388 gbinv1410.se
393855324 gbinv1411.se
492709181 gbinv1412.se
187722486 gbinv1413.se
316437995 gbinv1414.se
404935920 gbinv1415.se
377535768 gbinv1416.se
357065535 gbinv1417.se
306211988 gbinv1418.se
475517285 gbinv1419.se
487648026 gbinv142.seq
487075677 gbinv1420.se
416387225 gbinv1421.se
134695954 gbinv1422.se
430211421 gbinv1423.se
468408575 gbinv1424.se
436825552 gbinv1425.se
499430139 gbinv1426.se
151862240 gbinv1427.se
462552718 gbinv1428.se
491611432 gbinv1429.se
482729414 gbinv143.seq
498143107 gbinv1430.se
338205053 gbinv1431.se
497160898 gbinv1432.se
493529280 gbinv1433.se
490583969 gbinv1434.se
296798816 gbinv1435.se
327269135 gbinv1436.se
374578168 gbinv1437.se
464846984 gbinv1438.se
483112113 gbinv1439.se
499999958 gbinv144.seq
134997033 gbinv1440.se
435630019 gbinv1441.se
484610659 gbinv1442.se
421495202 gbinv1443.se
397549582 gbinv1444.se
481528936 gbinv1445.se
458589607 gbinv1446.se
472513592 gbinv1447.se
337603339 gbinv1448.se
484201127 gbinv1449.se
420949560 gbinv145.seq
385978713 gbinv1450.se
440431049 gbinv1451.se
460502362 gbinv1452.se
495623919 gbinv1453.se
476021491 gbinv1454.se
461121425 gbinv1455.se
344726041 gbinv1456.se
460975459 gbinv1457.se
487003903 gbinv1458.se
498520425 gbinv1459.se
485183381 gbinv146.seq
418134448 gbinv1460.se
427253029 gbinv1461.se
486412807 gbinv1462.se
383942184 gbinv1463.se
477338574 gbinv1464.se
490073097 gbinv1465.se
478811262 gbinv1466.se
496060117 gbinv1467.se
340406228 gbinv1468.se
449114541 gbinv1469.se
497640652 gbinv147.seq
199251506 gbinv1470.se
221729756 gbinv1471.se
327938029 gbinv1472.se
425282426 gbinv1473.se
313687149 gbinv1474.se
266841778 gbinv1475.se
458869871 gbinv1476.se
369422706 gbinv1477.se
153606987 gbinv1478.se
472914403 gbinv1479.se
492273365 gbinv148.seq
306852781 gbinv1480.se
291548062 gbinv1481.se
272671608 gbinv1482.se
486703218 gbinv1483.se
499913313 gbinv1484.se
491927835 gbinv1485.se
158294388 gbinv1486.se
470404301 gbinv1487.se
477785110 gbinv1488.se
401558910 gbinv1489.se
493650305 gbinv149.seq
482108666 gbinv1490.se
75176389 gbinv1491.se
466305691 gbinv1492.se
488346628 gbinv1493.se
427690357 gbinv1494.se
413354153 gbinv1495.se
497212607 gbinv1496.se
400793181 gbinv1497.se
484524034 gbinv1498.se
465540714 gbinv1499.se
484230611 gbinv15.seq
319412812 gbinv150.seq
498576546 gbinv1500.se
406206788 gbinv1501.se
453652425 gbinv1502.se
457851234 gbinv1503.se
392940138 gbinv1504.se
484114705 gbinv1505.se
485175842 gbinv1506.se
489823569 gbinv1507.se
493576473 gbinv1508.se
177016892 gbinv1509.se
495488980 gbinv151.seq
486849466 gbinv1510.se
480897370 gbinv1511.se
254718644 gbinv1512.se
271476686 gbinv1513.se
459218955 gbinv1514.se
436464597 gbinv1515.se
424836755 gbinv1516.se
407409473 gbinv1517.se
392557971 gbinv1518.se
374840311 gbinv1519.se
496723739 gbinv152.seq
370687455 gbinv1520.se
364209018 gbinv1521.se
356043378 gbinv1522.se
470407388 gbinv1523.se
498144179 gbinv1524.se
440247259 gbinv1525.se
432569025 gbinv1526.se
473074066 gbinv1527.se
446787735 gbinv1528.se
490046306 gbinv1529.se
492757168 gbinv153.seq
458546137 gbinv1530.se
453744056 gbinv1531.se
485719553 gbinv1532.se
470688947 gbinv1533.se
499145969 gbinv1534.se
488679526 gbinv1535.se
383236752 gbinv1536.se
403063473 gbinv1537.se
491935868 gbinv1538.se
450996388 gbinv1539.se
483899601 gbinv154.seq
494574942 gbinv1540.se
190754233 gbinv1541.se
446572734 gbinv1542.se
349707818 gbinv1543.se
498341839 gbinv1544.se
475083978 gbinv1545.se
495586255 gbinv1546.se
493047765 gbinv1547.se
424336607 gbinv1548.se
445635419 gbinv1549.se
478256053 gbinv155.seq
496536598 gbinv1550.se
421970194 gbinv1551.se
304852181 gbinv1552.se
282782605 gbinv1553.se
287459144 gbinv1554.se
292138330 gbinv1555.se
278622574 gbinv1556.se
464187388 gbinv1557.se
365807256 gbinv1558.se
473318223 gbinv1559.se
492780857 gbinv156.seq
397532595 gbinv1560.se
499926253 gbinv1561.se
489834503 gbinv1562.se
494009263 gbinv1563.se
227606738 gbinv1564.se
354335913 gbinv1565.se
405308849 gbinv1566.se
373295374 gbinv1567.se
461408168 gbinv1568.se
468585870 gbinv1569.se
499976012 gbinv157.seq
465615394 gbinv1570.se
478206747 gbinv1571.se
470845488 gbinv1572.se
434630573 gbinv1573.se
449352694 gbinv1574.se
475961503 gbinv1575.se
499526122 gbinv1576.se
474588030 gbinv1577.se
497424296 gbinv1578.se
495011127 gbinv1579.se
498322008 gbinv158.seq
473393654 gbinv1580.se
492895518 gbinv1581.se
433798578 gbinv1582.se
497380186 gbinv1583.se
478698569 gbinv1584.se
493900539 gbinv1585.se
448881029 gbinv1586.se
491287252 gbinv1587.se
486729373 gbinv1588.se
490419273 gbinv1589.se
483551083 gbinv159.seq
466942698 gbinv1590.se
496628250 gbinv1591.se
415334432 gbinv1592.se
477729034 gbinv1593.se
389608539 gbinv1594.se
447782896 gbinv1595.se
379570416 gbinv1596.se
168050660 gbinv1597.se
402140341 gbinv1598.se
498521166 gbinv1599.se
495961065 gbinv16.seq
444451735 gbinv160.seq
487560937 gbinv1600.se
470237421 gbinv1601.se
251883025 gbinv1602.se
450021867 gbinv1603.se
456014148 gbinv1604.se
424453416 gbinv1605.se
489077138 gbinv1606.se
291935973 gbinv1607.se
447199297 gbinv1608.se
482287346 gbinv1609.se
483770018 gbinv161.seq
446762057 gbinv1610.se
478107977 gbinv1611.se
499941570 gbinv1612.se
250754094 gbinv1613.se
426775075 gbinv1614.se
469944018 gbinv1615.se
421658854 gbinv1616.se
156531103 gbinv1617.se
424023494 gbinv1618.se
458403575 gbinv1619.se
493575936 gbinv162.seq
760558437 gbinv1620.se
630932111 gbinv1621.se
269337227 gbinv1622.se
306383890 gbinv1623.se
362982048 gbinv1624.se
490460088 gbinv1625.se
490124242 gbinv1626.se
474114247 gbinv1627.se
414555840 gbinv1628.se
367764030 gbinv1629.se
498159917 gbinv163.seq
492318902 gbinv1630.se
465538889 gbinv1631.se
440087513 gbinv1632.se
402923832 gbinv1633.se
293890829 gbinv1634.se
480424893 gbinv1635.se
487780990 gbinv1636.se
497662462 gbinv1637.se
493315557 gbinv1638.se
454184050 gbinv1639.se
461241055 gbinv164.seq
453672339 gbinv1640.se
477783541 gbinv1641.se
396639389 gbinv1642.se
258248902 gbinv1643.se
457972032 gbinv1644.se
493145244 gbinv1645.se
83808633 gbinv1646.se
481310336 gbinv1647.se
484438327 gbinv1648.se
431604389 gbinv1649.se
429126369 gbinv165.seq
466521191 gbinv1650.se
479481937 gbinv1651.se
203515617 gbinv1652.se
438666095 gbinv1653.se
288710027 gbinv1654.se
587646776 gbinv1655.se
521821380 gbinv1656.se
488633320 gbinv1657.se
484849194 gbinv1658.se
494691429 gbinv1659.se
472246082 gbinv166.seq
84878173 gbinv1660.se
474082897 gbinv1661.se
328282042 gbinv1662.se
429294922 gbinv1663.se
376618222 gbinv1664.se
465450082 gbinv1665.se
191733239 gbinv1666.se
413988002 gbinv1667.se
346233485 gbinv1668.se
351456130 gbinv1669.se
487388602 gbinv167.seq
332888212 gbinv1670.se
344512888 gbinv1671.se
161969290 gbinv1672.se
466172748 gbinv1673.se
443973599 gbinv1674.se
439364738 gbinv1675.se
492660163 gbinv1676.se
421482701 gbinv1677.se
494043084 gbinv1678.se
349286868 gbinv1679.se
488621132 gbinv168.seq
401241900 gbinv1680.se
478917983 gbinv1681.se
476837170 gbinv1682.se
489355798 gbinv1683.se
455471572 gbinv1684.se
498384166 gbinv1685.se
319485498 gbinv1686.se
499130515 gbinv1687.se
487864427 gbinv1688.se
493398968 gbinv1689.se
492386538 gbinv169.seq
485556197 gbinv1690.se
485364037 gbinv1691.se
484935088 gbinv1692.se
466357014 gbinv1693.se
457733117 gbinv1694.se
392915750 gbinv1695.se
478478032 gbinv1696.se
393129850 gbinv1697.se
492543588 gbinv1698.se
450108923 gbinv1699.se
498728841 gbinv17.seq
410012642 gbinv170.seq
351978698 gbinv1700.se
478292534 gbinv1701.se
420767553 gbinv1702.se
481749728 gbinv1703.se
445278271 gbinv1704.se
412662975 gbinv1705.se
387090079 gbinv1706.se
256908256 gbinv1707.se
469736436 gbinv1708.se
490540910 gbinv1709.se
489753866 gbinv171.seq
485878260 gbinv1710.se
465587474 gbinv1711.se
480998150 gbinv1712.se
465832905 gbinv1713.se
485326493 gbinv1714.se
433309101 gbinv1715.se
440675008 gbinv1716.se
68735845 gbinv1717.se
450845716 gbinv1718.se
313135865 gbinv1719.se
486908019 gbinv172.seq
429536528 gbinv1720.se
394632639 gbinv1721.se
476444266 gbinv1722.se
496585001 gbinv1723.se
484815304 gbinv1724.se
498211104 gbinv1725.se
490032585 gbinv1726.se
88986595 gbinv1727.se
499092910 gbinv1728.se
471084800 gbinv1729.se
475277294 gbinv173.seq
479084211 gbinv1730.se
458027456 gbinv1731.se
183437281 gbinv1732.se
489133522 gbinv1733.se
480973066 gbinv1734.se
476620478 gbinv1735.se
484763605 gbinv1736.se
172605670 gbinv1737.se
476872305 gbinv1738.se
497217757 gbinv1739.se
499301159 gbinv174.seq
454084009 gbinv1740.se
490687872 gbinv1741.se
249163765 gbinv1742.se
446287432 gbinv1743.se
480747279 gbinv1744.se
477662208 gbinv1745.se
486024070 gbinv1746.se
138543432 gbinv1747.se
363404243 gbinv1748.se
440303391 gbinv1749.se
356777678 gbinv175.seq
428374310 gbinv1750.se
485262912 gbinv1751.se
313605393 gbinv1752.se
384773620 gbinv1753.se
344575448 gbinv1754.se
302995972 gbinv1755.se
489532826 gbinv1756.se
205630096 gbinv1757.se
469243590 gbinv1758.se
491841323 gbinv1759.se
461771503 gbinv176.seq
478814364 gbinv1760.se
449053948 gbinv1761.se
480874694 gbinv1762.se
305190058 gbinv1763.se
455945958 gbinv1764.se
299250305 gbinv1765.se
480931807 gbinv1766.se
439984634 gbinv1767.se
406664054 gbinv1768.se
381577942 gbinv1769.se
479426529 gbinv177.seq
185200260 gbinv1770.se
349601440 gbinv1771.se
480401561 gbinv1772.se
483626729 gbinv1773.se
247425526 gbinv1774.se
407101180 gbinv1775.se
364334325 gbinv1776.se
459985559 gbinv1777.se
404003999 gbinv1778.se
268459648 gbinv1779.se
494640587 gbinv178.seq
477702099 gbinv1780.se
460168850 gbinv1781.se
478963154 gbinv1782.se
324699595 gbinv1783.se
491566844 gbinv1784.se
484918227 gbinv1785.se
471411039 gbinv1786.se
401957469 gbinv1787.se
174828331 gbinv1788.se
456950968 gbinv1789.se
328489973 gbinv179.seq
452653049 gbinv1790.se
439521990 gbinv1791.se
469069239 gbinv1792.se
403378951 gbinv1793.se
498968159 gbinv1794.se
489660738 gbinv1795.se
447280245 gbinv1796.se
491313358 gbinv1797.se
473371583 gbinv1798.se
421938580 gbinv1799.se
485356809 gbinv18.seq
484117251 gbinv180.seq
461808273 gbinv1800.se
499047170 gbinv1801.se
448428578 gbinv1802.se
478899995 gbinv1803.se
433199933 gbinv1804.se
447202279 gbinv1805.se
499645462 gbinv1806.se
499728235 gbinv1807.se
281848846 gbinv1808.se
350069691 gbinv1809.se
499999053 gbinv181.seq
276080178 gbinv1810.se
249584187 gbinv1811.se
482294957 gbinv1812.se
432625059 gbinv1813.se
390302552 gbinv1814.se
356463371 gbinv1815.se
434548133 gbinv1816.se
499992092 gbinv1817.se
112145102 gbinv1818.se
498992007 gbinv1819.se
499996673 gbinv182.seq
493005878 gbinv1820.se
494399781 gbinv1821.se
463657580 gbinv1822.se
486200575 gbinv1823.se
296149363 gbinv1824.se
403805423 gbinv1825.se
343800410 gbinv1826.se
304171260 gbinv1827.se
296432606 gbinv1828.se
282298128 gbinv1829.se
116556457 gbinv183.seq
281277784 gbinv1830.se
272065061 gbinv1831.se
264586044 gbinv1832.se
488282800 gbinv1833.se
220144679 gbinv1834.se
416658392 gbinv1835.se
355528545 gbinv1836.se
440867432 gbinv1837.se
406695325 gbinv1838.se
485520087 gbinv1839.se
499998509 gbinv184.seq
456871825 gbinv1840.se
285317935 gbinv1841.se
435573273 gbinv1842.se
495486079 gbinv1843.se
478791254 gbinv1844.se
362223580 gbinv1845.se
463548723 gbinv1846.se
446713082 gbinv1847.se
492755543 gbinv1848.se
479071997 gbinv1849.se
500000250 gbinv185.seq
94856663 gbinv1850.se
487346963 gbinv1851.se
486480531 gbinv1852.se
491518484 gbinv1853.se
499253247 gbinv1854.se
492100745 gbinv1855.se
240584427 gbinv1856.se
473910512 gbinv1857.se
467512893 gbinv1858.se
489494146 gbinv1859.se
405150547 gbinv186.seq
481476018 gbinv1860.se
487782737 gbinv1861.se
323629222 gbinv1862.se
499999050 gbinv187.seq
499998884 gbinv188.seq
181391084 gbinv189.seq
256153500 gbinv19.seq
499997710 gbinv190.seq
499998790 gbinv191.seq
124879376 gbinv192.seq
499997245 gbinv193.seq
499997455 gbinv194.seq
151225007 gbinv195.seq
499998460 gbinv196.seq
499998057 gbinv197.seq
154518140 gbinv198.seq
499998346 gbinv199.seq
457128070 gbinv2.seq
497380639 gbinv20.seq
499996667 gbinv200.seq
188822378 gbinv201.seq
499996914 gbinv202.seq
500000155 gbinv203.seq
245841207 gbinv204.seq
499968427 gbinv205.seq
499998024 gbinv206.seq
499998902 gbinv207.seq
499996828 gbinv208.seq
149048703 gbinv209.seq
476460093 gbinv21.seq
499999374 gbinv210.seq
455573372 gbinv211.seq
289058569 gbinv212.seq
54983087 gbinv213.seq
52942591 gbinv214.seq
157076018 gbinv215.seq
499999147 gbinv216.seq
268190266 gbinv217.seq
499996088 gbinv218.seq
499997883 gbinv219.seq
439600490 gbinv22.seq
182060786 gbinv220.seq
499192390 gbinv221.seq
499768698 gbinv222.seq
498733787 gbinv223.seq
135328028 gbinv224.seq
496659695 gbinv225.seq
51960557 gbinv226.seq
466568646 gbinv227.seq
479577598 gbinv228.seq
450560355 gbinv229.seq
173964304 gbinv23.seq
482003105 gbinv230.seq
121049467 gbinv231.seq
494590358 gbinv232.seq
499153393 gbinv233.seq
499582279 gbinv234.seq
494046837 gbinv235.seq
498084896 gbinv236.seq
493910409 gbinv237.seq
305143352 gbinv238.seq
453012519 gbinv239.seq
490451259 gbinv24.seq
480839077 gbinv240.seq
375796260 gbinv241.seq
499933702 gbinv242.seq
485464339 gbinv243.seq
485283938 gbinv244.seq
498294953 gbinv245.seq
414580638 gbinv246.seq
498679440 gbinv247.seq
495007238 gbinv248.seq
486086193 gbinv249.seq
491062219 gbinv25.seq
483986740 gbinv250.seq
479016567 gbinv251.seq
377180280 gbinv252.seq
491313703 gbinv253.seq
482991950 gbinv254.seq
495169229 gbinv255.seq
493741890 gbinv256.seq
495500028 gbinv257.seq
371035005 gbinv258.seq
470293000 gbinv259.seq
470215242 gbinv26.seq
496253081 gbinv260.seq
496289838 gbinv261.seq
472378022 gbinv262.seq
493450323 gbinv263.seq
418570715 gbinv264.seq
493158119 gbinv265.seq
491119641 gbinv266.seq
465656312 gbinv267.seq
490891118 gbinv268.seq
459581775 gbinv269.seq
485523455 gbinv27.seq
406078142 gbinv270.seq
476900813 gbinv271.seq
481848691 gbinv272.seq
496747716 gbinv273.seq
492742204 gbinv274.seq
496271174 gbinv275.seq
392139815 gbinv276.seq
496951694 gbinv277.seq
492317100 gbinv278.seq
475961856 gbinv279.seq
174159504 gbinv28.seq
498252048 gbinv280.seq
496664764 gbinv281.seq
351267284 gbinv282.seq
454438248 gbinv283.seq
490109816 gbinv284.seq
477836082 gbinv285.seq
497117087 gbinv286.seq
273421111 gbinv287.seq
484550538 gbinv288.seq
486204454 gbinv289.seq
486730694 gbinv29.seq
489013669 gbinv290.seq
499892182 gbinv291.seq
389960712 gbinv292.seq
230763287 gbinv293.seq
433765668 gbinv294.seq
341801067 gbinv295.seq
488714019 gbinv296.seq
442231501 gbinv297.seq
498588264 gbinv298.seq
499228960 gbinv299.seq
500000047 gbinv3.seq
495353494 gbinv30.seq
194395415 gbinv300.seq
499999653 gbinv301.seq
499996564 gbinv302.seq
395714764 gbinv303.seq
499999777 gbinv304.seq
499997438 gbinv305.seq
234162663 gbinv306.seq
499999402 gbinv307.seq
499998895 gbinv308.seq
288220065 gbinv309.seq
471931517 gbinv31.seq
499998576 gbinv310.seq
499984290 gbinv311.seq
388532835 gbinv312.seq
499998224 gbinv313.seq
499998794 gbinv314.seq
499934671 gbinv315.seq
499906963 gbinv316.seq
345599526 gbinv317.seq
499999353 gbinv318.seq
499954513 gbinv319.seq
486628934 gbinv32.seq
394312187 gbinv320.seq
499998973 gbinv321.seq
499768151 gbinv322.seq
499935390 gbinv323.seq
262394318 gbinv324.seq
499489044 gbinv325.seq
499984461 gbinv326.seq
499999178 gbinv327.seq
219010924 gbinv328.seq
499665286 gbinv329.seq
497114880 gbinv33.seq
499954794 gbinv330.seq
499986274 gbinv331.seq
349517342 gbinv332.seq
500000137 gbinv333.seq
499979428 gbinv334.seq
499843177 gbinv335.seq
499948105 gbinv336.seq
500000223 gbinv337.seq
67122505 gbinv338.seq
499999636 gbinv339.seq
488719896 gbinv34.seq
499704487 gbinv340.seq
499897338 gbinv341.seq
499999895 gbinv342.seq
68002970 gbinv343.seq
499977802 gbinv344.seq
499904157 gbinv345.seq
499970007 gbinv346.seq
499999529 gbinv347.seq
499940074 gbinv348.seq
122380920 gbinv349.seq
319196831 gbinv35.seq
500000224 gbinv350.seq
499999552 gbinv351.seq
468683478 gbinv352.seq
499670167 gbinv353.seq
499934229 gbinv354.seq
499999149 gbinv355.seq
90103424 gbinv356.seq
499997513 gbinv357.seq
499998131 gbinv358.seq
499998504 gbinv359.seq
305989097 gbinv36.seq
499995849 gbinv360.seq
499994697 gbinv361.seq
127551371 gbinv362.seq
499998352 gbinv363.seq
499995294 gbinv364.seq
499998702 gbinv365.seq
40097141 gbinv366.seq
499997612 gbinv367.seq
499999713 gbinv368.seq
488643249 gbinv369.seq
499447601 gbinv37.seq
154317558 gbinv370.seq
481046566 gbinv371.seq
450037592 gbinv372.seq
303709120 gbinv373.seq
293451879 gbinv374.seq
280090292 gbinv375.seq
279807655 gbinv376.seq
274554291 gbinv377.seq
266890013 gbinv378.seq
491295680 gbinv379.seq
331575178 gbinv38.seq
418047621 gbinv380.seq
383074342 gbinv381.seq
489267408 gbinv382.seq
393039463 gbinv383.seq
484538449 gbinv384.seq
482310364 gbinv385.seq
491415359 gbinv386.seq
495004950 gbinv387.seq
484038821 gbinv388.seq
495670320 gbinv389.seq
409329256 gbinv39.seq
40846857 gbinv390.seq
492571202 gbinv391.seq
490206006 gbinv392.seq
445709424 gbinv393.seq
207302902 gbinv394.seq
370283947 gbinv395.seq
207800719 gbinv396.seq
403111025 gbinv397.seq
496966573 gbinv398.seq
495208718 gbinv399.seq
499160533 gbinv4.seq
337324220 gbinv40.seq
486338081 gbinv400.seq
491887863 gbinv401.seq
62682558 gbinv402.seq
487684874 gbinv403.seq
495915356 gbinv404.seq
497117994 gbinv405.seq
485878834 gbinv406.seq
336958408 gbinv407.seq
470338855 gbinv408.seq
473857916 gbinv409.seq
416902989 gbinv41.seq
488417194 gbinv410.seq
472996654 gbinv411.seq
444602917 gbinv412.seq
489109149 gbinv413.seq
489050714 gbinv414.seq
492905647 gbinv415.seq
464574397 gbinv416.seq
389650543 gbinv417.seq
499026362 gbinv418.seq
459755126 gbinv419.seq
480340526 gbinv42.seq
457336321 gbinv420.seq
468059538 gbinv421.seq
487547225 gbinv422.seq
494629437 gbinv423.seq
499368968 gbinv424.seq
425865947 gbinv425.seq
447703471 gbinv426.seq
471358720 gbinv427.seq
106488590 gbinv428.seq
494438067 gbinv429.seq
470719972 gbinv43.seq
499096313 gbinv430.seq
174717833 gbinv431.seq
439432672 gbinv432.seq
315017082 gbinv433.seq
247279447 gbinv434.seq
493106968 gbinv435.seq
482399453 gbinv436.seq
487563600 gbinv437.seq
495047837 gbinv438.seq
345419513 gbinv439.seq
478012779 gbinv44.seq
499133273 gbinv440.seq
496482189 gbinv441.seq
369581646 gbinv442.seq
456145557 gbinv443.seq
200285196 gbinv444.seq
495154413 gbinv445.seq
341654330 gbinv446.seq
336683654 gbinv447.seq
493060580 gbinv448.seq
107491235 gbinv449.seq
372274412 gbinv45.seq
487938647 gbinv450.seq
495763325 gbinv451.seq
481723089 gbinv452.seq
326171717 gbinv453.seq
485891711 gbinv454.seq
492821648 gbinv455.seq
471307712 gbinv456.seq
311911756 gbinv457.seq
499380148 gbinv458.seq
482084817 gbinv459.seq
473605830 gbinv46.seq
479662419 gbinv460.seq
363343706 gbinv461.seq
489746713 gbinv462.seq
499514774 gbinv463.seq
496438512 gbinv464.seq
492580334 gbinv465.seq
486836376 gbinv466.seq
496615730 gbinv467.seq
482720635 gbinv468.seq
134241704 gbinv469.seq
476844427 gbinv47.seq
493089306 gbinv470.seq
490891004 gbinv471.seq
498098866 gbinv472.seq
498391590 gbinv473.seq
493309439 gbinv474.seq
324291471 gbinv475.seq
484493924 gbinv476.seq
491069771 gbinv477.seq
494055574 gbinv478.seq
235593723 gbinv479.seq
486980011 gbinv48.seq
319983008 gbinv480.seq
484241023 gbinv481.seq
216170369 gbinv482.seq
218804026 gbinv483.seq
336455655 gbinv484.seq
297857601 gbinv485.seq
477593708 gbinv486.seq
493171167 gbinv487.seq
96653657 gbinv488.seq
401450903 gbinv489.seq
160013874 gbinv49.seq
471214414 gbinv490.seq
478230772 gbinv491.seq
481554780 gbinv492.seq
119372855 gbinv493.seq
489114034 gbinv494.seq
418974457 gbinv495.seq
492119058 gbinv496.seq
488068826 gbinv497.seq
86400276 gbinv498.seq
475977385 gbinv499.seq
499713007 gbinv5.seq
493935222 gbinv50.seq
479094391 gbinv500.seq
91925882 gbinv501.seq
498866242 gbinv502.seq
475446584 gbinv503.seq
492109157 gbinv504.seq
493644048 gbinv505.seq
450867996 gbinv506.seq
491759493 gbinv507.seq
84745799 gbinv508.seq
423732674 gbinv509.seq
422099764 gbinv51.seq
344360076 gbinv510.seq
487664625 gbinv511.seq
481798553 gbinv512.seq
419437573 gbinv513.seq
447480354 gbinv514.seq
458542150 gbinv515.seq
84187054 gbinv516.seq
476248749 gbinv517.seq
482272438 gbinv518.seq
498234741 gbinv519.seq
466237117 gbinv52.seq
471043224 gbinv520.seq
136592520 gbinv521.seq
495120952 gbinv522.seq
498047113 gbinv523.seq
493290837 gbinv524.seq
467613412 gbinv525.seq
464868282 gbinv526.seq
485108715 gbinv527.seq
70627368 gbinv528.seq
444909488 gbinv529.seq
490207614 gbinv53.seq
457689916 gbinv530.seq
485382078 gbinv531.seq
496105931 gbinv532.seq
484291167 gbinv533.seq
248438198 gbinv534.seq
413526177 gbinv535.seq
438000207 gbinv536.seq
487748206 gbinv537.seq
497322827 gbinv538.seq
171187065 gbinv539.seq
480431708 gbinv54.seq
404122148 gbinv540.seq
358274008 gbinv541.seq
352555230 gbinv542.seq
335719715 gbinv543.seq
334992684 gbinv544.seq
323934868 gbinv545.seq
323397124 gbinv546.seq
292340545 gbinv547.seq
497373639 gbinv548.seq
451425634 gbinv549.seq
268718981 gbinv55.seq
352564218 gbinv550.seq
457737190 gbinv551.seq
480925976 gbinv552.seq
482363288 gbinv553.seq
490058774 gbinv554.seq
457330992 gbinv555.seq
213313220 gbinv556.seq
475683221 gbinv557.seq
475722382 gbinv558.seq
474820474 gbinv559.seq
391536350 gbinv56.seq
463889606 gbinv560.seq
174479470 gbinv561.seq
467301426 gbinv562.seq
487596983 gbinv563.seq
466523941 gbinv564.seq
473849332 gbinv565.seq
271533425 gbinv566.seq
474315468 gbinv567.seq
422684936 gbinv568.seq
403437207 gbinv569.seq
441369502 gbinv57.seq
460401414 gbinv570.seq
495684114 gbinv571.seq
496931437 gbinv572.seq
255707629 gbinv573.seq
488417645 gbinv574.seq
493391118 gbinv575.seq
430721640 gbinv576.seq
483962961 gbinv577.seq
482614063 gbinv578.seq
466924368 gbinv579.seq
395604817 gbinv58.seq
153705523 gbinv580.seq
469807657 gbinv581.seq
497173372 gbinv582.seq
486068129 gbinv583.seq
497761269 gbinv584.seq
483774021 gbinv585.seq
208975227 gbinv586.seq
482561048 gbinv587.seq
489387386 gbinv588.seq
174750473 gbinv589.seq
484951437 gbinv59.seq
520668510 gbinv590.seq
439679373 gbinv591.seq
76608705 gbinv592.seq
544459581 gbinv593.seq
291577990 gbinv594.seq
499183813 gbinv595.seq
449457434 gbinv596.seq
403099826 gbinv597.seq
426341523 gbinv598.seq
452289588 gbinv599.seq
371668925 gbinv6.seq
431159123 gbinv60.seq
332054885 gbinv600.seq
216067261 gbinv601.seq
363589773 gbinv602.seq
349108604 gbinv603.seq
466080734 gbinv604.seq
433540835 gbinv605.seq
325349387 gbinv606.seq
414135977 gbinv607.seq
443362325 gbinv608.seq
458656169 gbinv609.seq
449767967 gbinv61.seq
469667434 gbinv610.seq
275644987 gbinv611.seq
446552014 gbinv612.seq
480169917 gbinv613.seq
474041236 gbinv614.seq
439739785 gbinv615.seq
415879695 gbinv616.seq
467640439 gbinv617.seq
312202563 gbinv618.seq
476756795 gbinv619.seq
494181873 gbinv62.seq
477061626 gbinv620.seq
483683490 gbinv621.seq
495487713 gbinv622.seq
69234679 gbinv623.seq
477792636 gbinv624.seq
492728468 gbinv625.seq
425135691 gbinv626.seq
353041445 gbinv627.seq
470334960 gbinv628.seq
494601058 gbinv629.seq
497557396 gbinv63.seq
481221711 gbinv630.seq
396473476 gbinv631.seq
483642314 gbinv632.seq
482127664 gbinv633.seq
470874419 gbinv634.seq
495029689 gbinv635.seq
99066263 gbinv636.seq
477955845 gbinv637.seq
452660426 gbinv638.seq
467009813 gbinv639.seq
409223006 gbinv64.seq
409211575 gbinv640.seq
281441527 gbinv641.seq
321243822 gbinv642.seq
272762615 gbinv643.seq
459220600 gbinv644.seq
380210496 gbinv645.seq
157861358 gbinv646.seq
496825048 gbinv647.seq
457058797 gbinv648.seq
475749694 gbinv649.seq
432405101 gbinv65.seq
458940745 gbinv650.seq
478290025 gbinv651.seq
201201186 gbinv652.seq
476458619 gbinv653.seq
472367844 gbinv654.seq
491956509 gbinv655.seq
445112980 gbinv656.seq
478727516 gbinv657.seq
213103145 gbinv658.seq
426002690 gbinv659.seq
302298162 gbinv66.seq
491306551 gbinv660.seq
485922068 gbinv661.seq
470775025 gbinv662.seq
259886474 gbinv663.seq
323358243 gbinv664.seq
292361181 gbinv665.seq
472027339 gbinv666.seq
394618639 gbinv667.seq
498685113 gbinv668.seq
252840705 gbinv669.seq
474204665 gbinv67.seq
409818882 gbinv670.seq
483153574 gbinv671.seq
356373819 gbinv672.seq
382117771 gbinv673.seq
414986838 gbinv674.seq
358562967 gbinv675.seq
454612949 gbinv676.seq
397094236 gbinv677.seq
472022816 gbinv678.seq
375604154 gbinv679.seq
499406905 gbinv68.seq
260058125 gbinv680.seq
416870448 gbinv681.seq
337551656 gbinv682.seq
323476118 gbinv683.seq
316192878 gbinv684.seq
483033075 gbinv685.seq
484553056 gbinv686.seq
485400895 gbinv687.seq
444237062 gbinv688.seq
115137081 gbinv689.seq
493280432 gbinv69.seq
465061268 gbinv690.seq
450665417 gbinv691.seq
495339385 gbinv692.seq
358679242 gbinv693.seq
488909847 gbinv694.seq
494569731 gbinv695.seq
446419168 gbinv696.seq
393089050 gbinv697.seq
119924885 gbinv698.seq
475723349 gbinv699.seq
462608484 gbinv7.seq
319188821 gbinv70.seq
418498253 gbinv700.seq
487729463 gbinv701.seq
442064966 gbinv702.seq
459399034 gbinv703.seq
476019529 gbinv704.seq
489445959 gbinv705.seq
488427181 gbinv706.seq
39113487 gbinv707.seq
478318630 gbinv708.seq
485192704 gbinv709.seq
491655073 gbinv71.seq
487924132 gbinv710.seq
367187723 gbinv711.seq
491253033 gbinv712.seq
492099884 gbinv713.seq
492318782 gbinv714.seq
490488560 gbinv715.seq
264709414 gbinv716.seq
498243322 gbinv717.seq
461893097 gbinv718.seq
479536374 gbinv719.seq
492219703 gbinv72.seq
498214872 gbinv720.seq
358503530 gbinv721.seq
497880059 gbinv722.seq
328840422 gbinv723.seq
388768319 gbinv724.seq
497514162 gbinv725.seq
102760609 gbinv726.seq
424365480 gbinv727.seq
415464839 gbinv728.seq
468645236 gbinv729.seq
480268373 gbinv73.seq
491418312 gbinv730.seq
422461178 gbinv731.seq
494059900 gbinv732.seq
492105201 gbinv733.seq
371680457 gbinv734.seq
418666111 gbinv735.seq
385203223 gbinv736.seq
490161407 gbinv737.seq
462283913 gbinv738.seq
497343220 gbinv739.seq
380543400 gbinv74.seq
483358775 gbinv740.seq
419495810 gbinv741.seq
495088992 gbinv742.seq
118039128 gbinv743.seq
460760613 gbinv744.seq
474795905 gbinv745.seq
448271770 gbinv746.seq
447953092 gbinv747.seq
397698504 gbinv748.seq
412906977 gbinv749.seq
498478577 gbinv75.seq
414039055 gbinv750.seq
373499990 gbinv751.seq
352095009 gbinv752.seq
171624580 gbinv753.seq
492880950 gbinv754.seq
496329611 gbinv755.seq
495293458 gbinv756.seq
326435281 gbinv757.seq
478875133 gbinv758.seq
438224962 gbinv759.seq
489123698 gbinv76.seq
474184048 gbinv760.seq
357686295 gbinv761.seq
465465282 gbinv762.seq
485209832 gbinv763.seq
427730310 gbinv764.seq
361113223 gbinv765.seq
482159714 gbinv766.seq
495382944 gbinv767.seq
299589099 gbinv768.seq
321246481 gbinv769.seq
498905574 gbinv77.seq
309309582 gbinv770.seq
488604754 gbinv771.seq
410235494 gbinv772.seq
495922375 gbinv773.seq
434632204 gbinv774.seq
74348655 gbinv775.seq
541537247 gbinv776.seq
355690685 gbinv777.seq
292909846 gbinv778.seq
463584322 gbinv779.seq
234808936 gbinv78.seq
387676008 gbinv780.seq
372674865 gbinv781.seq
485847387 gbinv782.seq
484407673 gbinv783.seq
473708314 gbinv784.seq
352986490 gbinv785.seq
443627527 gbinv786.seq
434076487 gbinv787.seq
478667921 gbinv788.seq
488478103 gbinv789.seq
466465897 gbinv79.seq
306326401 gbinv790.seq
385565833 gbinv791.seq
482190195 gbinv792.seq
137160705 gbinv793.seq
490300743 gbinv794.seq
419187067 gbinv795.seq
398652960 gbinv796.seq
436288257 gbinv797.seq
493888501 gbinv798.seq
447343866 gbinv799.seq
446653334 gbinv8.seq
473206517 gbinv80.seq
496950073 gbinv800.seq
68378185 gbinv801.seq
484369453 gbinv802.seq
474926486 gbinv803.seq
480605871 gbinv804.seq
489403870 gbinv805.seq
489850852 gbinv806.seq
483923401 gbinv807.seq
195051546 gbinv808.seq
278317571 gbinv809.seq
478992009 gbinv81.seq
405202233 gbinv810.seq
481613416 gbinv811.seq
483053144 gbinv812.seq
140617338 gbinv813.seq
480377160 gbinv814.seq
499100085 gbinv815.seq
495490578 gbinv816.seq
401267230 gbinv817.seq
334138952 gbinv818.seq
475047240 gbinv819.seq
282038790 gbinv82.seq
428648405 gbinv820.seq
378490165 gbinv821.seq
487837824 gbinv822.seq
491255029 gbinv823.seq
375538343 gbinv824.seq
353621722 gbinv825.seq
408852378 gbinv826.seq
494054422 gbinv827.seq
437725967 gbinv828.seq
364183673 gbinv829.seq
478991943 gbinv83.seq
466430597 gbinv830.seq
418516710 gbinv831.seq
347070086 gbinv832.seq
481701036 gbinv833.seq
453274315 gbinv834.seq
496564297 gbinv835.seq
467957545 gbinv836.seq
479873706 gbinv837.seq
479944057 gbinv838.seq
154655407 gbinv839.seq
483677905 gbinv84.seq
464570217 gbinv840.seq
498339612 gbinv841.seq
474586953 gbinv842.seq
481881129 gbinv843.seq
132360635 gbinv844.seq
377651382 gbinv845.seq
471908759 gbinv846.seq
346087536 gbinv847.seq
221434064 gbinv848.seq
312336498 gbinv849.seq
483677903 gbinv85.seq
482097150 gbinv850.seq
426274349 gbinv851.seq
491798282 gbinv852.seq
456244166 gbinv853.seq
498886557 gbinv854.seq
413523689 gbinv855.seq
494612233 gbinv856.seq
269134738 gbinv857.seq
458119773 gbinv858.seq
492920478 gbinv859.seq
309424683 gbinv86.seq
331278911 gbinv860.seq
237876308 gbinv861.seq
380568436 gbinv862.seq
323208797 gbinv863.seq
298483269 gbinv864.seq
296444100 gbinv865.seq
461753371 gbinv866.seq
66028693 gbinv867.seq
499911575 gbinv868.seq
471640101 gbinv869.seq
483677981 gbinv87.seq
447745268 gbinv870.seq
441848406 gbinv871.seq
180180054 gbinv872.seq
470673110 gbinv873.seq
492815961 gbinv874.seq
498278063 gbinv875.seq
445601713 gbinv876.seq
469989934 gbinv877.seq
478205479 gbinv878.seq
459587666 gbinv879.seq
483678137 gbinv88.seq
272670030 gbinv880.seq
227990903 gbinv881.seq
413244998 gbinv882.seq
498213748 gbinv883.seq
449979801 gbinv884.seq
461330907 gbinv885.seq
294874575 gbinv886.seq
405670616 gbinv887.seq
474471565 gbinv888.seq
439625427 gbinv889.seq
478992326 gbinv89.seq
463229555 gbinv890.seq
464851338 gbinv891.seq
455511857 gbinv892.seq
439389009 gbinv893.seq
405283735 gbinv894.seq
419761690 gbinv895.seq
406996610 gbinv896.seq
442305653 gbinv897.seq
479961209 gbinv898.seq
282852446 gbinv899.seq
485749846 gbinv9.seq
271721852 gbinv90.seq
494971745 gbinv900.seq
459071349 gbinv901.seq
457510304 gbinv902.seq
482562593 gbinv903.seq
413357535 gbinv904.seq
381806397 gbinv905.seq
357962786 gbinv906.seq
482830686 gbinv907.seq
494826362 gbinv908.seq
370208813 gbinv909.seq
473206806 gbinv91.seq
428586963 gbinv910.seq
123105615 gbinv911.seq
423910707 gbinv912.seq
460666534 gbinv913.seq
432539703 gbinv914.seq
384196500 gbinv915.seq
348330627 gbinv916.seq
449196792 gbinv917.seq
388541575 gbinv918.seq
386427271 gbinv919.seq
476783192 gbinv92.seq
495791066 gbinv920.seq
479478002 gbinv921.seq
80923082 gbinv922.seq
468644389 gbinv923.seq
487921921 gbinv924.seq
470328373 gbinv925.seq
468642645 gbinv926.seq
411136544 gbinv927.seq
462696619 gbinv928.seq
493415138 gbinv929.seq
479030351 gbinv93.seq
499955696 gbinv930.seq
484026075 gbinv931.seq
483632078 gbinv932.seq
496808153 gbinv933.seq
162547431 gbinv934.seq
455355382 gbinv935.seq
452744560 gbinv936.seq
457356752 gbinv937.seq
492140801 gbinv938.seq
477236440 gbinv939.seq
309386799 gbinv94.seq
440746130 gbinv940.seq
201920044 gbinv941.seq
351798642 gbinv942.seq
407318285 gbinv943.seq
497577312 gbinv944.seq
297816794 gbinv945.seq
465053752 gbinv946.seq
477543055 gbinv947.seq
488522642 gbinv948.seq
485383082 gbinv949.seq
477840597 gbinv95.seq
494197670 gbinv950.seq
492976606 gbinv951.seq
491252062 gbinv952.seq
485879488 gbinv953.seq
184862936 gbinv954.seq
490499065 gbinv955.seq
473434617 gbinv956.seq
491357576 gbinv957.seq
482466282 gbinv958.seq
488062265 gbinv959.seq
487392428 gbinv96.seq
207127102 gbinv960.seq
483701457 gbinv961.seq
474847426 gbinv962.seq
392959411 gbinv963.seq
283167653 gbinv964.seq
394326806 gbinv965.seq
386741280 gbinv966.seq
148537239 gbinv967.seq
412230439 gbinv968.seq
434620162 gbinv969.seq
489703622 gbinv97.seq
494101468 gbinv970.seq
494548234 gbinv971.seq
436233527 gbinv972.seq
493245062 gbinv973.seq
474858921 gbinv974.seq
85346444 gbinv975.seq
449524998 gbinv976.seq
387985633 gbinv977.seq
480105396 gbinv978.seq
468490309 gbinv979.seq
276099327 gbinv98.seq
33888816 gbinv980.seq
316525209 gbinv981.seq
491028997 gbinv982.seq
492549691 gbinv983.seq
490858334 gbinv984.seq
480371330 gbinv985.seq
485115876 gbinv986.seq
185082058 gbinv987.seq
468046278 gbinv988.seq
494868031 gbinv989.seq
494542524 gbinv99.seq
494549890 gbinv990.seq
464492176 gbinv991.seq
479062193 gbinv992.seq
229136178 gbinv993.seq
496620898 gbinv994.seq
489401016 gbinv995.seq
473706349 gbinv996.seq
492517013 gbinv997.seq
489752524 gbinv998.seq
424310251 gbinv999.seq
499998368 gbmam1.seq
82814289 gbmam10.seq
468294588 gbmam100.seq
497569810 gbmam101.seq
377746248 gbmam102.seq
460747192 gbmam103.seq
150130544 gbmam104.seq
416665241 gbmam105.seq
456214450 gbmam106.seq
486132453 gbmam107.seq
483844712 gbmam108.seq
437064425 gbmam109.seq
71270358 gbmam11.seq
223540742 gbmam110.seq
451994163 gbmam111.seq
449442494 gbmam112.seq
428332658 gbmam113.seq
499998403 gbmam114.seq
499999908 gbmam115.seq
472678944 gbmam116.seq
348089742 gbmam117.seq
373183698 gbmam118.seq
467160879 gbmam119.seq
22560541 gbmam12.seq
457054238 gbmam120.seq
483676806 gbmam121.seq
409916232 gbmam122.seq
398303012 gbmam123.seq
346344396 gbmam124.seq
274828989 gbmam125.seq
266926791 gbmam126.seq
442156622 gbmam127.seq
394957817 gbmam128.seq
359859430 gbmam129.seq
1268288 gbmam13.seq
441833973 gbmam130.seq
467878018 gbmam131.seq
460914273 gbmam132.seq
77886542 gbmam133.seq
384335011 gbmam134.seq
490312196 gbmam135.seq
385325611 gbmam136.seq
473911567 gbmam137.seq
413152711 gbmam138.seq
479361008 gbmam139.seq
378312043 gbmam14.seq
435411678 gbmam140.seq
197832427 gbmam141.seq
374823133 gbmam142.seq
463547765 gbmam143.seq
439985383 gbmam144.seq
408172038 gbmam145.seq
432812311 gbmam146.seq
459597410 gbmam147.seq
495156885 gbmam148.seq
327564081 gbmam149.seq
338653928 gbmam15.seq
422791489 gbmam150.seq
491401632 gbmam151.seq
449317136 gbmam152.seq
287465618 gbmam153.seq
394362643 gbmam154.seq
439407312 gbmam155.seq
453590059 gbmam156.seq
469351291 gbmam157.seq
67268930 gbmam158.seq
483520870 gbmam159.seq
477859984 gbmam16.seq
480679033 gbmam160.seq
410124870 gbmam161.seq
460089444 gbmam162.seq
273447476 gbmam163.seq
472899893 gbmam164.seq
469419756 gbmam165.seq
290267902 gbmam166.seq
453331085 gbmam167.seq
187958881 gbmam168.seq
352138940 gbmam169.seq
445458565 gbmam17.seq
440262201 gbmam170.seq
401683994 gbmam171.seq
455777749 gbmam172.seq
465167960 gbmam173.seq
44571261 gbmam174.seq
449685039 gbmam175.seq
404827665 gbmam176.seq
447228326 gbmam177.seq
494282867 gbmam178.seq
425898549 gbmam179.seq
122412952 gbmam18.seq
165392109 gbmam180.seq
457263770 gbmam181.seq
324046918 gbmam182.seq
339102216 gbmam183.seq
323096334 gbmam184.seq
358506878 gbmam185.seq
422099488 gbmam186.seq
440058971 gbmam187.seq
394948573 gbmam188.seq
469038481 gbmam189.seq
451114191 gbmam19.seq
465364880 gbmam190.seq
477461411 gbmam191.seq
236798673 gbmam192.seq
269398733 gbmam193.seq
253603154 gbmam194.seq
381680709 gbmam195.seq
259094846 gbmam196.seq
433914327 gbmam197.seq
473689213 gbmam198.seq
499762686 gbmam199.seq
399286830 gbmam2.seq
418062936 gbmam20.seq
225944987 gbmam200.seq
402292620 gbmam201.seq
484267156 gbmam202.seq
422021843 gbmam203.seq
490305734 gbmam204.seq
112546871 gbmam205.seq
497927921 gbmam206.seq
377275105 gbmam207.seq
468953574 gbmam208.seq
375382417 gbmam209.seq
499818179 gbmam21.seq
479246766 gbmam210.seq
432957019 gbmam211.seq
493590582 gbmam212.seq
329856862 gbmam213.seq
320418665 gbmam214.seq
267180870 gbmam215.seq
494229345 gbmam216.seq
467852307 gbmam217.seq
169801131 gbmam218.seq
484790256 gbmam219.seq
462376348 gbmam22.seq
441563731 gbmam220.seq
488307435 gbmam221.seq
465828461 gbmam222.seq
440072400 gbmam223.seq
498165380 gbmam224.seq
417880520 gbmam225.seq
476061385 gbmam226.seq
168979186 gbmam227.seq
481542732 gbmam228.seq
477958396 gbmam229.seq
370510647 gbmam23.seq
356503297 gbmam230.seq
452219504 gbmam231.seq
373237938 gbmam232.seq
474361951 gbmam233.seq
407382471 gbmam234.seq
471880001 gbmam235.seq
499955615 gbmam236.seq
446124674 gbmam237.seq
428305446 gbmam238.seq
406513882 gbmam239.seq
446296416 gbmam24.seq
496219854 gbmam240.seq
493963774 gbmam241.seq
438662527 gbmam242.seq
296563085 gbmam243.seq
281941182 gbmam244.seq
456589692 gbmam245.seq
418783593 gbmam246.seq
463645501 gbmam247.seq
439299057 gbmam248.seq
305561734 gbmam249.seq
431104435 gbmam25.seq
315163717 gbmam250.seq
291683593 gbmam251.seq
288961940 gbmam252.seq
480494424 gbmam253.seq
453137211 gbmam254.seq
421005676 gbmam255.seq
485358028 gbmam256.seq
238286100 gbmam257.seq
443551588 gbmam258.seq
363178461 gbmam259.seq
480602942 gbmam26.seq
451506905 gbmam260.seq
400618499 gbmam261.seq
471189051 gbmam262.seq
498164186 gbmam263.seq
127842067 gbmam264.seq
275430940 gbmam265.seq
261153012 gbmam266.seq
490824593 gbmam267.seq
398633269 gbmam268.seq
365676919 gbmam269.seq
479109855 gbmam27.seq
478729236 gbmam270.seq
491973006 gbmam271.seq
350082314 gbmam272.seq
483903273 gbmam28.seq
483307002 gbmam29.seq
400559326 gbmam3.seq
48405032 gbmam30.seq
363174382 gbmam31.seq
437246747 gbmam32.seq
470828962 gbmam33.seq
402408906 gbmam34.seq
304109928 gbmam35.seq
452443739 gbmam36.seq
451303958 gbmam37.seq
495648598 gbmam38.seq
405636626 gbmam39.seq
477148353 gbmam4.seq
410457734 gbmam40.seq
441553748 gbmam41.seq
367146984 gbmam42.seq
478421809 gbmam43.seq
316388332 gbmam44.seq
352226884 gbmam45.seq
195247700 gbmam46.seq
474022452 gbmam47.seq
378020853 gbmam48.seq
450136561 gbmam49.seq
374653134 gbmam5.seq
450750944 gbmam50.seq
468132660 gbmam51.seq
492835688 gbmam52.seq
75338832 gbmam53.seq
366599996 gbmam54.seq
281001866 gbmam55.seq
437173285 gbmam56.seq
347414819 gbmam57.seq
449179935 gbmam58.seq
401264497 gbmam59.seq
487713568 gbmam6.seq
485087002 gbmam60.seq
9943400 gbmam61.seq
43988539 gbmam62.seq
91321391 gbmam63.seq
88809559 gbmam64.seq
6363338 gbmam65.seq
21003343 gbmam66.seq
449523494 gbmam67.seq
423583311 gbmam68.seq
453840584 gbmam69.seq
401181424 gbmam7.seq
491149506 gbmam70.seq
425479852 gbmam71.seq
461110029 gbmam72.seq
385606603 gbmam73.seq
489901313 gbmam74.seq
499997631 gbmam75.seq
499999736 gbmam76.seq
25799059 gbmam77.seq
907465328 gbmam78.seq
839494897 gbmam79.seq
435129139 gbmam8.seq
774395849 gbmam80.seq
588873740 gbmam81.seq
364960392 gbmam82.seq
428298067 gbmam83.seq
283039909 gbmam84.seq
266822134 gbmam85.seq
255007062 gbmam86.seq
250435267 gbmam87.seq
405637168 gbmam88.seq
372091530 gbmam89.seq
275778814 gbmam9.seq
465555642 gbmam90.seq
444923834 gbmam91.seq
341582221 gbmam92.seq
257946240 gbmam93.seq
485829704 gbmam94.seq
486026993 gbmam95.seq
483298905 gbmam96.seq
494677523 gbmam97.seq
335874920 gbmam98.seq
464872853 gbmam99.seq
26881467 gbnew.txt
499997781 gbpat1.seq
499999978 gbpat10.seq
499999036 gbpat100.seq
499999497 gbpat101.seq
499997525 gbpat102.seq
228719622 gbpat103.seq
500000251 gbpat104.seq
500000174 gbpat105.seq
499999692 gbpat106.seq
335512882 gbpat107.seq
499998499 gbpat108.seq
499999295 gbpat109.seq
499997636 gbpat11.seq
210521571 gbpat110.seq
499924528 gbpat111.seq
499996623 gbpat112.seq
174127663 gbpat113.seq
499998868 gbpat114.seq
499998125 gbpat115.seq
499990060 gbpat116.seq
8731691 gbpat117.seq
499726254 gbpat118.seq
382812845 gbpat119.seq
179028884 gbpat12.seq
499998900 gbpat120.seq
499998132 gbpat121.seq
499992686 gbpat122.seq
499998945 gbpat123.seq
56638340 gbpat124.seq
499990147 gbpat125.seq
499999173 gbpat126.seq
208443590 gbpat127.seq
500000246 gbpat128.seq
499999970 gbpat129.seq
499953415 gbpat13.seq
59343162 gbpat130.seq
499999871 gbpat131.seq
499996324 gbpat132.seq
488850771 gbpat133.seq
499999911 gbpat134.seq
499998089 gbpat135.seq
28279117 gbpat136.seq
499997540 gbpat137.seq
385160747 gbpat138.seq
499999318 gbpat139.seq
499999854 gbpat14.seq
500000185 gbpat140.seq
148512982 gbpat141.seq
499995478 gbpat142.seq
314551576 gbpat143.seq
499988381 gbpat144.seq
499980283 gbpat145.seq
409538104 gbpat146.seq
500000154 gbpat147.seq
499978765 gbpat148.seq
125987771 gbpat149.seq
62743871 gbpat15.seq
499989559 gbpat150.seq
499995251 gbpat151.seq
499998971 gbpat152.seq
499997529 gbpat153.seq
169879712 gbpat154.seq
499998369 gbpat155.seq
426349690 gbpat156.seq
499999557 gbpat157.seq
499999554 gbpat158.seq
499926630 gbpat159.seq
499998957 gbpat16.seq
353563233 gbpat160.seq
499999413 gbpat161.seq
500000109 gbpat162.seq
291233649 gbpat163.seq
499999569 gbpat164.seq
499998633 gbpat165.seq
500000127 gbpat166.seq
102914130 gbpat167.seq
499988348 gbpat168.seq
499993882 gbpat169.seq
499998817 gbpat17.seq
499993951 gbpat170.seq
499999217 gbpat171.seq
301725661 gbpat172.seq
500000190 gbpat173.seq
499999447 gbpat174.seq
499998935 gbpat175.seq
319773201 gbpat176.seq
499603198 gbpat177.seq
499999805 gbpat178.seq
499999721 gbpat179.seq
422091611 gbpat18.seq
13390185 gbpat180.seq
497266519 gbpat181.seq
499998655 gbpat182.seq
499998706 gbpat183.seq
86838124 gbpat184.seq
499932018 gbpat185.seq
499999973 gbpat186.seq
499998109 gbpat187.seq
39745949 gbpat188.seq
499282951 gbpat189.seq
499901014 gbpat19.seq
500000091 gbpat190.seq
500000128 gbpat191.seq
499999465 gbpat192.seq
96581447 gbpat193.seq
499883592 gbpat194.seq
499997535 gbpat195.seq
499999338 gbpat196.seq
499999041 gbpat197.seq
90169363 gbpat198.seq
499992973 gbpat199.seq
499999607 gbpat2.seq
499998369 gbpat20.seq
499994277 gbpat200.seq
499998512 gbpat201.seq
499999298 gbpat202.seq
4092526 gbpat203.seq
499999756 gbpat204.seq
499999459 gbpat205.seq
500000244 gbpat206.seq
478202129 gbpat207.seq
500000054 gbpat208.seq
499999577 gbpat209.seq
499999980 gbpat21.seq
321705067 gbpat210.seq
499991396 gbpat211.seq
499963719 gbpat212.seq
350635988 gbpat213.seq
497506292 gbpat214.seq
499869540 gbpat215.seq
421452571 gbpat216.seq
499425936 gbpat217.seq
499999361 gbpat218.seq
336263474 gbpat219.seq
347865952 gbpat22.seq
499998549 gbpat220.seq
499999023 gbpat221.seq
499999828 gbpat222.seq
361439206 gbpat223.seq
499999662 gbpat224.seq
494515367 gbpat225.seq
341868206 gbpat226.seq
499999744 gbpat227.seq
500000159 gbpat228.seq
366896749 gbpat229.seq
499993576 gbpat23.seq
499999946 gbpat230.seq
499335751 gbpat231.seq
389256092 gbpat232.seq
499996721 gbpat233.seq
500000056 gbpat234.seq
498671374 gbpat235.seq
499998420 gbpat236.seq
499998403 gbpat237.seq
21956630 gbpat238.seq
499998662 gbpat239.seq
499999495 gbpat24.seq
499999933 gbpat240.seq
499999918 gbpat241.seq
499999385 gbpat242.seq
488118897 gbpat243.seq
499999639 gbpat244.seq
499997091 gbpat245.seq
499999375 gbpat246.seq
187729792 gbpat247.seq
500000259 gbpat248.seq
499999167 gbpat249.seq
499527123 gbpat25.seq
481540759 gbpat250.seq
495284053 gbpat251.seq
500000161 gbpat252.seq
389872169 gbpat253.seq
499735576 gbpat254.seq
499999196 gbpat255.seq
499997403 gbpat256.seq
499999197 gbpat257.seq
388500439 gbpat258.seq
499999586 gbpat259.seq
499999623 gbpat26.seq
499999077 gbpat260.seq
444239420 gbpat261.seq
166814863 gbpat27.seq
499998273 gbpat28.seq
500000116 gbpat29.seq
61247109 gbpat3.seq
213213665 gbpat30.seq
499999775 gbpat31.seq
406039996 gbpat32.seq
499995733 gbpat33.seq
499999866 gbpat34.seq
126624976 gbpat35.seq
499998110 gbpat36.seq
499998229 gbpat37.seq
499999737 gbpat38.seq
140161176 gbpat39.seq
499999373 gbpat4.seq
499999717 gbpat40.seq
493990713 gbpat41.seq
494767586 gbpat42.seq
500000135 gbpat43.seq
149227782 gbpat44.seq
499999126 gbpat45.seq
499999712 gbpat46.seq
499999861 gbpat47.seq
87880943 gbpat48.seq
499999163 gbpat49.seq
500000003 gbpat5.seq
499999914 gbpat50.seq
499998939 gbpat51.seq
130970228 gbpat52.seq
499999701 gbpat53.seq
499999084 gbpat54.seq
185010162 gbpat55.seq
499999726 gbpat56.seq
499999154 gbpat57.seq
137265710 gbpat58.seq
499998902 gbpat59.seq
418925462 gbpat6.seq
499638184 gbpat60.seq
429858608 gbpat61.seq
499999681 gbpat62.seq
321464299 gbpat63.seq
499999736 gbpat64.seq
499999570 gbpat65.seq
306450921 gbpat66.seq
499999595 gbpat67.seq
499997159 gbpat68.seq
144919043 gbpat69.seq
499999165 gbpat7.seq
499999495 gbpat70.seq
226235202 gbpat71.seq
499942763 gbpat72.seq
500000257 gbpat73.seq
309555677 gbpat74.seq
499990988 gbpat75.seq
499996904 gbpat76.seq
259606120 gbpat77.seq
499998418 gbpat78.seq
499997914 gbpat79.seq
499998849 gbpat8.seq
36785301 gbpat80.seq
500000256 gbpat81.seq
474766116 gbpat82.seq
500000188 gbpat83.seq
331724995 gbpat84.seq
499998777 gbpat85.seq
312342224 gbpat86.seq
499999526 gbpat87.seq
500000130 gbpat88.seq
499998086 gbpat89.seq
317303686 gbpat9.seq
205546057 gbpat90.seq
499999444 gbpat91.seq
455869832 gbpat92.seq
499983275 gbpat93.seq
252314441 gbpat94.seq
499998816 gbpat95.seq
499998875 gbpat96.seq
83002461 gbpat97.seq
499999689 gbpat98.seq
498236426 gbpat99.seq
499839952 gbphg1.seq
499967979 gbphg2.seq
499965327 gbphg3.seq
499990567 gbphg4.seq
499947720 gbphg5.seq
499962676 gbphg6.seq
37025143 gbphg7.seq
499998297 gbpln1.seq
269118160 gbpln10.seq
422837726 gbpln100.seq
732833309 gbpln1000.se
468601371 gbpln1001.se
493398868 gbpln1002.se
474782479 gbpln1003.se
380660146 gbpln1004.se
467902933 gbpln1005.se
216458899 gbpln1006.se
767568441 gbpln1007.se
890586336 gbpln1008.se
628166166 gbpln1009.se
383453844 gbpln101.seq
1008494770 gbpln1010.se
987228440 gbpln1011.se
843057146 gbpln1012.se
959088227 gbpln1013.se
1080118900 gbpln1014.se
790032689 gbpln1015.se
943744808 gbpln1016.se
858758923 gbpln1017.se
664109824 gbpln1018.se
920678548 gbpln1019.se
376172116 gbpln102.seq
888501597 gbpln1020.se
739915904 gbpln1021.se
788736236 gbpln1022.se
944601115 gbpln1023.se
621465899 gbpln1024.se
948555731 gbpln1025.se
954911743 gbpln1026.se
815610131 gbpln1027.se
39280847 gbpln1028.se
752395252 gbpln1029.se
326317073 gbpln103.seq
890282442 gbpln1030.se
626588938 gbpln1031.se
1004358314 gbpln1032.se
1028945403 gbpln1033.se
838465031 gbpln1034.se
950517848 gbpln1035.se
1082441571 gbpln1036.se
789583362 gbpln1037.se
950035126 gbpln1038.se
853507174 gbpln1039.se
320571253 gbpln104.seq
659807143 gbpln1040.se
902654822 gbpln1041.se
890952840 gbpln1042.se
721824595 gbpln1043.se
785634143 gbpln1044.se
909002041 gbpln1045.se
625532226 gbpln1046.se
945667285 gbpln1047.se
953425673 gbpln1048.se
821771932 gbpln1049.se
286199717 gbpln105.seq
49706481 gbpln1050.se
685151081 gbpln1051.se
568933209 gbpln1052.se
539200808 gbpln1053.se
586715519 gbpln1054.se
614750081 gbpln1055.se
568071416 gbpln1056.se
625152560 gbpln1057.se
586214274 gbpln1058.se
746226478 gbpln1059.se
277716232 gbpln106.seq
808684470 gbpln1060.se
907082919 gbpln1061.se
776688265 gbpln1062.se
793241327 gbpln1063.se
698857036 gbpln1064.se
613368022 gbpln1065.se
674019106 gbpln1066.se
609236735 gbpln1067.se
576791005 gbpln1068.se
632369216 gbpln1069.se
499733064 gbpln107.seq
377507569 gbpln1070.se
669127828 gbpln1071.se
466230967 gbpln1072.se
475319448 gbpln1073.se
488174615 gbpln1074.se
318504234 gbpln1075.se
198080534 gbpln1076.se
752395252 gbpln1077.se
890282442 gbpln1078.se
626588938 gbpln1079.se
79413547 gbpln108.seq
1004358314 gbpln1080.se
1028945403 gbpln1081.se
838465031 gbpln1082.se
950517848 gbpln1083.se
1082441571 gbpln1084.se
789583362 gbpln1085.se
950035126 gbpln1086.se
853507174 gbpln1087.se
659807143 gbpln1088.se
902654822 gbpln1089.se
391026516 gbpln109.seq
890952840 gbpln1090.se
721824595 gbpln1091.se
785634143 gbpln1092.se
909002041 gbpln1093.se
625532226 gbpln1094.se
945667285 gbpln1095.se
953425673 gbpln1096.se
821771932 gbpln1097.se
459041667 gbpln1098.se
304571885 gbpln1099.se
499921593 gbpln11.seq
362500947 gbpln110.seq
571276484 gbpln1100.se
841140963 gbpln1101.se
813242081 gbpln1102.se
666749684 gbpln1103.se
786164670 gbpln1104.se
685610369 gbpln1105.se
780661607 gbpln1106.se
20764769 gbpln1107.se
494104735 gbpln1108.se
487719162 gbpln1109.se
390024685 gbpln111.seq
475203143 gbpln1110.se
481053138 gbpln1111.se
491971790 gbpln1112.se
174964113 gbpln1113.se
489989534 gbpln1114.se
498671512 gbpln1115.se
498654651 gbpln1116.se
472130628 gbpln1117.se
484783481 gbpln1118.se
174534000 gbpln1119.se
341773035 gbpln112.seq
458581762 gbpln1120.se
487249767 gbpln1121.se
488104602 gbpln1122.se
490993470 gbpln1123.se
458758162 gbpln1124.se
243752045 gbpln1125.se
496284751 gbpln1126.se
470894249 gbpln1127.se
456702113 gbpln1128.se
468851576 gbpln1129.se
199854531 gbpln113.seq
498668450 gbpln1130.se
246543998 gbpln1131.se
403648092 gbpln1132.se
420333785 gbpln1133.se
486138903 gbpln1134.se
461617634 gbpln1135.se
214014145 gbpln1136.se
461722879 gbpln1137.se
470401116 gbpln1138.se
494676807 gbpln1139.se
483137958 gbpln114.seq
492353397 gbpln1140.se
492252090 gbpln1141.se
345527633 gbpln1142.se
463862211 gbpln1143.se
494081914 gbpln1144.se
498159633 gbpln1145.se
430115650 gbpln1146.se
489276790 gbpln1147.se
408967072 gbpln1148.se
100679825 gbpln1149.se
493810296 gbpln115.seq
437115790 gbpln1150.se
441097064 gbpln1151.se
442410423 gbpln1152.se
451274488 gbpln1153.se
251536188 gbpln1154.se
422420084 gbpln1155.se
498624032 gbpln1156.se
493874495 gbpln1157.se
461365034 gbpln1158.se
368984003 gbpln1159.se
497201313 gbpln116.seq
327296104 gbpln1160.se
393553638 gbpln1161.se
494499660 gbpln1162.se
339690898 gbpln1163.se
442962794 gbpln1164.se
443202510 gbpln1165.se
473793657 gbpln1166.se
487062259 gbpln1167.se
402248903 gbpln1168.se
441515110 gbpln1169.se
262329677 gbpln117.seq
497650728 gbpln1170.se
425883871 gbpln1171.se
363732401 gbpln1172.se
454836169 gbpln1173.se
473634452 gbpln1174.se
202150508 gbpln1175.se
470919442 gbpln1176.se
485212352 gbpln1177.se
473559497 gbpln1178.se
436659501 gbpln1179.se
410692589 gbpln118.seq
334662145 gbpln1180.se
1096228946 gbpln1181.se
1065747702 gbpln1182.se
978382754 gbpln1183.se
970377846 gbpln1184.se
932157798 gbpln1185.se
878151181 gbpln1186.se
874085482 gbpln1187.se
829265283 gbpln1188.se
863296713 gbpln1189.se
485439355 gbpln119.seq
823515697 gbpln1190.se
815413879 gbpln1191.se
693494316 gbpln1192.se
690790562 gbpln1193.se
669344399 gbpln1194.se
682118426 gbpln1195.se
617460029 gbpln1196.se
613278884 gbpln1197.se
540591172 gbpln1198.se
1122504 gbpln1199.se
498718656 gbpln12.seq
339967820 gbpln120.seq
2012725365 gbpln1200.se
2313576157 gbpln1201.se
2199353951 gbpln1202.se
2096617949 gbpln1203.se
2106642321 gbpln1204.se
1745413840 gbpln1205.se
1943630374 gbpln1206.se
482844875 gbpln1207.se
172025956 gbpln1208.se
477983665 gbpln1209.se
410604091 gbpln121.seq
479133534 gbpln1210.se
489619458 gbpln1211.se
483060400 gbpln1212.se
446936322 gbpln1213.se
207970098 gbpln1214.se
460655312 gbpln1215.se
364708423 gbpln1216.se
339216276 gbpln1217.se
386345512 gbpln1218.se
311846069 gbpln1219.se
459875355 gbpln122.seq
213922978 gbpln1220.se
547084404 gbpln1221.se
299808 gbpln1222.se
575997766 gbpln1223.se
565057145 gbpln1224.se
546636235 gbpln1225.se
480735429 gbpln1226.se
428611956 gbpln1227.se
399987344 gbpln1228.se
452012654 gbpln1229.se
499126764 gbpln123.seq
407833644 gbpln1230.se
98616602 gbpln1231.se
487406408 gbpln1232.se
497106695 gbpln1233.se
448383755 gbpln1234.se
303860709 gbpln1235.se
79771756 gbpln1236.se
610632167 gbpln1237.se
761027417 gbpln1238.se
474894144 gbpln1239.se
182005254 gbpln124.seq
820639220 gbpln1240.se
834487583 gbpln1241.se
646503636 gbpln1242.se
791663935 gbpln1243.se
942730875 gbpln1244.se
611720944 gbpln1245.se
801353716 gbpln1246.se
755984392 gbpln1247.se
515950587 gbpln1248.se
730612021 gbpln1249.se
498973295 gbpln125.seq
754956047 gbpln1250.se
552345645 gbpln1251.se
632515095 gbpln1252.se
756169196 gbpln1253.se
470848206 gbpln1254.se
774219381 gbpln1255.se
818888469 gbpln1256.se
623527102 gbpln1257.se
498525119 gbpln1258.se
482321806 gbpln1259.se
472540038 gbpln126.seq
457141996 gbpln1260.se
469346005 gbpln1261.se
323635207 gbpln1262.se
498969871 gbpln1263.se
499320075 gbpln1264.se
491583750 gbpln1265.se
487185903 gbpln1266.se
182220271 gbpln1267.se
377272807 gbpln1268.se
626278050 gbpln1269.se
453105795 gbpln127.seq
818534977 gbpln1270.se
744338029 gbpln1271.se
840481828 gbpln1272.se
794009713 gbpln1273.se
688256286 gbpln1274.se
841577973 gbpln1275.se
456582573 gbpln1276.se
439418037 gbpln1277.se
495349376 gbpln1278.se
420755197 gbpln1279.se
445429529 gbpln128.seq
79867313 gbpln1280.se
477385948 gbpln1281.se
471883612 gbpln1282.se
478940659 gbpln1283.se
333989198 gbpln1284.se
253005912 gbpln1285.se
436323528 gbpln1286.se
474062172 gbpln1287.se
483649355 gbpln1288.se
403534786 gbpln1289.se
387853287 gbpln129.seq
498884017 gbpln1290.se
201620526 gbpln1291.se
492206431 gbpln1292.se
431247284 gbpln1293.se
485331477 gbpln1294.se
499128952 gbpln1295.se
446943656 gbpln1296.se
445678707 gbpln1297.se
492931817 gbpln1298.se
488728965 gbpln1299.se
469955827 gbpln13.seq
496158186 gbpln130.seq
442513917 gbpln1300.se
489986240 gbpln1301.se
485052602 gbpln1302.se
402707116 gbpln1303.se
484676594 gbpln1304.se
457870134 gbpln1305.se
485317363 gbpln1306.se
412333094 gbpln1307.se
414213485 gbpln1308.se
392278204 gbpln1309.se
499810789 gbpln131.seq
252441040 gbpln1310.se
483659967 gbpln1311.se
467301410 gbpln1312.se
405580660 gbpln1313.se
457115946 gbpln1314.se
70190485 gbpln1315.se
484439011 gbpln1316.se
462114796 gbpln1317.se
463366807 gbpln1318.se
320374741 gbpln1319.se
498685873 gbpln132.seq
395846795 gbpln1320.se
378719650 gbpln1321.se
367281367 gbpln1322.se
338474475 gbpln1323.se
318607005 gbpln1324.se
311653033 gbpln1325.se
283823331 gbpln1326.se
499365134 gbpln1327.se
472679926 gbpln1328.se
111646958 gbpln1329.se
312787398 gbpln133.seq
475053211 gbpln1330.se
410147052 gbpln1331.se
437551134 gbpln1332.se
453268537 gbpln1333.se
377240170 gbpln1334.se
2734223096 gbpln1335.se
2727931901 gbpln1336.se
2720692598 gbpln1337.se
2732441076 gbpln1338.se
2733260927 gbpln1339.se
489314534 gbpln134.seq
157556535 gbpln1340.se
2694271430 gbpln1341.se
2735442486 gbpln1342.se
2720859722 gbpln1343.se
2732011308 gbpln1344.se
2383529845 gbpln1345.se
2723191931 gbpln1346.se
2689474086 gbpln1347.se
2737751830 gbpln1348.se
2700210160 gbpln1349.se
486163971 gbpln135.seq
2006289519 gbpln1350.se
2636141786 gbpln1351.se
2722875815 gbpln1352.se
2725415454 gbpln1353.se
2730393002 gbpln1354.se
1948886785 gbpln1355.se
2738131093 gbpln1356.se
2727379378 gbpln1357.se
2679871098 gbpln1358.se
2737685310 gbpln1359.se
495247726 gbpln136.seq
786720890 gbpln1360.se
2727907345 gbpln1361.se
2657432129 gbpln1362.se
2735229991 gbpln1363.se
2728645371 gbpln1364.se
218791011 gbpln1365.se
2719617838 gbpln1366.se
2721885171 gbpln1367.se
2721092581 gbpln1368.se
2679558604 gbpln1369.se
466229178 gbpln137.seq
181580803 gbpln1370.se
2722179116 gbpln1371.se
2736369220 gbpln1372.se
2726783046 gbpln1373.se
2440060122 gbpln1374.se
2736724965 gbpln1375.se
2696541624 gbpln1376.se
422496617 gbpln1377.se
2731302183 gbpln1378.se
2702984894 gbpln1379.se
493826666 gbpln138.seq
2732485324 gbpln1380.se
1906858977 gbpln1381.se
1292626852 gbpln1382.se
407499681 gbpln1383.se
471674647 gbpln1384.se
391389041 gbpln1385.se
469279688 gbpln1386.se
498555516 gbpln1387.se
406257878 gbpln1388.se
575645529 gbpln1389.se
495604408 gbpln139.seq
734445378 gbpln1390.se
697159202 gbpln1391.se
621889642 gbpln1392.se
656718843 gbpln1393.se
558783862 gbpln1394.se
699089816 gbpln1395.se
574123634 gbpln1396.se
721607985 gbpln1397.se
718233528 gbpln1398.se
628979866 gbpln1399.se
170594869 gbpln14.seq
494888128 gbpln140.seq
662283407 gbpln1400.se
559564406 gbpln1401.se
726501832 gbpln1402.se
175851 gbpln1403.se
558553896 gbpln1404.se
736054186 gbpln1405.se
682550439 gbpln1406.se
616280683 gbpln1407.se
628026548 gbpln1408.se
551354059 gbpln1409.se
496855421 gbpln141.seq
677933274 gbpln1410.se
549876381 gbpln1411.se
689339626 gbpln1412.se
658635449 gbpln1413.se
604420911 gbpln1414.se
622625000 gbpln1415.se
544618917 gbpln1416.se
696594014 gbpln1417.se
174779 gbpln1418.se
568398582 gbpln1419.se
494352368 gbpln142.seq
752800823 gbpln1420.se
698346119 gbpln1421.se
608730243 gbpln1422.se
652235208 gbpln1423.se
542363484 gbpln1424.se
702360856 gbpln1425.se
565600613 gbpln1426.se
754304818 gbpln1427.se
711293759 gbpln1428.se
605904859 gbpln1429.se
32707512 gbpln143.seq
666855938 gbpln1430.se
544952160 gbpln1431.se
703427667 gbpln1432.se
174749 gbpln1433.se
566716389 gbpln1434.se
718786058 gbpln1435.se
711087366 gbpln1436.se
642562848 gbpln1437.se
647633318 gbpln1438.se
553626911 gbpln1439.se
468986126 gbpln144.seq
565229115 gbpln1440.se
549156577 gbpln1441.se
736859608 gbpln1442.se
691433519 gbpln1443.se
617624847 gbpln1444.se
636966542 gbpln1445.se
552239528 gbpln1446.se
556957719 gbpln1447.se
174818 gbpln1448.se
564066555 gbpln1449.se
474996855 gbpln145.seq
691947282 gbpln1450.se
624453167 gbpln1451.se
568801669 gbpln1452.se
623008870 gbpln1453.se
524788928 gbpln1454.se
645004954 gbpln1455.se
540958899 gbpln1456.se
655828783 gbpln1457.se
520795030 gbpln1458.se
586540920 gbpln1459.se
477161896 gbpln146.seq
597946208 gbpln1460.se
512499450 gbpln1461.se
665998603 gbpln1462.se
549985709 gbpln1463.se
705073397 gbpln1464.se
569802481 gbpln1465.se
551263895 gbpln1466.se
617715492 gbpln1467.se
533030891 gbpln1468.se
642027672 gbpln1469.se
340348392 gbpln147.seq
537224178 gbpln1470.se
670508728 gbpln1471.se
649315773 gbpln1472.se
588952556 gbpln1473.se
605547434 gbpln1474.se
513253175 gbpln1475.se
637456772 gbpln1476.se
174881 gbpln1477.se
548524272 gbpln1478.se
711748457 gbpln1479.se
484550390 gbpln148.seq
688643289 gbpln1480.se
589153230 gbpln1481.se
607494571 gbpln1482.se
469515369 gbpln1483.se
596414735 gbpln1484.se
563516669 gbpln1485.se
696200282 gbpln1486.se
602471952 gbpln1487.se
479557185 gbpln1488.se
613324917 gbpln1489.se
490914318 gbpln149.seq
542743607 gbpln1490.se
577693408 gbpln1491.se
515295514 gbpln1492.se
698832234 gbpln1493.se
595216266 gbpln1494.se
522577566 gbpln1495.se
554145572 gbpln1496.se
465690537 gbpln1497.se
637185354 gbpln1498.se
518213118 gbpln1499.se
496172925 gbpln15.seq
481177815 gbpln150.seq
700947969 gbpln1500.se
667672842 gbpln1501.se
557142977 gbpln1502.se
587023274 gbpln1503.se
522955911 gbpln1504.se
549261646 gbpln1505.se
174960 gbpln1506.se
555727736 gbpln1507.se
707369547 gbpln1508.se
665776881 gbpln1509.se
496102157 gbpln151.seq
632220444 gbpln1510.se
603354746 gbpln1511.se
512704100 gbpln1512.se
209276730 gbpln1513.se
542361412 gbpln1514.se
673868938 gbpln1515.se
669299626 gbpln1516.se
594324003 gbpln1517.se
633286407 gbpln1518.se
540739103 gbpln1519.se
423059914 gbpln152.seq
656466500 gbpln1520.se
573168484 gbpln1521.se
664511655 gbpln1522.se
699170489 gbpln1523.se
613488890 gbpln1524.se
604892488 gbpln1525.se
530136173 gbpln1526.se
321128187 gbpln1527.se
549702443 gbpln1528.se
691732891 gbpln1529.se
497478474 gbpln153.seq
690639525 gbpln1530.se
592908220 gbpln1531.se
583827820 gbpln1532.se
505911951 gbpln1533.se
187370785 gbpln1534.se
531607726 gbpln1535.se
670735982 gbpln1536.se
639701218 gbpln1537.se
625168916 gbpln1538.se
608581292 gbpln1539.se
435183975 gbpln154.seq
409196174 gbpln1540.se
650768736 gbpln1541.se
553023979 gbpln1542.se
701464510 gbpln1543.se
681749344 gbpln1544.se
628995544 gbpln1545.se
631664938 gbpln1546.se
532240293 gbpln1547.se
701394148 gbpln1548.se
563260621 gbpln1549.se
460820205 gbpln155.seq
694363863 gbpln1550.se
602187920 gbpln1551.se
534603645 gbpln1552.se
623960566 gbpln1553.se
400123881 gbpln1554.se
659795356 gbpln1555.se
548217914 gbpln1556.se
710835335 gbpln1557.se
630332153 gbpln1558.se
576299747 gbpln1559.se
485737542 gbpln156.seq
601997530 gbpln1560.se
504851755 gbpln1561.se
628751564 gbpln1562.se
175090 gbpln1563.se
564528827 gbpln1564.se
618979127 gbpln1565.se
635231824 gbpln1566.se
529924441 gbpln1567.se
621986808 gbpln1568.se
523379327 gbpln1569.se
498612562 gbpln157.seq
594649456 gbpln1570.se
519615124 gbpln1571.se
616668781 gbpln1572.se
675038822 gbpln1573.se
595433203 gbpln1574.se
605474869 gbpln1575.se
500671219 gbpln1576.se
684971873 gbpln1577.se
552386546 gbpln1578.se
716306444 gbpln1579.se
485304962 gbpln158.seq
672179655 gbpln1580.se
600740349 gbpln1581.se
620624199 gbpln1582.se
482434358 gbpln1583.se
619293983 gbpln1584.se
503654450 gbpln1585.se
687554133 gbpln1586.se
692658095 gbpln1587.se
519573430 gbpln1588.se
609582586 gbpln1589.se
499875093 gbpln159.seq
522424837 gbpln1590.se
637977863 gbpln1591.se
174958 gbpln1592.se
814010732 gbpln1593.se
1048521841 gbpln1594.se
1038155649 gbpln1595.se
833369914 gbpln1596.se
931292853 gbpln1597.se
811379776 gbpln1598.se
1004411700 gbpln1599.se
478637900 gbpln16.seq
473509905 gbpln160.seq
73580987 gbpln1600.se
812614241 gbpln1601.se
1052276437 gbpln1602.se
1035793500 gbpln1603.se
832863065 gbpln1604.se
922247149 gbpln1605.se
807661511 gbpln1606.se
1004047797 gbpln1607.se
62119261 gbpln1608.se
537475227 gbpln1609.se
336937021 gbpln161.seq
460223025 gbpln1610.se
693641164 gbpln1611.se
580029100 gbpln1612.se
597416510 gbpln1613.se
505105364 gbpln1614.se
657955597 gbpln1615.se
551663040 gbpln1616.se
470220012 gbpln1617.se
640870217 gbpln1618.se
550372651 gbpln1619.se
481782456 gbpln162.seq
609801478 gbpln1620.se
526021655 gbpln1621.se
679622534 gbpln1622.se
554031927 gbpln1623.se
683042768 gbpln1624.se
659526432 gbpln1625.se
583157115 gbpln1626.se
580366358 gbpln1627.se
500443859 gbpln1628.se
672372455 gbpln1629.se
432553122 gbpln163.seq
554076188 gbpln1630.se
701020945 gbpln1631.se
648496395 gbpln1632.se
568395035 gbpln1633.se
607372526 gbpln1634.se
532052842 gbpln1635.se
684166413 gbpln1636.se
494361317 gbpln1637.se
488905431 gbpln1638.se
443593696 gbpln1639.se
462278275 gbpln164.seq
447037980 gbpln1640.se
486295927 gbpln1641.se
494988497 gbpln1642.se
445384194 gbpln1643.se
486655806 gbpln1644.se
436113233 gbpln1645.se
468059670 gbpln1646.se
376082255 gbpln1647.se
338514050 gbpln165.seq
478622058 gbpln166.seq
276524733 gbpln167.seq
445190576 gbpln168.seq
357274162 gbpln169.seq
335223965 gbpln17.seq
375890576 gbpln170.seq
349832882 gbpln171.seq
336189913 gbpln172.seq
463740200 gbpln173.seq
393476964 gbpln174.seq
114312500 gbpln175.seq
430007058 gbpln176.seq
485882010 gbpln177.seq
403795990 gbpln178.seq
451516767 gbpln179.seq
418823303 gbpln18.seq
382592005 gbpln180.seq
457726110 gbpln181.seq
493420618 gbpln182.seq
497715243 gbpln183.seq
494847899 gbpln184.seq
147147531 gbpln185.seq
490697083 gbpln186.seq
492045809 gbpln187.seq
495010987 gbpln188.seq
375787291 gbpln189.seq
496016838 gbpln19.seq
459748362 gbpln190.seq
221425534 gbpln191.seq
389473095 gbpln192.seq
304823814 gbpln193.seq
301383681 gbpln194.seq
318452230 gbpln195.seq
281218213 gbpln196.seq
447505205 gbpln197.seq
228460638 gbpln198.seq
497423162 gbpln199.seq
499956808 gbpln2.seq
243286344 gbpln20.seq
497849933 gbpln200.seq
339283519 gbpln201.seq
352772052 gbpln202.seq
185131817 gbpln203.seq
369359776 gbpln204.seq
360003680 gbpln205.seq
481797464 gbpln206.seq
185334309 gbpln207.seq
332596046 gbpln208.seq
352285419 gbpln209.seq
462332174 gbpln21.seq
316491733 gbpln210.seq
356545945 gbpln211.seq
237684058 gbpln212.seq
344675277 gbpln213.seq
325130194 gbpln214.seq
319807389 gbpln215.seq
320591842 gbpln216.seq
370343519 gbpln217.seq
226022854 gbpln218.seq
487885129 gbpln219.seq
458606826 gbpln22.seq
488700928 gbpln220.seq
361041710 gbpln221.seq
413234155 gbpln222.seq
425115149 gbpln223.seq
425560692 gbpln224.seq
753151986 gbpln225.seq
744282264 gbpln226.seq
743804521 gbpln227.seq
739735479 gbpln228.seq
667988546 gbpln229.seq
465601747 gbpln23.seq
650329544 gbpln230.seq
574703572 gbpln231.seq
490264012 gbpln232.seq
430773005 gbpln233.seq
494631260 gbpln234.seq
434517734 gbpln235.seq
494162266 gbpln236.seq
495838535 gbpln237.seq
377365193 gbpln238.seq
460983181 gbpln239.seq
494528875 gbpln24.seq
455183610 gbpln240.seq
477269031 gbpln241.seq
476577420 gbpln242.seq
483904219 gbpln243.seq
495017956 gbpln244.seq
460145370 gbpln245.seq
499758825 gbpln246.seq
480460294 gbpln247.seq
357789591 gbpln248.seq
495236186 gbpln249.seq
426926678 gbpln25.seq
338584917 gbpln250.seq
445491347 gbpln251.seq
499907826 gbpln252.seq
169709069 gbpln253.seq
484246438 gbpln254.seq
457709024 gbpln255.seq
449004169 gbpln256.seq
453106454 gbpln257.seq
138964454 gbpln258.seq
496547370 gbpln259.seq
224879017 gbpln26.seq
486983540 gbpln260.seq
427641884 gbpln261.seq
626279429 gbpln262.seq
818536598 gbpln263.seq
744339771 gbpln264.seq
840483636 gbpln265.seq
794011180 gbpln266.seq
688257643 gbpln267.seq
841579594 gbpln268.seq
128636798 gbpln269.seq
369920299 gbpln27.seq
86418 gbpln270.seq
361751 gbpln271.seq
164981107 gbpln272.seq
40089516 gbpln273.seq
74918158 gbpln274.seq
499995494 gbpln275.seq
358013152 gbpln276.seq
499997737 gbpln277.seq
499999023 gbpln278.seq
143993650 gbpln279.seq
320631792 gbpln28.seq
499998955 gbpln280.seq
499597075 gbpln281.seq
499958607 gbpln282.seq
291023025 gbpln283.seq
298759180 gbpln284.seq
211414125 gbpln285.seq
248588329 gbpln286.seq
185673034 gbpln287.seq
997331398 gbpln288.seq
56517389 gbpln289.seq
318185493 gbpln29.seq
487357652 gbpln290.seq
473525596 gbpln291.seq
473209473 gbpln292.seq
467870653 gbpln293.seq
168324953 gbpln294.seq
442170645 gbpln295.seq
460425795 gbpln296.seq
479222672 gbpln297.seq
92564056 gbpln298.seq
609356119 gbpln299.seq
499820641 gbpln3.seq
320810750 gbpln30.seq
786074578 gbpln300.seq
733167229 gbpln301.seq
736239733 gbpln302.seq
691575746 gbpln303.seq
660133963 gbpln304.seq
739031764 gbpln305.seq
457972634 gbpln306.seq
425775604 gbpln307.seq
500000120 gbpln308.seq
66362344 gbpln309.seq
339200181 gbpln31.seq
499999834 gbpln310.seq
499999839 gbpln311.seq
272120982 gbpln312.seq
499998299 gbpln313.seq
499999009 gbpln314.seq
93870398 gbpln315.seq
499997737 gbpln316.seq
484603166 gbpln317.seq
499997591 gbpln318.seq
421252361 gbpln319.seq
222826757 gbpln32.seq
499996686 gbpln320.seq
389630785 gbpln321.seq
499998089 gbpln322.seq
499998405 gbpln323.seq
499998514 gbpln324.seq
72162415 gbpln325.seq
499998379 gbpln326.seq
499878134 gbpln327.seq
423266431 gbpln328.seq
499998698 gbpln329.seq
336947956 gbpln33.seq
499782879 gbpln330.seq
492483682 gbpln331.seq
499999971 gbpln332.seq
42361061 gbpln333.seq
499831932 gbpln334.seq
491589584 gbpln335.seq
402785639 gbpln336.seq
445924319 gbpln337.seq
499811168 gbpln338.seq
5650012 gbpln339.seq
309835203 gbpln34.seq
492255024 gbpln340.seq
226945063 gbpln341.seq
315805316 gbpln342.seq
665291577 gbpln343.seq
860028189 gbpln344.seq
800605872 gbpln345.seq
794469115 gbpln346.seq
762933697 gbpln347.seq
729969959 gbpln348.seq
808217924 gbpln349.seq
351268105 gbpln35.seq
209360455 gbpln350.seq
924325157 gbpln351.seq
1201978654 gbpln352.seq
1227268207 gbpln353.seq
1152253241 gbpln354.seq
1115248374 gbpln355.seq
1125506105 gbpln356.seq
1145303472 gbpln357.seq
695608615 gbpln358.seq
494750655 gbpln359.seq
495270369 gbpln36.seq
460644363 gbpln360.seq
152680390 gbpln361.seq
462987281 gbpln362.seq
480457520 gbpln363.seq
494737040 gbpln364.seq
446441302 gbpln365.seq
117077133 gbpln366.seq
485280656 gbpln367.seq
153318246 gbpln368.seq
689933987 gbpln369.seq
184338495 gbpln37.seq
887561680 gbpln370.seq
834970472 gbpln371.seq
826391913 gbpln372.seq
792513917 gbpln373.seq
743209872 gbpln374.seq
833073712 gbpln375.seq
562407 gbpln376.seq
665291577 gbpln377.seq
860028189 gbpln378.seq
800605872 gbpln379.seq
346111462 gbpln38.seq
794469115 gbpln380.seq
762933697 gbpln381.seq
729969959 gbpln382.seq
808217924 gbpln383.seq
189172308 gbpln384.seq
663098252 gbpln385.seq
855592604 gbpln386.seq
807031053 gbpln387.seq
793905039 gbpln388.seq
773303164 gbpln389.seq
384904972 gbpln39.seq
718153248 gbpln390.seq
804870210 gbpln391.seq
661762125 gbpln392.seq
840180304 gbpln393.seq
796430245 gbpln394.seq
779180715 gbpln395.seq
761224530 gbpln396.seq
725380245 gbpln397.seq
792983451 gbpln398.seq
652402241 gbpln399.seq
499897802 gbpln4.seq
205693142 gbpln40.seq
831209396 gbpln400.seq
783682955 gbpln401.seq
775938782 gbpln402.seq
741958804 gbpln403.seq
700440901 gbpln404.seq
788705159 gbpln405.seq
683172483 gbpln406.seq
872662143 gbpln407.seq
815663229 gbpln408.seq
813528167 gbpln409.seq
85942873 gbpln41.seq
780491844 gbpln410.seq
734904793 gbpln411.seq
816941948 gbpln412.seq
635039454 gbpln413.seq
824184474 gbpln414.seq
768070182 gbpln415.seq
758956882 gbpln416.seq
732189331 gbpln417.seq
706311232 gbpln418.seq
766293442 gbpln419.seq
477916829 gbpln42.seq
651415133 gbpln420.seq
830082304 gbpln421.seq
783385752 gbpln422.seq
770520351 gbpln423.seq
753421970 gbpln424.seq
699441547 gbpln425.seq
784443196 gbpln426.seq
4698 gbpln427.seq
702337808 gbpln428.seq
906907390 gbpln429.seq
499904224 gbpln43.seq
844110716 gbpln430.seq
841780855 gbpln431.seq
805270043 gbpln432.seq
764396863 gbpln433.seq
841492595 gbpln434.seq
714482811 gbpln435.seq
916127997 gbpln436.seq
858459407 gbpln437.seq
848936990 gbpln438.seq
813129213 gbpln439.seq
498817817 gbpln44.seq
765593150 gbpln440.seq
862731158 gbpln441.seq
665885634 gbpln442.seq
854365265 gbpln443.seq
802776346 gbpln444.seq
793295912 gbpln445.seq
769246240 gbpln446.seq
710912919 gbpln447.seq
799876815 gbpln448.seq
629668050 gbpln449.seq
323729344 gbpln45.seq
814320946 gbpln450.seq
759349720 gbpln451.seq
762512207 gbpln452.seq
724647884 gbpln453.seq
679679449 gbpln454.seq
784312844 gbpln455.seq
684180819 gbpln456.seq
873292213 gbpln457.seq
827422505 gbpln458.seq
815925825 gbpln459.seq
499081471 gbpln46.seq
779009585 gbpln460.seq
739747654 gbpln461.seq
834950434 gbpln462.seq
663096073 gbpln463.seq
849628701 gbpln464.seq
803882830 gbpln465.seq
794420470 gbpln466.seq
760127459 gbpln467.seq
714663802 gbpln468.seq
801095950 gbpln469.seq
497391852 gbpln47.seq
668869887 gbpln470.seq
854770002 gbpln471.seq
805931576 gbpln472.seq
798923954 gbpln473.seq
766411223 gbpln474.seq
723133936 gbpln475.seq
803351408 gbpln476.seq
664176987 gbpln477.seq
854339916 gbpln478.seq
803900400 gbpln479.seq
499428080 gbpln48.seq
791449620 gbpln480.seq
761145205 gbpln481.seq
715062603 gbpln482.seq
806379176 gbpln483.seq
668964953 gbpln484.seq
870939392 gbpln485.seq
809408813 gbpln486.seq
801514137 gbpln487.seq
768794024 gbpln488.seq
723644689 gbpln489.seq
103294636 gbpln49.seq
815153418 gbpln490.seq
661177159 gbpln491.seq
846934671 gbpln492.seq
794708793 gbpln493.seq
789781753 gbpln494.seq
764576068 gbpln495.seq
711115451 gbpln496.seq
797517245 gbpln497.seq
691953899 gbpln498.seq
888406351 gbpln499.seq
480119598 gbpln5.seq
496566630 gbpln50.seq
835271741 gbpln500.seq
823533989 gbpln501.seq
787819193 gbpln502.seq
748786657 gbpln503.seq
838184652 gbpln504.seq
488802687 gbpln505.seq
439661491 gbpln506.seq
155752105 gbpln507.seq
758806100 gbpln508.seq
898446949 gbpln509.seq
478891333 gbpln51.seq
628489896 gbpln510.seq
1024113089 gbpln511.seq
1032878661 gbpln512.seq
858694781 gbpln513.seq
960391204 gbpln514.seq
1090094606 gbpln515.seq
781959143 gbpln516.seq
946995961 gbpln517.seq
857542781 gbpln518.seq
656405285 gbpln519.seq
383840485 gbpln52.seq
907889097 gbpln520.seq
896386890 gbpln521.seq
726432335 gbpln522.seq
798296822 gbpln523.seq
918393750 gbpln524.seq
584961784 gbpln525.seq
948865971 gbpln526.seq
954536271 gbpln527.seq
819735731 gbpln528.seq
756588093 gbpln529.seq
454048451 gbpln53.seq
876067119 gbpln530.seq
625446321 gbpln531.seq
977801494 gbpln532.seq
854357980 gbpln533.seq
807732556 gbpln534.seq
947696453 gbpln535.seq
1067629605 gbpln536.seq
822222048 gbpln537.seq
950272996 gbpln538.seq
845138843 gbpln539.seq
495221947 gbpln54.seq
643846993 gbpln540.seq
894745096 gbpln541.seq
893352134 gbpln542.seq
722578984 gbpln543.seq
776227316 gbpln544.seq
899750467 gbpln545.seq
592059964 gbpln546.seq
933986451 gbpln547.seq
939527664 gbpln548.seq
810117922 gbpln549.seq
486126470 gbpln55.seq
765938558 gbpln550.seq
886537018 gbpln551.seq
623519964 gbpln552.seq
996940649 gbpln553.seq
1030190034 gbpln554.seq
832828033 gbpln555.seq
956342979 gbpln556.seq
1134286144 gbpln557.seq
790513299 gbpln558.seq
944161893 gbpln559.seq
498663354 gbpln56.seq
860035788 gbpln560.seq
647268685 gbpln561.seq
902239623 gbpln562.seq
611029440 gbpln563.seq
734907577 gbpln564.seq
787834228 gbpln565.seq
910724363 gbpln566.seq
606016896 gbpln567.seq
961485234 gbpln568.seq
1242775191 gbpln569.seq
471931520 gbpln57.seq
816670128 gbpln570.seq
636658925 gbpln571.seq
818591771 gbpln572.seq
766580884 gbpln573.seq
752100829 gbpln574.seq
724519993 gbpln575.seq
690955648 gbpln576.seq
769738288 gbpln577.seq
750738544 gbpln578.seq
872184389 gbpln579.seq
497321530 gbpln58.seq
624480879 gbpln580.seq
995069022 gbpln581.seq
1012956234 gbpln582.seq
827074347 gbpln583.seq
940621783 gbpln584.seq
1079418810 gbpln585.seq
776922106 gbpln586.seq
938380968 gbpln587.seq
848757671 gbpln588.seq
643572913 gbpln589.seq
472649872 gbpln59.seq
891714442 gbpln590.seq
878638403 gbpln591.seq
721632671 gbpln592.seq
779156122 gbpln593.seq
895553446 gbpln594.seq
604678568 gbpln595.seq
931006295 gbpln596.seq
933660027 gbpln597.seq
810459540 gbpln598.seq
761872100 gbpln599.seq
499999658 gbpln6.seq
478648821 gbpln60.seq
878702815 gbpln600.seq
627081460 gbpln601.seq
994320235 gbpln602.seq
999434327 gbpln603.seq
823789349 gbpln604.seq
945629782 gbpln605.seq
1062113821 gbpln606.seq
792298939 gbpln607.seq
941851700 gbpln608.seq
850142413 gbpln609.seq
83738365 gbpln61.seq
656955691 gbpln610.seq
904094753 gbpln611.seq
900193903 gbpln612.seq
728906821 gbpln613.seq
741172650 gbpln614.seq
898719079 gbpln615.seq
599002526 gbpln616.seq
937117048 gbpln617.seq
936021119 gbpln618.seq
812696702 gbpln619.seq
494333293 gbpln62.seq
746628212 gbpln620.seq
897168807 gbpln621.seq
626698501 gbpln622.seq
1007072101 gbpln623.seq
1000831797 gbpln624.seq
841918855 gbpln625.seq
963426816 gbpln626.seq
1093654114 gbpln627.seq
791118382 gbpln628.seq
959940756 gbpln629.seq
475215142 gbpln63.seq
853263842 gbpln630.seq
648051398 gbpln631.seq
901282075 gbpln632.seq
923491092 gbpln633.seq
732477869 gbpln634.seq
789987733 gbpln635.seq
926022053 gbpln636.seq
610840579 gbpln637.seq
949759032 gbpln638.seq
955444559 gbpln639.seq
468208544 gbpln64.seq
818480442 gbpln640.seq
752251380 gbpln641.seq
897893149 gbpln642.seq
631111272 gbpln643.seq
1022032953 gbpln644.seq
1006306956 gbpln645.seq
837035085 gbpln646.seq
966140819 gbpln647.seq
1090560006 gbpln648.seq
800164754 gbpln649.seq
486858437 gbpln65.seq
959884028 gbpln650.seq
886916735 gbpln651.seq
641540050 gbpln652.seq
910168783 gbpln653.seq
908785549 gbpln654.seq
729527181 gbpln655.seq
797552105 gbpln656.seq
910975470 gbpln657.seq
616026199 gbpln658.seq
945685366 gbpln659.seq
272302955 gbpln66.seq
953145956 gbpln660.seq
820081609 gbpln661.seq
763165947 gbpln662.seq
870898266 gbpln663.seq
618200825 gbpln664.seq
1009123187 gbpln665.seq
1016689515 gbpln666.seq
832912303 gbpln667.seq
952656374 gbpln668.seq
1065835283 gbpln669.seq
172902191 gbpln67.seq
776075044 gbpln670.seq
935940025 gbpln671.seq
846831932 gbpln672.seq
641399988 gbpln673.seq
892709705 gbpln674.seq
594848385 gbpln675.seq
720169483 gbpln676.seq
780564861 gbpln677.seq
888344689 gbpln678.seq
610800072 gbpln679.seq
471233536 gbpln68.seq
934713391 gbpln680.seq
1233388213 gbpln681.seq
807523234 gbpln682.seq
19542 gbpln683.seq
757881986 gbpln684.seq
889760627 gbpln685.seq
635890046 gbpln686.seq
1007873898 gbpln687.seq
1015524558 gbpln688.seq
836625022 gbpln689.seq
455042321 gbpln69.seq
959076059 gbpln690.seq
1077416379 gbpln691.seq
789416089 gbpln692.seq
958430056 gbpln693.seq
877922843 gbpln694.seq
648665455 gbpln695.seq
907513209 gbpln696.seq
904978028 gbpln697.seq
727024880 gbpln698.seq
789120540 gbpln699.seq
499932188 gbpln7.seq
488809223 gbpln70.seq
898507915 gbpln700.seq
617229811 gbpln701.seq
942711764 gbpln702.seq
964780021 gbpln703.seq
818917331 gbpln704.seq
755294557 gbpln705.seq
882064051 gbpln706.seq
627203691 gbpln707.seq
993595919 gbpln708.seq
1021497440 gbpln709.seq
355272263 gbpln71.seq
827286497 gbpln710.seq
962451301 gbpln711.seq
1082256067 gbpln712.seq
781463827 gbpln713.seq
919665368 gbpln714.seq
852133929 gbpln715.seq
645388382 gbpln716.seq
905574854 gbpln717.seq
906714977 gbpln718.seq
718743537 gbpln719.seq
200538454 gbpln72.seq
787529633 gbpln720.seq
910251919 gbpln721.seq
608518276 gbpln722.seq
934541265 gbpln723.seq
954054955 gbpln724.seq
806443717 gbpln725.seq
1009766480 gbpln726.seq
1318260463 gbpln727.seq
1253136609 gbpln728.seq
1066198175 gbpln729.seq
377219536 gbpln73.seq
1119572655 gbpln730.seq
1040217505 gbpln731.seq
1310077288 gbpln732.seq
955690374 gbpln733.seq
1230684440 gbpln734.seq
1179787958 gbpln735.seq
1125383520 gbpln736.seq
1051194518 gbpln737.seq
965656648 gbpln738.seq
1110281977 gbpln739.seq
375192640 gbpln74.seq
32675 gbpln740.seq
253174917 gbpln741.seq
654245898 gbpln742.seq
843080362 gbpln743.seq
787261705 gbpln744.seq
773098599 gbpln745.seq
745082094 gbpln746.seq
711612756 gbpln747.seq
801222610 gbpln748.seq
271156 gbpln749.seq
386441749 gbpln75.seq
398651709 gbpln750.seq
315170317 gbpln751.seq
306732013 gbpln752.seq
319872292 gbpln753.seq
286450423 gbpln754.seq
220883441 gbpln755.seq
470283415 gbpln756.seq
475876375 gbpln757.seq
499130261 gbpln758.seq
460644363 gbpln759.seq
475313842 gbpln76.seq
359155255 gbpln760.seq
399402445 gbpln761.seq
501115666 gbpln762.seq
413826113 gbpln763.seq
367000227 gbpln764.seq
238050627 gbpln765.seq
352241749 gbpln766.seq
298781185 gbpln767.seq
490717667 gbpln768.seq
86108252 gbpln769.seq
452882572 gbpln77.seq
9838016 gbpln770.seq
10168205 gbpln771.seq
766528189 gbpln772.seq
422668596 gbpln773.seq
133601452 gbpln774.seq
756143249 gbpln775.seq
878426054 gbpln776.seq
631056251 gbpln777.seq
993852367 gbpln778.seq
1020132695 gbpln779.seq
125944249 gbpln78.seq
830166807 gbpln780.seq
955723315 gbpln781.seq
1057964328 gbpln782.seq
784007552 gbpln783.seq
947940191 gbpln784.seq
857511193 gbpln785.seq
649137171 gbpln786.seq
903393879 gbpln787.seq
908180396 gbpln788.seq
721135945 gbpln789.seq
476593700 gbpln79.seq
786739709 gbpln790.seq
918070756 gbpln791.seq
603192844 gbpln792.seq
938102555 gbpln793.seq
955978436 gbpln794.seq
813787878 gbpln795.seq
639701128 gbpln796.seq
468551880 gbpln797.seq
499475565 gbpln798.seq
498585758 gbpln799.seq
226151307 gbpln8.seq
434249982 gbpln80.seq
20795914 gbpln800.seq
768129678 gbpln801.seq
891209633 gbpln802.seq
1017177961 gbpln803.seq
1036708108 gbpln804.seq
980496603 gbpln805.seq
1096870510 gbpln806.seq
964601805 gbpln807.seq
883690282 gbpln808.seq
879367269 gbpln809.seq
440487400 gbpln81.seq
922136688 gbpln810.seq
805432021 gbpln811.seq
912345991 gbpln812.seq
954500353 gbpln813.seq
944560088 gbpln814.seq
29543025 gbpln815.seq
404677934 gbpln816.seq
500000256 gbpln817.seq
499997989 gbpln818.seq
488915145 gbpln819.seq
444203819 gbpln82.seq
499998025 gbpln820.seq
499922154 gbpln821.seq
499722668 gbpln822.seq
87917686 gbpln823.seq
499999358 gbpln824.seq
499999343 gbpln825.seq
499997951 gbpln826.seq
318787499 gbpln827.seq
499720378 gbpln828.seq
499739594 gbpln829.seq
189178941 gbpln83.seq
499865526 gbpln830.seq
26363499 gbpln831.seq
499742837 gbpln832.seq
499997759 gbpln833.seq
499999043 gbpln834.seq
166375414 gbpln835.seq
499914096 gbpln836.seq
499999324 gbpln837.seq
499760029 gbpln838.seq
499999279 gbpln839.seq
460469415 gbpln84.seq
499747396 gbpln840.seq
93817485 gbpln841.seq
499999643 gbpln842.seq
499755730 gbpln843.seq
499971059 gbpln844.seq
375291175 gbpln845.seq
499944491 gbpln846.seq
499975892 gbpln847.seq
499923735 gbpln848.seq
331469284 gbpln849.seq
440542307 gbpln85.seq
500000119 gbpln850.seq
499997849 gbpln851.seq
499881029 gbpln852.seq
499932515 gbpln853.seq
443856143 gbpln854.seq
453022433 gbpln855.seq
110261817 gbpln856.seq
674055631 gbpln857.seq
865045961 gbpln858.seq
815791689 gbpln859.seq
452992006 gbpln86.seq
802718902 gbpln860.seq
776304595 gbpln861.seq
721531499 gbpln862.seq
809857060 gbpln863.seq
679344023 gbpln864.seq
873797632 gbpln865.seq
820367220 gbpln866.seq
806296382 gbpln867.seq
775209384 gbpln868.seq
744231520 gbpln869.seq
497916786 gbpln87.seq
817156402 gbpln870.seq
771380170 gbpln871.seq
913253142 gbpln872.seq
634934982 gbpln873.seq
1019175188 gbpln874.seq
1023638564 gbpln875.seq
822225605 gbpln876.seq
961290952 gbpln877.seq
1090804562 gbpln878.seq
813694518 gbpln879.seq
437323942 gbpln88.seq
962545328 gbpln880.seq
873725319 gbpln881.seq
673190932 gbpln882.seq
905064826 gbpln883.seq
908590682 gbpln884.seq
742712720 gbpln885.seq
793279946 gbpln886.seq
934932909 gbpln887.seq
640700840 gbpln888.seq
961568346 gbpln889.seq
158619558 gbpln89.seq
952066709 gbpln890.seq
827214105 gbpln891.seq
455119462 gbpln892.seq
225763299 gbpln893.seq
606043562 gbpln894.seq
672463179 gbpln895.seq
670817639 gbpln896.seq
780744112 gbpln897.seq
709786566 gbpln898.seq
699981616 gbpln899.seq
500000209 gbpln9.seq
495372469 gbpln90.seq
605149309 gbpln900.seq
587850601 gbpln901.seq
521338174 gbpln902.seq
584041491 gbpln903.seq
586940642 gbpln904.seq
609718059 gbpln905.seq
520752754 gbpln906.seq
615367059 gbpln907.seq
678802710 gbpln908.seq
605705354 gbpln909.seq
472129613 gbpln91.seq
527901083 gbpln910.seq
594666478 gbpln911.seq
615720930 gbpln912.seq
576353841 gbpln913.seq
633125967 gbpln914.seq
548771038 gbpln915.seq
692441980 gbpln916.seq
738372777 gbpln917.seq
858786663 gbpln918.seq
737516179 gbpln919.seq
477884160 gbpln92.seq
745059844 gbpln920.seq
651602930 gbpln921.seq
604402506 gbpln922.seq
664905906 gbpln923.seq
584308833 gbpln924.seq
534160881 gbpln925.seq
630362065 gbpln926.seq
371796208 gbpln927.seq
630301723 gbpln928.seq
687847932 gbpln929.seq
460004048 gbpln93.seq
613107925 gbpln930.seq
667786022 gbpln931.seq
650171877 gbpln932.seq
580307352 gbpln933.seq
567733852 gbpln934.seq
731990320 gbpln935.seq
671427710 gbpln936.seq
677581065 gbpln937.seq
698173275 gbpln938.seq
745221978 gbpln939.seq
430418757 gbpln94.seq
582651724 gbpln940.seq
703621804 gbpln941.seq
577456793 gbpln942.seq
645348755 gbpln943.seq
738102834 gbpln944.seq
718402114 gbpln945.seq
581705855 gbpln946.seq
731196778 gbpln947.seq
559541977 gbpln948.seq
676833493 gbpln949.seq
457901320 gbpln95.seq
5774756 gbpln950.seq
777312364 gbpln951.seq
1006352199 gbpln952.seq
962815279 gbpln953.seq
975138624 gbpln954.seq
906550423 gbpln955.seq
790269619 gbpln956.seq
956926034 gbpln957.seq
908369814 gbpln958.seq
1035806383 gbpln959.seq
433637010 gbpln96.seq
1095241384 gbpln960.seq
889046375 gbpln961.seq
920177986 gbpln962.seq
934896187 gbpln963.seq
972756494 gbpln964.seq
639243888 gbpln965.seq
839211114 gbpln966.seq
802168717 gbpln967.seq
677231763 gbpln968.seq
740101369 gbpln969.seq
498225038 gbpln97.seq
642539818 gbpln970.seq
835613563 gbpln971.seq
284703679 gbpln972.seq
252385105 gbpln973.seq
408962039 gbpln974.seq
329779393 gbpln975.seq
332794404 gbpln976.seq
418495189 gbpln977.seq
443558619 gbpln978.seq
449429603 gbpln979.seq
107502928 gbpln98.seq
403262216 gbpln980.seq
477398793 gbpln981.seq
434382532 gbpln982.seq
443534393 gbpln983.seq
444327807 gbpln984.seq
486802329 gbpln985.seq
482267023 gbpln986.seq
434633991 gbpln987.seq
412605137 gbpln988.seq
487251002 gbpln989.seq
449964742 gbpln99.seq
475655683 gbpln990.seq
480193090 gbpln991.seq
445118180 gbpln992.seq
94040671 gbpln993.seq
598056431 gbpln994.seq
774899230 gbpln995.seq
723495076 gbpln996.seq
714415062 gbpln997.seq
677999217 gbpln998.seq
629027473 gbpln999.seq
148373644 gbpri1.seq
499825465 gbpri10.seq
499966274 gbpri11.seq
248882813 gbpri12.seq
499849548 gbpri13.seq
352979039 gbpri14.seq
162643079 gbpri15.seq
494712989 gbpri16.seq
499956353 gbpri17.seq
499952905 gbpri18.seq
499962231 gbpri19.seq
499849640 gbpri2.seq
254317986 gbpri20.seq
317623611 gbpri21.seq
301999314 gbpri22.seq
491210460 gbpri23.seq
445784960 gbpri24.seq
381564599 gbpri25.seq
343180411 gbpri26.seq
476587789 gbpri27.seq
474072403 gbpri28.seq
368094098 gbpri29.seq
499891275 gbpri3.seq
499998059 gbpri30.seq
73923753 gbpri31.seq
499936200 gbpri32.seq
445709575 gbpri33.seq
427947001 gbpri34.seq
376529642 gbpri35.seq
483909975 gbpri36.seq
361488390 gbpri37.seq
388660134 gbpri38.seq
448630862 gbpri39.seq
499855408 gbpri4.seq
499942041 gbpri40.seq
307422469 gbpri41.seq
314630532 gbpri42.seq
499799975 gbpri43.seq
499997851 gbpri44.seq
213880827 gbpri45.seq
499999780 gbpri46.seq
499997086 gbpri47.seq
316411730 gbpri48.seq
499990113 gbpri49.seq
499729176 gbpri5.seq
499998495 gbpri50.seq
327917692 gbpri51.seq
258775295 gbpri52.seq
499996624 gbpri53.seq
499999314 gbpri54.seq
499993572 gbpri55.seq
499973003 gbpri56.seq
499997612 gbpri57.seq
214239008 gbpri58.seq
393528728 gbpri6.seq
499802910 gbpri7.seq
499984899 gbpri8.seq
499967070 gbpri9.seq
1169290 gbrel.txt
499951866 gbrod1.seq
499998469 gbrod10.seq
419878182 gbrod100.seq
403492494 gbrod101.seq
439526332 gbrod102.seq
248164111 gbrod103.seq
405939473 gbrod104.seq
384447340 gbrod105.seq
355679333 gbrod106.seq
497729616 gbrod107.seq
445498035 gbrod108.seq
466416387 gbrod109.seq
6033902 gbrod11.seq
384594494 gbrod110.seq
370764567 gbrod111.seq
352341932 gbrod112.seq
472534897 gbrod113.seq
442899850 gbrod114.seq
391247240 gbrod115.seq
302308728 gbrod116.seq
480858122 gbrod117.seq
424097302 gbrod118.seq
389168953 gbrod119.seq
499806176 gbrod12.seq
364557408 gbrod120.seq
496236266 gbrod121.seq
457035537 gbrod122.seq
397907216 gbrod123.seq
303919253 gbrod124.seq
472719372 gbrod125.seq
199611566 gbrod126.seq
379735208 gbrod127.seq
373874236 gbrod128.seq
492612107 gbrod129.seq
203924668 gbrod13.seq
455685049 gbrod130.seq
424015225 gbrod131.seq
422109961 gbrod132.seq
402489078 gbrod133.seq
150585215 gbrod134.seq
432875924 gbrod135.seq
473809988 gbrod136.seq
493341944 gbrod137.seq
369899434 gbrod138.seq
352286248 gbrod139.seq
499995322 gbrod14.seq
495134062 gbrod140.seq
469349893 gbrod141.seq
385134441 gbrod142.seq
370752989 gbrod143.seq
350782953 gbrod144.seq
472215298 gbrod145.seq
440418647 gbrod146.seq
390673256 gbrod147.seq
299732413 gbrod148.seq
469102685 gbrod149.seq
499997002 gbrod15.seq
389834819 gbrod150.seq
372942018 gbrod151.seq
357041751 gbrod152.seq
471802981 gbrod153.seq
442335356 gbrod154.seq
272062219 gbrod155.seq
421368094 gbrod156.seq
465159875 gbrod157.seq
385490257 gbrod158.seq
365814425 gbrod159.seq
499999071 gbrod16.seq
349038378 gbrod160.seq
318450016 gbrod161.seq
448518533 gbrod162.seq
413714740 gbrod163.seq
419290195 gbrod164.seq
466211866 gbrod165.seq
387893635 gbrod166.seq
186742583 gbrod167.seq
369103842 gbrod168.seq
487915723 gbrod169.seq
296354536 gbrod17.seq
450102561 gbrod170.seq
413892753 gbrod171.seq
419378521 gbrod172.seq
249506719 gbrod173.seq
431031986 gbrod174.seq
392811039 gbrod175.seq
374963024 gbrod176.seq
339853098 gbrod177.seq
465902366 gbrod178.seq
448509046 gbrod179.seq
416105832 gbrod18.seq
478088985 gbrod180.seq
74225189 gbrod181.seq
401026287 gbrod182.seq
438450513 gbrod183.seq
392223411 gbrod184.seq
298791488 gbrod185.seq
421037306 gbrod186.seq
377024222 gbrod187.seq
358182039 gbrod188.seq
498127194 gbrod189.seq
485622431 gbrod19.seq
395007403 gbrod190.seq
420940299 gbrod191.seq
420418108 gbrod192.seq
416033149 gbrod193.seq
371638158 gbrod194.seq
168940443 gbrod195.seq
344507393 gbrod196.seq
318954535 gbrod197.seq
344554082 gbrod198.seq
342695770 gbrod199.seq
499801667 gbrod2.seq
447177606 gbrod20.seq
464792186 gbrod200.seq
401018426 gbrod201.seq
244981400 gbrod202.seq
424020455 gbrod203.seq
445077763 gbrod204.seq
471066620 gbrod205.seq
463756029 gbrod206.seq
477523791 gbrod207.seq
429214893 gbrod208.seq
482809898 gbrod209.seq
401874104 gbrod21.seq
409881666 gbrod210.seq
499005744 gbrod211.seq
445425390 gbrod212.seq
453009972 gbrod213.seq
238222178 gbrod214.seq
433121687 gbrod215.seq
401444461 gbrod216.seq
355166120 gbrod217.seq
439733945 gbrod218.seq
399262915 gbrod219.seq
366906621 gbrod22.seq
343303814 gbrod220.seq
449604401 gbrod221.seq
373291356 gbrod222.seq
491021867 gbrod223.seq
411878942 gbrod224.seq
394783112 gbrod225.seq
354215147 gbrod226.seq
478827549 gbrod227.seq
464689320 gbrod228.seq
496457781 gbrod229.seq
178573599 gbrod23.seq
328639335 gbrod230.seq
429295912 gbrod231.seq
201904361 gbrod232.seq
381229576 gbrod233.seq
352252100 gbrod234.seq
483911001 gbrod235.seq
439271128 gbrod236.seq
432391884 gbrod237.seq
379422136 gbrod238.seq
487314628 gbrod239.seq
488460696 gbrod24.seq
424101431 gbrod240.seq
402251656 gbrod241.seq
377306384 gbrod242.seq
496030481 gbrod243.seq
476084602 gbrod244.seq
404173831 gbrod245.seq
121703297 gbrod246.seq
471718554 gbrod247.seq
429849644 gbrod248.seq
369205357 gbrod249.seq
424418862 gbrod25.seq
458471717 gbrod250.seq
410175604 gbrod251.seq
423146610 gbrod252.seq
172228268 gbrod253.seq
492401067 gbrod254.seq
487467397 gbrod255.seq
412574887 gbrod256.seq
371643290 gbrod257.seq
458445658 gbrod258.seq
395932157 gbrod259.seq
451727059 gbrod26.seq
429793810 gbrod260.seq
490297286 gbrod261.seq
410121996 gbrod262.seq
409184503 gbrod263.seq
367837774 gbrod264.seq
447381136 gbrod265.seq
223327565 gbrod266.seq
402425622 gbrod267.seq
448449857 gbrod268.seq
461815006 gbrod269.seq
499112036 gbrod27.seq
478700924 gbrod270.seq
408314221 gbrod271.seq
349093340 gbrod272.seq
455227074 gbrod273.seq
454883295 gbrod274.seq
483614724 gbrod275.seq
369373092 gbrod276.seq
442583968 gbrod277.seq
421061266 gbrod278.seq
196273488 gbrod279.seq
467946548 gbrod28.seq
350815101 gbrod280.seq
431195894 gbrod281.seq
436876327 gbrod282.seq
495700637 gbrod283.seq
383320388 gbrod284.seq
457101351 gbrod285.seq
410386577 gbrod286.seq
373894312 gbrod287.seq
447245565 gbrod288.seq
442554857 gbrod289.seq
425428799 gbrod29.seq
496529716 gbrod290.seq
438732151 gbrod291.seq
404017310 gbrod292.seq
417018539 gbrod293.seq
194574877 gbrod294.seq
493375331 gbrod295.seq
407058545 gbrod296.seq
420360712 gbrod297.seq
497137694 gbrod298.seq
376315111 gbrod299.seq
499860799 gbrod3.seq
380509124 gbrod30.seq
435156107 gbrod300.seq
487765053 gbrod301.seq
406428098 gbrod302.seq
448028858 gbrod303.seq
469164401 gbrod304.seq
471219154 gbrod305.seq
251509050 gbrod306.seq
303883779 gbrod307.seq
469719503 gbrod308.seq
386750689 gbrod309.seq
359291146 gbrod31.seq
495403498 gbrod310.seq
440414980 gbrod311.seq
405968892 gbrod312.seq
477306463 gbrod313.seq
254268214 gbrod314.seq
441031541 gbrod32.seq
489661762 gbrod33.seq
301541840 gbrod34.seq
245696968 gbrod35.seq
444533522 gbrod36.seq
404901396 gbrod37.seq
350079181 gbrod38.seq
484303888 gbrod39.seq
499965631 gbrod4.seq
464197213 gbrod40.seq
475600609 gbrod41.seq
417011576 gbrod42.seq
368092577 gbrod43.seq
459234406 gbrod44.seq
385583012 gbrod45.seq
488265022 gbrod46.seq
434197329 gbrod47.seq
412800312 gbrod48.seq
454365663 gbrod49.seq
499960342 gbrod5.seq
382748472 gbrod50.seq
428038719 gbrod51.seq
487918369 gbrod52.seq
440586747 gbrod53.seq
359290553 gbrod54.seq
499999662 gbrod55.seq
291916823 gbrod56.seq
390007635 gbrod57.seq
346418766 gbrod58.seq
345548222 gbrod59.seq
80291490 gbrod6.seq
465925928 gbrod60.seq
403537722 gbrod61.seq
386823577 gbrod62.seq
403462511 gbrod63.seq
391812927 gbrod64.seq
346719868 gbrod65.seq
491742089 gbrod66.seq
445010312 gbrod67.seq
493387550 gbrod68.seq
300864949 gbrod69.seq
499846851 gbrod7.seq
466768965 gbrod70.seq
374387663 gbrod71.seq
350248940 gbrod72.seq
470230178 gbrod73.seq
465917437 gbrod74.seq
493546372 gbrod75.seq
164945760 gbrod76.seq
403745653 gbrod77.seq
436915885 gbrod78.seq
473498938 gbrod79.seq
499742719 gbrod8.seq
494867130 gbrod80.seq
353125249 gbrod81.seq
339090141 gbrod82.seq
372648418 gbrod83.seq
304437664 gbrod84.seq
466850317 gbrod85.seq
387285794 gbrod86.seq
374061084 gbrod87.seq
353646449 gbrod88.seq
160857005 gbrod89.seq
499945822 gbrod9.seq
461956462 gbrod90.seq
433837684 gbrod91.seq
474478559 gbrod92.seq
316311284 gbrod93.seq
418985554 gbrod94.seq
371050540 gbrod95.seq
363244189 gbrod96.seq
482685615 gbrod97.seq
448001147 gbrod98.seq
413360145 gbrod99.seq
499999620 gbsts1.seq
499999261 gbsts10.seq
433593155 gbsts11.seq
499995920 gbsts2.seq
38302306 gbsts3.seq
499998792 gbsts4.seq
499998127 gbsts5.seq
456725186 gbsts6.seq
499997583 gbsts7.seq
499998390 gbsts8.seq
21009609 gbsts9.seq
300842093 gbsyn1.seq
484840372 gbsyn10.seq
420813753 gbsyn11.seq
490139440 gbsyn12.seq
343340422 gbsyn13.seq
372527348 gbsyn14.seq
417861289 gbsyn15.seq
448312981 gbsyn16.seq
416378132 gbsyn17.seq
453065790 gbsyn18.seq
263307032 gbsyn19.seq
343340424 gbsyn2.seq
484840366 gbsyn20.seq
420813747 gbsyn21.seq
498979310 gbsyn22.seq
495655717 gbsyn23.seq
483003347 gbsyn24.seq
499993129 gbsyn25.seq
499997703 gbsyn26.seq
499993978 gbsyn27.seq
248715894 gbsyn28.seq
438887010 gbsyn29.seq
372527353 gbsyn3.seq
417861297 gbsyn4.seq
448312992 gbsyn5.seq
81377357 gbsyn6.seq
470781602 gbsyn7.seq
317285242 gbsyn8.seq
263307034 gbsyn9.seq
499999170 gbtsa1.seq
499997170 gbtsa10.seq
499997439 gbtsa100.seq
499999811 gbtsa101.seq
499996108 gbtsa102.seq
404671505 gbtsa103.seq
499996434 gbtsa104.seq
499998444 gbtsa105.seq
499998535 gbtsa106.seq
473161128 gbtsa107.seq
499998602 gbtsa108.seq
499997931 gbtsa109.seq
499999169 gbtsa11.seq
235230591 gbtsa110.seq
499991596 gbtsa111.seq
499999834 gbtsa112.seq
499999770 gbtsa113.seq
499998939 gbtsa114.seq
34150369 gbtsa115.seq
499995781 gbtsa116.seq
499999069 gbtsa117.seq
499994937 gbtsa118.seq
470659755 gbtsa119.seq
280571641 gbtsa12.seq
499998218 gbtsa120.seq
499998672 gbtsa121.seq
499999924 gbtsa122.seq
280313902 gbtsa123.seq
499999116 gbtsa124.seq
499998111 gbtsa125.seq
499999818 gbtsa126.seq
423256101 gbtsa127.seq
499996305 gbtsa13.seq
499999062 gbtsa14.seq
161780319 gbtsa15.seq
500000121 gbtsa16.seq
499994772 gbtsa17.seq
260516544 gbtsa18.seq
499998904 gbtsa19.seq
499999528 gbtsa2.seq
500000036 gbtsa20.seq
499995141 gbtsa21.seq
72460486 gbtsa22.seq
500000102 gbtsa23.seq
499998850 gbtsa24.seq
499998338 gbtsa25.seq
284712908 gbtsa26.seq
499999143 gbtsa27.seq
499999640 gbtsa28.seq
77188803 gbtsa29.seq
148639076 gbtsa3.seq
499999538 gbtsa30.seq
499998402 gbtsa31.seq
160181305 gbtsa32.seq
499998942 gbtsa33.seq
499997585 gbtsa34.seq
499998185 gbtsa35.seq
492954858 gbtsa36.seq
499999905 gbtsa37.seq
499998822 gbtsa38.seq
499996375 gbtsa39.seq
499998486 gbtsa4.seq
229182509 gbtsa40.seq
499997763 gbtsa41.seq
499999567 gbtsa42.seq
499999364 gbtsa43.seq
177582677 gbtsa44.seq
499998570 gbtsa45.seq
499998681 gbtsa46.seq
356101733 gbtsa47.seq
499999382 gbtsa48.seq
499999056 gbtsa49.seq
499998583 gbtsa5.seq
298479435 gbtsa50.seq
499997916 gbtsa51.seq
499999591 gbtsa52.seq
402924700 gbtsa53.seq
499999696 gbtsa54.seq
499997992 gbtsa55.seq
499998333 gbtsa56.seq
343934196 gbtsa57.seq
499999894 gbtsa58.seq
499999312 gbtsa59.seq
58524370 gbtsa6.seq
499996663 gbtsa60.seq
226876032 gbtsa61.seq
499998883 gbtsa62.seq
499998945 gbtsa63.seq
261554469 gbtsa64.seq
499999567 gbtsa65.seq
464262990 gbtsa66.seq
499998462 gbtsa67.seq
499999620 gbtsa68.seq
499998268 gbtsa69.seq
499998361 gbtsa7.seq
168770314 gbtsa70.seq
499997567 gbtsa71.seq
500000162 gbtsa72.seq
499998185 gbtsa73.seq
2512297 gbtsa74.seq
499998125 gbtsa75.seq
499999999 gbtsa76.seq
131338866 gbtsa77.seq
500000012 gbtsa78.seq
499999875 gbtsa79.seq
499999426 gbtsa8.seq
34997856 gbtsa80.seq
499999375 gbtsa81.seq
499997355 gbtsa82.seq
499996990 gbtsa83.seq
499997400 gbtsa84.seq
48843479 gbtsa85.seq
499997725 gbtsa86.seq
499999047 gbtsa87.seq
499998830 gbtsa88.seq
83128617 gbtsa89.seq
274552792 gbtsa9.seq
499998662 gbtsa90.seq
390370134 gbtsa91.seq
499998191 gbtsa92.seq
499994249 gbtsa93.seq
499998640 gbtsa94.seq
208350764 gbtsa95.seq
499999734 gbtsa96.seq
499998253 gbtsa97.seq
499996332 gbtsa98.seq
230879944 gbtsa99.seq
7314509 gbuna1.seq
499998322 gbvrl1.seq
499998998 gbvrl10.seq
499970354 gbvrl100.seq
101935477 gbvrl1000.se
499959573 gbvrl1001.se
499976239 gbvrl1002.se
499984409 gbvrl1003.se
369334715 gbvrl1004.se
499979245 gbvrl1005.se
499979721 gbvrl1006.se
499979821 gbvrl1007.se
499963429 gbvrl1008.se
160099447 gbvrl1009.se
199437498 gbvrl101.seq
499972227 gbvrl1010.se
499975329 gbvrl1011.se
499983189 gbvrl1012.se
499983490 gbvrl1013.se
499992002 gbvrl1014.se
103867249 gbvrl1015.se
499985908 gbvrl1016.se
499963642 gbvrl1017.se
499983539 gbvrl1018.se
500000000 gbvrl1019.se
499945853 gbvrl102.seq
307395367 gbvrl1020.se
499961016 gbvrl1021.se
499968835 gbvrl1022.se
499992120 gbvrl1023.se
324381302 gbvrl1024.se
499982522 gbvrl1025.se
499972967 gbvrl1026.se
499972756 gbvrl1027.se
499961382 gbvrl1028.se
499987423 gbvrl1029.se
499991259 gbvrl103.seq
178045189 gbvrl1030.se
499992266 gbvrl1031.se
499999515 gbvrl1032.se
499999971 gbvrl1033.se
499978031 gbvrl1034.se
499997919 gbvrl1035.se
499999711 gbvrl1036.se
134434425 gbvrl1037.se
499979824 gbvrl104.seq
249621641 gbvrl105.seq
499939986 gbvrl106.seq
499943047 gbvrl107.seq
499950409 gbvrl108.seq
447575212 gbvrl109.seq
499996904 gbvrl11.seq
499974451 gbvrl110.seq
499948725 gbvrl111.seq
499934102 gbvrl112.seq
147258184 gbvrl113.seq
499945899 gbvrl114.seq
499975940 gbvrl115.seq
499996536 gbvrl116.seq
499992423 gbvrl117.seq
11677548 gbvrl118.seq
499983278 gbvrl119.seq
499988188 gbvrl12.seq
499996166 gbvrl120.seq
499936493 gbvrl121.seq
261077215 gbvrl122.seq
499988973 gbvrl123.seq
499940262 gbvrl124.seq
499965643 gbvrl125.seq
499938066 gbvrl126.seq
10734996 gbvrl127.seq
499941734 gbvrl128.seq
499974455 gbvrl129.seq
167713505 gbvrl13.seq
499998785 gbvrl130.seq
499990414 gbvrl131.seq
317225729 gbvrl132.seq
499983054 gbvrl133.seq
500000248 gbvrl134.seq
499973059 gbvrl135.seq
499982774 gbvrl136.seq
499974584 gbvrl137.seq
230219843 gbvrl138.seq
499996809 gbvrl139.seq
499996086 gbvrl14.seq
499999895 gbvrl140.seq
499991400 gbvrl141.seq
325521675 gbvrl142.seq
499966066 gbvrl143.seq
499968818 gbvrl144.seq
499980029 gbvrl145.seq
301217599 gbvrl146.seq
499979028 gbvrl147.seq
499959609 gbvrl148.seq
499978787 gbvrl149.seq
500000124 gbvrl15.seq
185957796 gbvrl150.seq
499941793 gbvrl151.seq
499966162 gbvrl152.seq
499992721 gbvrl153.seq
499935005 gbvrl154.seq
263691398 gbvrl155.seq
499994928 gbvrl156.seq
499954320 gbvrl157.seq
499996427 gbvrl158.seq
240076943 gbvrl159.seq
136684320 gbvrl16.seq
499961956 gbvrl160.seq
499981491 gbvrl161.seq
499964003 gbvrl162.seq
499938159 gbvrl163.seq
268425091 gbvrl164.seq
499934815 gbvrl165.seq
499955895 gbvrl166.seq
499960906 gbvrl167.seq
499965308 gbvrl168.seq
230286107 gbvrl169.seq
499999413 gbvrl17.seq
499994101 gbvrl170.seq
499988195 gbvrl171.seq
499987737 gbvrl172.seq
338461002 gbvrl173.seq
499943659 gbvrl174.seq
499975406 gbvrl175.seq
499981847 gbvrl176.seq
135661324 gbvrl177.seq
499984458 gbvrl178.seq
499934410 gbvrl179.seq
499997471 gbvrl18.seq
499997472 gbvrl180.seq
154420332 gbvrl181.seq
499977523 gbvrl182.seq
499960236 gbvrl183.seq
499971958 gbvrl184.seq
493177733 gbvrl185.seq
499959914 gbvrl186.seq
499941464 gbvrl187.seq
499993381 gbvrl188.seq
499981609 gbvrl189.seq
321440707 gbvrl19.seq
7164881 gbvrl190.seq
499951054 gbvrl191.seq
499946701 gbvrl192.seq
499989336 gbvrl193.seq
177144588 gbvrl194.seq
499974446 gbvrl195.seq
499955314 gbvrl196.seq
499941593 gbvrl197.seq
499938033 gbvrl198.seq
268313859 gbvrl199.seq
499999022 gbvrl2.seq
499999125 gbvrl20.seq
499962119 gbvrl200.seq
499954245 gbvrl201.seq
499968779 gbvrl202.seq
499988730 gbvrl203.seq
281417921 gbvrl204.seq
499936963 gbvrl205.seq
499936843 gbvrl206.seq
499981582 gbvrl207.seq
499966524 gbvrl208.seq
313199570 gbvrl209.seq
499995500 gbvrl21.seq
499990929 gbvrl210.seq
499969757 gbvrl211.seq
499981840 gbvrl212.seq
499978639 gbvrl213.seq
286863642 gbvrl214.seq
499969985 gbvrl215.seq
499971276 gbvrl216.seq
499934306 gbvrl217.seq
499958531 gbvrl218.seq
269764809 gbvrl219.seq
348831154 gbvrl22.seq
499937156 gbvrl220.seq
499964494 gbvrl221.seq
499946761 gbvrl222.seq
499948348 gbvrl223.seq
284413649 gbvrl224.seq
499976696 gbvrl225.seq
499995582 gbvrl226.seq
499988986 gbvrl227.seq
499983848 gbvrl228.seq
284053962 gbvrl229.seq
499521833 gbvrl23.seq
499969618 gbvrl230.seq
499977908 gbvrl231.seq
499942860 gbvrl232.seq
499962083 gbvrl233.seq
274762197 gbvrl234.seq
499944245 gbvrl235.seq
499980000 gbvrl236.seq
499942312 gbvrl237.seq
499948683 gbvrl238.seq
239583375 gbvrl239.seq
499999187 gbvrl24.seq
499995448 gbvrl240.seq
499989671 gbvrl241.seq
499943959 gbvrl242.seq
499988572 gbvrl243.seq
263144370 gbvrl244.seq
499995908 gbvrl245.seq
499977100 gbvrl246.seq
499958714 gbvrl247.seq
499989449 gbvrl248.seq
264216698 gbvrl249.seq
373350160 gbvrl25.seq
499955591 gbvrl250.seq
499964451 gbvrl251.seq
499933383 gbvrl252.seq
499951318 gbvrl253.seq
263968050 gbvrl254.seq
499948093 gbvrl255.seq
499987219 gbvrl256.seq
499937055 gbvrl257.seq
137571832 gbvrl258.seq
499939743 gbvrl259.seq
499997702 gbvrl26.seq
499950605 gbvrl260.seq
499967297 gbvrl261.seq
145842756 gbvrl262.seq
499944789 gbvrl263.seq
499944834 gbvrl264.seq
499943615 gbvrl265.seq
499940887 gbvrl266.seq
499995153 gbvrl267.seq
499956558 gbvrl268.seq
245792518 gbvrl269.seq
499995630 gbvrl27.seq
499953049 gbvrl270.seq
499944214 gbvrl271.seq
499973163 gbvrl272.seq
499964471 gbvrl273.seq
254737531 gbvrl274.seq
499945748 gbvrl275.seq
499989044 gbvrl276.seq
499958758 gbvrl277.seq
499985868 gbvrl278.seq
262950858 gbvrl279.seq
317210608 gbvrl28.seq
499933463 gbvrl280.seq
499990210 gbvrl281.seq
499937855 gbvrl282.seq
499975105 gbvrl283.seq
421440261 gbvrl284.seq
499966811 gbvrl285.seq
499951871 gbvrl286.seq
499978481 gbvrl287.seq
166973409 gbvrl288.seq
499998709 gbvrl289.seq
499996378 gbvrl29.seq
499963725 gbvrl290.seq
499995678 gbvrl291.seq
228199220 gbvrl292.seq
499958490 gbvrl293.seq
499944718 gbvrl294.seq
499971991 gbvrl295.seq
309527775 gbvrl296.seq
499992351 gbvrl297.seq
499955529 gbvrl298.seq
499942230 gbvrl299.seq
499944583 gbvrl3.seq
499910241 gbvrl30.seq
269130036 gbvrl300.seq
499977762 gbvrl301.seq
499997321 gbvrl302.seq
499937572 gbvrl303.seq
372922730 gbvrl304.seq
499987362 gbvrl305.seq
499982413 gbvrl306.seq
499995917 gbvrl307.seq
386286627 gbvrl308.seq
499936525 gbvrl309.seq
499997493 gbvrl31.seq
499958288 gbvrl310.seq
499998969 gbvrl311.seq
499997600 gbvrl312.seq
25305568 gbvrl313.seq
499981164 gbvrl314.seq
499955514 gbvrl315.seq
499946943 gbvrl316.seq
270338506 gbvrl317.seq
499980204 gbvrl318.seq
499944255 gbvrl319.seq
369560045 gbvrl32.seq
499972572 gbvrl320.seq
248926802 gbvrl321.seq
499979061 gbvrl322.seq
499960038 gbvrl323.seq
499966634 gbvrl324.seq
165141788 gbvrl325.seq
499997023 gbvrl326.seq
499987515 gbvrl327.seq
499932485 gbvrl328.seq
499983572 gbvrl329.seq
499996383 gbvrl33.seq
70478356 gbvrl330.seq
499985499 gbvrl331.seq
499982271 gbvrl332.seq
499993251 gbvrl333.seq
464591304 gbvrl334.seq
499976156 gbvrl335.seq
499990464 gbvrl336.seq
499982072 gbvrl337.seq
499946260 gbvrl338.seq
2258854 gbvrl339.seq
499964738 gbvrl34.seq
499979084 gbvrl340.seq
499962681 gbvrl341.seq
499940572 gbvrl342.seq
499981323 gbvrl343.seq
147998614 gbvrl344.seq
499943099 gbvrl345.seq
499944766 gbvrl346.seq
499942420 gbvrl347.seq
191148406 gbvrl348.seq
499952125 gbvrl349.seq
435583309 gbvrl35.seq
499976678 gbvrl350.seq
499980977 gbvrl351.seq
451551092 gbvrl352.seq
499991371 gbvrl353.seq
499955764 gbvrl354.seq
499971769 gbvrl355.seq
223023780 gbvrl356.seq
499949824 gbvrl357.seq
499971955 gbvrl358.seq
499949989 gbvrl359.seq
499998849 gbvrl36.seq
361414694 gbvrl360.seq
499990922 gbvrl361.seq
499984767 gbvrl362.seq
499968057 gbvrl363.seq
499978768 gbvrl364.seq
154949812 gbvrl365.seq
499951093 gbvrl366.seq
499962843 gbvrl367.seq
499999212 gbvrl368.seq
495803550 gbvrl369.seq
499997525 gbvrl37.seq
499942082 gbvrl370.seq
499939299 gbvrl371.seq
499949782 gbvrl372.seq
498014116 gbvrl373.seq
499939715 gbvrl374.seq
499966453 gbvrl375.seq
499972030 gbvrl376.seq
278819141 gbvrl377.seq
499970229 gbvrl378.seq
499933874 gbvrl379.seq
434029104 gbvrl38.seq
499937932 gbvrl380.seq
261317507 gbvrl381.seq
499978082 gbvrl382.seq
499959848 gbvrl383.seq
499952080 gbvrl384.seq
239418008 gbvrl385.seq
499955437 gbvrl386.seq
499966158 gbvrl387.seq
499947916 gbvrl388.seq
299899893 gbvrl389.seq
499978481 gbvrl39.seq
499939676 gbvrl390.seq
499952626 gbvrl391.seq
499954434 gbvrl392.seq
223525698 gbvrl393.seq
499982849 gbvrl394.seq
499943063 gbvrl395.seq
499953612 gbvrl396.seq
164057883 gbvrl397.seq
499974498 gbvrl398.seq
499958347 gbvrl399.seq
342410607 gbvrl4.seq
499942606 gbvrl40.seq
499962323 gbvrl400.seq
233193920 gbvrl401.seq
499993823 gbvrl402.seq
499969645 gbvrl403.seq
499981167 gbvrl404.seq
459635509 gbvrl405.seq
499973246 gbvrl406.seq
499962867 gbvrl407.seq
499952154 gbvrl408.seq
417409995 gbvrl409.seq
499999434 gbvrl41.seq
499952366 gbvrl410.seq
499947781 gbvrl411.seq
499976782 gbvrl412.seq
189778502 gbvrl413.seq
499938266 gbvrl414.seq
499958380 gbvrl415.seq
499962146 gbvrl416.seq
243596282 gbvrl417.seq
499964577 gbvrl418.seq
499964037 gbvrl419.seq
329869525 gbvrl42.seq
499948851 gbvrl420.seq
210802218 gbvrl421.seq
499986515 gbvrl422.seq
499997190 gbvrl423.seq
499949587 gbvrl424.seq
403602937 gbvrl425.seq
499940103 gbvrl426.seq
499953362 gbvrl427.seq
499989873 gbvrl428.seq
298659363 gbvrl429.seq
499961685 gbvrl43.seq
499978636 gbvrl430.seq
499937107 gbvrl431.seq
499954499 gbvrl432.seq
381587925 gbvrl433.seq
499948773 gbvrl434.seq
499967828 gbvrl435.seq
499996930 gbvrl436.seq
499989546 gbvrl437.seq
121868278 gbvrl438.seq
499959915 gbvrl439.seq
499954076 gbvrl44.seq
499934906 gbvrl440.seq
499954247 gbvrl441.seq
215333011 gbvrl442.seq
499962217 gbvrl443.seq
499990220 gbvrl444.seq
499968565 gbvrl445.seq
499997229 gbvrl446.seq
499991692 gbvrl447.seq
403513578 gbvrl448.seq
499999517 gbvrl449.seq
499998127 gbvrl45.seq
499983672 gbvrl450.seq
499968848 gbvrl451.seq
283549802 gbvrl452.seq
499811324 gbvrl453.seq
499993890 gbvrl454.seq
499933334 gbvrl455.seq
161396955 gbvrl456.seq
499966815 gbvrl457.seq
499991736 gbvrl458.seq
499978107 gbvrl459.seq
300823747 gbvrl46.seq
383125867 gbvrl460.seq
499966375 gbvrl461.seq
499970705 gbvrl462.seq
499955361 gbvrl463.seq
499995586 gbvrl464.seq
277173753 gbvrl465.seq
499944560 gbvrl466.seq
499944209 gbvrl467.seq
499987160 gbvrl468.seq
277779670 gbvrl469.seq
499944443 gbvrl47.seq
499967041 gbvrl470.seq
499940664 gbvrl471.seq
499951525 gbvrl472.seq
341374921 gbvrl473.seq
499973834 gbvrl474.seq
499999085 gbvrl475.seq
499996805 gbvrl476.seq
278899577 gbvrl477.seq
499990608 gbvrl478.seq
499966181 gbvrl479.seq
499997989 gbvrl48.seq
499963998 gbvrl480.seq
288792462 gbvrl481.seq
499938040 gbvrl482.seq
499968882 gbvrl483.seq
499943690 gbvrl484.seq
456519794 gbvrl485.seq
499985667 gbvrl486.seq
499966815 gbvrl487.seq
499963022 gbvrl488.seq
465981001 gbvrl489.seq
499958539 gbvrl49.seq
499939547 gbvrl490.seq
499999970 gbvrl491.seq
499937270 gbvrl492.seq
499955987 gbvrl493.seq
499948472 gbvrl494.seq
499980186 gbvrl495.seq
236822251 gbvrl496.seq
499984330 gbvrl497.seq
499956624 gbvrl498.seq
499996642 gbvrl499.seq
499998593 gbvrl5.seq
355781274 gbvrl50.seq
499996545 gbvrl500.seq
264841592 gbvrl501.seq
499985431 gbvrl502.seq
499948423 gbvrl503.seq
499950078 gbvrl504.seq
276158410 gbvrl505.seq
499990311 gbvrl506.seq
499970079 gbvrl507.seq
499989314 gbvrl508.seq
191608484 gbvrl509.seq
499952107 gbvrl51.seq
499998057 gbvrl510.seq
499949816 gbvrl511.seq
499948737 gbvrl512.seq
223630354 gbvrl513.seq
499994831 gbvrl514.seq
499990987 gbvrl515.seq
499952965 gbvrl516.seq
236500691 gbvrl517.seq
499966971 gbvrl518.seq
499962400 gbvrl519.seq
499969449 gbvrl52.seq
499939691 gbvrl520.seq
499934553 gbvrl521.seq
332952083 gbvrl522.seq
499983561 gbvrl523.seq
499982679 gbvrl524.seq
499991132 gbvrl525.seq
499944102 gbvrl526.seq
337305139 gbvrl527.seq
499999394 gbvrl528.seq
499950346 gbvrl529.seq
499981598 gbvrl53.seq
499947610 gbvrl530.seq
499985744 gbvrl531.seq
426169901 gbvrl532.seq
499967461 gbvrl533.seq
499975725 gbvrl534.seq
499941730 gbvrl535.seq
309584268 gbvrl536.seq
499940544 gbvrl537.seq
499857973 gbvrl538.seq
499966103 gbvrl539.seq
286387811 gbvrl54.seq
346290615 gbvrl540.seq
499977849 gbvrl541.seq
499933994 gbvrl542.seq
499999941 gbvrl543.seq
499982411 gbvrl544.seq
180210351 gbvrl545.seq
499940499 gbvrl546.seq
499966105 gbvrl547.seq
499974631 gbvrl548.seq
226204188 gbvrl549.seq
499975626 gbvrl55.seq
499995166 gbvrl550.seq
499989753 gbvrl551.seq
499954042 gbvrl552.seq
304945811 gbvrl553.seq
499981065 gbvrl554.seq
499959262 gbvrl555.seq
499936907 gbvrl556.seq
221608474 gbvrl557.seq
499974392 gbvrl558.seq
499952549 gbvrl559.seq
499972073 gbvrl56.seq
499998178 gbvrl560.seq
204501954 gbvrl561.seq
499957818 gbvrl562.seq
499969033 gbvrl563.seq
499934762 gbvrl564.seq
168315058 gbvrl565.seq
499940185 gbvrl566.seq
500000163 gbvrl567.seq
499987091 gbvrl568.seq
203124956 gbvrl569.seq
499979218 gbvrl57.seq
499939410 gbvrl570.seq
499957090 gbvrl571.seq
499948418 gbvrl572.seq
293397904 gbvrl573.seq
499964770 gbvrl574.seq
499976536 gbvrl575.seq
499996038 gbvrl576.seq
327652549 gbvrl577.seq
499982767 gbvrl578.seq
499978301 gbvrl579.seq
499979418 gbvrl58.seq
499961553 gbvrl580.seq
196912540 gbvrl581.seq
499953170 gbvrl582.seq
499950511 gbvrl583.seq
499995443 gbvrl584.seq
400585916 gbvrl585.seq
499958557 gbvrl586.seq
499963814 gbvrl587.seq
499975469 gbvrl588.seq
473225143 gbvrl589.seq
197971901 gbvrl59.seq
499940040 gbvrl590.seq
499990399 gbvrl591.seq
499993735 gbvrl592.seq
177281796 gbvrl593.seq
499941082 gbvrl594.seq
499997179 gbvrl595.seq
499994333 gbvrl596.seq
408238844 gbvrl597.seq
499933603 gbvrl598.seq
499960783 gbvrl599.seq
499999106 gbvrl6.seq
499963264 gbvrl60.seq
499996928 gbvrl600.seq
455826032 gbvrl601.seq
499939560 gbvrl602.seq
499998099 gbvrl603.seq
499990582 gbvrl604.seq
499937178 gbvrl605.seq
42417441 gbvrl606.seq
499975462 gbvrl607.seq
499978048 gbvrl608.seq
499980248 gbvrl609.seq
499945381 gbvrl61.seq
139044745 gbvrl610.seq
499958385 gbvrl611.seq
499972426 gbvrl612.seq
499978000 gbvrl613.seq
186444737 gbvrl614.seq
499981766 gbvrl615.seq
499997395 gbvrl616.seq
499994083 gbvrl617.seq
164317108 gbvrl618.seq
499978039 gbvrl619.seq
499978157 gbvrl62.seq
499991470 gbvrl620.seq
499943021 gbvrl621.seq
280069084 gbvrl622.seq
492738925 gbvrl623.seq
499973021 gbvrl624.seq
253869488 gbvrl625.seq
76815845 gbvrl626.seq
499979979 gbvrl627.seq
499965262 gbvrl628.seq
499992805 gbvrl629.seq
499967569 gbvrl63.seq
252210177 gbvrl630.seq
499979104 gbvrl631.seq
499999809 gbvrl632.seq
499964201 gbvrl633.seq
280382976 gbvrl634.seq
499973547 gbvrl635.seq
499964780 gbvrl636.seq
499974018 gbvrl637.seq
175135386 gbvrl638.seq
499973309 gbvrl639.seq
186511929 gbvrl64.seq
499989608 gbvrl640.seq
499960757 gbvrl641.seq
147804991 gbvrl642.seq
499996522 gbvrl643.seq
499971122 gbvrl644.seq
499973686 gbvrl645.seq
259661349 gbvrl646.seq
499963274 gbvrl647.seq
499968852 gbvrl648.seq
499994020 gbvrl649.seq
499959229 gbvrl65.seq
141758832 gbvrl650.seq
499987428 gbvrl651.seq
499986183 gbvrl652.seq
499970029 gbvrl653.seq
119837707 gbvrl654.seq
146296175 gbvrl655.seq
499967013 gbvrl656.seq
499996633 gbvrl657.seq
499970769 gbvrl658.seq
126388437 gbvrl659.seq
499987884 gbvrl66.seq
499995120 gbvrl660.seq
499972873 gbvrl661.seq
499969488 gbvrl662.seq
471353671 gbvrl663.seq
499967731 gbvrl664.seq
499981503 gbvrl665.seq
499966252 gbvrl666.seq
148206664 gbvrl667.seq
499995662 gbvrl668.seq
499985048 gbvrl669.seq
499993800 gbvrl67.seq
499985400 gbvrl670.seq
363308908 gbvrl671.seq
499975349 gbvrl672.seq
499995044 gbvrl673.seq
499982421 gbvrl674.seq
499984336 gbvrl675.seq
281596540 gbvrl676.seq
499978306 gbvrl677.seq
499974491 gbvrl678.seq
499971452 gbvrl679.seq
499995138 gbvrl68.seq
499960503 gbvrl680.seq
56386242 gbvrl681.seq
499993829 gbvrl682.seq
499998290 gbvrl683.seq
499998944 gbvrl684.seq
404134109 gbvrl685.seq
499976158 gbvrl686.seq
499992691 gbvrl687.seq
499970768 gbvrl688.seq
358552958 gbvrl689.seq
154635633 gbvrl69.seq
499994976 gbvrl690.seq
499995631 gbvrl691.seq
499993106 gbvrl692.seq
247357210 gbvrl693.seq
499986293 gbvrl694.seq
499984816 gbvrl695.seq
499967239 gbvrl696.seq
314635508 gbvrl697.seq
499961396 gbvrl698.seq
499984158 gbvrl699.seq
499999229 gbvrl7.seq
499950078 gbvrl70.seq
499986788 gbvrl700.seq
288025255 gbvrl701.seq
499970230 gbvrl702.seq
499981579 gbvrl703.seq
499998615 gbvrl704.seq
285158648 gbvrl705.seq
499967026 gbvrl706.seq
499980568 gbvrl707.seq
499961738 gbvrl708.seq
291559508 gbvrl709.seq
499970728 gbvrl71.seq
499973581 gbvrl710.seq
499977906 gbvrl711.seq
499972170 gbvrl712.seq
289138070 gbvrl713.seq
499966396 gbvrl714.seq
499987226 gbvrl715.seq
499974314 gbvrl716.seq
280112559 gbvrl717.seq
499989154 gbvrl718.seq
499975570 gbvrl719.seq
499936161 gbvrl72.seq
499962760 gbvrl720.seq
499988688 gbvrl721.seq
137977402 gbvrl722.seq
499991812 gbvrl723.seq
499998884 gbvrl724.seq
499998440 gbvrl725.seq
499965827 gbvrl726.seq
78679008 gbvrl727.seq
499970339 gbvrl728.seq
499996499 gbvrl729.seq
411246285 gbvrl73.seq
499984600 gbvrl730.seq
499965087 gbvrl731.seq
98844236 gbvrl732.seq
499992259 gbvrl733.seq
499990217 gbvrl734.seq
499966023 gbvrl735.seq
118505686 gbvrl736.seq
499988359 gbvrl737.seq
499970326 gbvrl738.seq
499999323 gbvrl739.seq
499940645 gbvrl74.seq
128891738 gbvrl740.seq
499961344 gbvrl741.seq
499965246 gbvrl742.seq
499963743 gbvrl743.seq
129520828 gbvrl744.seq
499989649 gbvrl745.seq
499990091 gbvrl746.seq
499993045 gbvrl747.seq
499997622 gbvrl748.seq
154992715 gbvrl749.seq
499986060 gbvrl75.seq
499990389 gbvrl750.seq
499997500 gbvrl751.seq
499978686 gbvrl752.seq
259989341 gbvrl753.seq
499978661 gbvrl754.seq
499961935 gbvrl755.seq
499976715 gbvrl756.seq
499974967 gbvrl757.seq
315477211 gbvrl758.seq
499978445 gbvrl759.seq
499990164 gbvrl76.seq
499985683 gbvrl760.seq
499975835 gbvrl761.seq
400008726 gbvrl762.seq
499960836 gbvrl763.seq
499971777 gbvrl764.seq
499983297 gbvrl765.seq
499998600 gbvrl766.seq
499963451 gbvrl767.seq
499965104 gbvrl768.seq
128009138 gbvrl769.seq
362638423 gbvrl77.seq
499998201 gbvrl770.seq
499994429 gbvrl771.seq
499974041 gbvrl772.seq
499966031 gbvrl773.seq
499992532 gbvrl774.seq
478191694 gbvrl775.seq
499977958 gbvrl776.seq
499968023 gbvrl777.seq
500000199 gbvrl778.seq
499961570 gbvrl779.seq
499999547 gbvrl78.seq
392138866 gbvrl780.seq
499987579 gbvrl781.seq
499987807 gbvrl782.seq
499979629 gbvrl783.seq
499962956 gbvrl784.seq
81093847 gbvrl785.seq
499961952 gbvrl786.seq
499966425 gbvrl787.seq
499991821 gbvrl788.seq
499987134 gbvrl789.seq
499943451 gbvrl79.seq
499973524 gbvrl790.seq
326640176 gbvrl791.seq
499967744 gbvrl792.seq
499988602 gbvrl793.seq
499970539 gbvrl794.seq
499992754 gbvrl795.seq
368120436 gbvrl796.seq
499961814 gbvrl797.seq
499975293 gbvrl798.seq
499964890 gbvrl799.seq
499996247 gbvrl8.seq
499983928 gbvrl80.seq
499986361 gbvrl800.seq
24043791 gbvrl801.seq
499969458 gbvrl802.seq
499992114 gbvrl803.seq
499979236 gbvrl804.seq
499988026 gbvrl805.seq
22590184 gbvrl806.seq
499988892 gbvrl807.seq
499958582 gbvrl808.seq
499998891 gbvrl809.seq
326609834 gbvrl81.seq
499984766 gbvrl810.seq
46828118 gbvrl811.seq
499995703 gbvrl812.seq
499968334 gbvrl813.seq
499993852 gbvrl814.seq
499996602 gbvrl815.seq
10933612 gbvrl816.seq
499984317 gbvrl817.seq
499959785 gbvrl818.seq
499997386 gbvrl819.seq
499995550 gbvrl82.seq
242993684 gbvrl820.seq
499985905 gbvrl821.seq
499960615 gbvrl822.seq
499973456 gbvrl823.seq
499990857 gbvrl824.seq
52232764 gbvrl825.seq
499964490 gbvrl826.seq
499964464 gbvrl827.seq
500000082 gbvrl828.seq
499999836 gbvrl829.seq
499939556 gbvrl83.seq
59983696 gbvrl830.seq
499995720 gbvrl831.seq
499998218 gbvrl832.seq
499975379 gbvrl833.seq
191184922 gbvrl834.seq
499990027 gbvrl835.seq
499998072 gbvrl836.seq
499964642 gbvrl837.seq
187063445 gbvrl838.seq
499994300 gbvrl839.seq
499973290 gbvrl84.seq
499976615 gbvrl840.seq
499991093 gbvrl841.seq
194078795 gbvrl842.seq
499980969 gbvrl843.seq
499976110 gbvrl844.seq
499981568 gbvrl845.seq
223831052 gbvrl846.seq
499983048 gbvrl847.seq
499967469 gbvrl848.seq
499961975 gbvrl849.seq
45054454 gbvrl85.seq
224403955 gbvrl850.seq
499994169 gbvrl851.seq
499964420 gbvrl852.seq
499989233 gbvrl853.seq
191992835 gbvrl854.seq
499979086 gbvrl855.seq
499980339 gbvrl856.seq
499975396 gbvrl857.seq
197260979 gbvrl858.seq
499967952 gbvrl859.seq
499969614 gbvrl86.seq
499999616 gbvrl860.seq
499989909 gbvrl861.seq
499994460 gbvrl862.seq
499971439 gbvrl863.seq
210537192 gbvrl864.seq
499994396 gbvrl865.seq
499960629 gbvrl866.seq
499988409 gbvrl867.seq
373194307 gbvrl868.seq
499970312 gbvrl869.seq
499960629 gbvrl87.seq
499995829 gbvrl870.seq
499993275 gbvrl871.seq
117606948 gbvrl872.seq
499985783 gbvrl873.seq
499999955 gbvrl874.seq
499997938 gbvrl875.seq
307125894 gbvrl876.seq
499969220 gbvrl877.seq
499999878 gbvrl878.seq
499993728 gbvrl879.seq
499981955 gbvrl88.seq
499998249 gbvrl880.seq
499964927 gbvrl881.seq
499968844 gbvrl882.seq
78929220 gbvrl883.seq
499973254 gbvrl884.seq
499969713 gbvrl885.seq
499967615 gbvrl886.seq
286698002 gbvrl887.seq
499965605 gbvrl888.seq
499984803 gbvrl889.seq
185029166 gbvrl89.seq
499981918 gbvrl890.seq
499964944 gbvrl891.seq
190811873 gbvrl892.seq
499983057 gbvrl893.seq
499961583 gbvrl894.seq
499995798 gbvrl895.seq
499984248 gbvrl896.seq
148129947 gbvrl897.seq
499962549 gbvrl898.seq
499994082 gbvrl899.seq
315074389 gbvrl9.seq
499995909 gbvrl90.seq
499988751 gbvrl900.seq
499972397 gbvrl901.seq
499984666 gbvrl902.seq
1810975 gbvrl903.seq
499959094 gbvrl904.seq
499983038 gbvrl905.seq
499992901 gbvrl906.seq
422170540 gbvrl907.seq
499975132 gbvrl908.seq
499995567 gbvrl909.seq
499959805 gbvrl91.seq
499995290 gbvrl910.seq
199372111 gbvrl911.seq
499993381 gbvrl912.seq
499985259 gbvrl913.seq
499997469 gbvrl914.seq
156460575 gbvrl915.seq
499977500 gbvrl916.seq
499967878 gbvrl917.seq
499993605 gbvrl918.seq
499966067 gbvrl919.seq
499969371 gbvrl92.seq
400314761 gbvrl920.seq
499959638 gbvrl921.seq
499980583 gbvrl922.seq
499990051 gbvrl923.seq
499973318 gbvrl924.seq
344871922 gbvrl925.seq
499974503 gbvrl926.seq
499967581 gbvrl927.seq
500000188 gbvrl928.seq
266779067 gbvrl929.seq
191652367 gbvrl93.seq
499973862 gbvrl930.seq
499988498 gbvrl931.seq
499971868 gbvrl932.seq
154951226 gbvrl933.seq
499974801 gbvrl934.seq
499970831 gbvrl935.seq
499961802 gbvrl936.seq
499987483 gbvrl937.seq
499964777 gbvrl938.seq
499980832 gbvrl939.seq
499969181 gbvrl94.seq
111556145 gbvrl940.seq
499971178 gbvrl941.seq
499975894 gbvrl942.seq
499993408 gbvrl943.seq
499982950 gbvrl944.seq
499962062 gbvrl945.seq
499993473 gbvrl946.seq
110227900 gbvrl947.seq
499977953 gbvrl948.seq
499988439 gbvrl949.seq
499992681 gbvrl95.seq
499990785 gbvrl950.seq
499994288 gbvrl951.seq
499964929 gbvrl952.seq
499972152 gbvrl953.seq
166666603 gbvrl954.seq
499973060 gbvrl955.seq
499976784 gbvrl956.seq
499975843 gbvrl957.seq
499994641 gbvrl958.seq
333937173 gbvrl959.seq
499996893 gbvrl96.seq
499993852 gbvrl960.seq
499995349 gbvrl961.seq
499974111 gbvrl962.seq
499988841 gbvrl963.seq
318630320 gbvrl964.seq
499993744 gbvrl965.seq
499965435 gbvrl966.seq
499982504 gbvrl967.seq
499977584 gbvrl968.seq
481610372 gbvrl969.seq
230061486 gbvrl97.seq
499980908 gbvrl970.seq
499998043 gbvrl971.seq
499975412 gbvrl972.seq
499973714 gbvrl973.seq
48125717 gbvrl974.seq
499986783 gbvrl975.seq
499964953 gbvrl976.seq
499987753 gbvrl977.seq
153956903 gbvrl978.seq
499968881 gbvrl979.seq
499999665 gbvrl98.seq
499973548 gbvrl980.seq
499968822 gbvrl981.seq
339023301 gbvrl982.seq
499987569 gbvrl983.seq
499981580 gbvrl984.seq
499997631 gbvrl985.seq
274621927 gbvrl986.seq
499968003 gbvrl987.seq
499997675 gbvrl988.seq
499973422 gbvrl989.seq
499991887 gbvrl99.seq
433047614 gbvrl990.seq
499991709 gbvrl991.seq
499994035 gbvrl992.seq
499989400 gbvrl993.seq
499984662 gbvrl994.seq
83227542 gbvrl995.seq
499972476 gbvrl996.seq
499968472 gbvrl997.seq
499987567 gbvrl998.seq
499964280 gbvrl999.seq
499926421 gbvrt1.seq
290137512 gbvrt10.seq
418722221 gbvrt100.seq
186091499 gbvrt101.seq
404212771 gbvrt102.seq
481131818 gbvrt103.seq
474827268 gbvrt104.seq
480710663 gbvrt105.seq
89576281 gbvrt106.seq
435880707 gbvrt107.seq
487966706 gbvrt108.seq
497561524 gbvrt109.seq
87351606 gbvrt11.seq
468911725 gbvrt110.seq
1063697373 gbvrt111.seq
1045817456 gbvrt112.seq
754876698 gbvrt113.seq
616753988 gbvrt114.seq
490283916 gbvrt115.seq
470651151 gbvrt116.seq
397152890 gbvrt117.seq
351566814 gbvrt118.seq
339881554 gbvrt119.seq
499803371 gbvrt12.seq
404716166 gbvrt120.seq
489465929 gbvrt121.seq
499108511 gbvrt122.seq
486719349 gbvrt123.seq
58362562 gbvrt124.seq
436489699 gbvrt125.seq
486735687 gbvrt126.seq
492786702 gbvrt127.seq
424170309 gbvrt128.seq
281367593 gbvrt129.seq
284674796 gbvrt13.seq
478264522 gbvrt130.seq
485840122 gbvrt131.seq
493662272 gbvrt132.seq
75046811 gbvrt133.seq
979125221 gbvrt134.seq
838606764 gbvrt135.seq
678362247 gbvrt136.seq
476490051 gbvrt137.seq
461393141 gbvrt138.seq
438814149 gbvrt139.seq
15637437 gbvrt14.seq
394334276 gbvrt140.seq
313818221 gbvrt141.seq
288999697 gbvrt142.seq
280186115 gbvrt143.seq
407765043 gbvrt144.seq
421853258 gbvrt145.seq
478932645 gbvrt146.seq
480028007 gbvrt147.seq
438022009 gbvrt148.seq
174441466 gbvrt149.seq
36035214 gbvrt15.seq
487902327 gbvrt150.seq
456814552 gbvrt151.seq
462308829 gbvrt152.seq
168813991 gbvrt153.seq
455915969 gbvrt154.seq
469542169 gbvrt155.seq
479148432 gbvrt156.seq
211438035 gbvrt157.seq
481255007 gbvrt158.seq
475910680 gbvrt159.seq
18509260 gbvrt16.seq
366785231 gbvrt160.seq
464881586 gbvrt161.seq
474452025 gbvrt162.seq
234874130 gbvrt163.seq
697335450 gbvrt164.seq
670835803 gbvrt165.seq
524090553 gbvrt166.seq
413420126 gbvrt167.seq
345317144 gbvrt168.seq
329841089 gbvrt169.seq
497676963 gbvrt17.seq
250750417 gbvrt170.seq
486600390 gbvrt171.seq
364885711 gbvrt172.seq
448395879 gbvrt173.seq
471877569 gbvrt174.seq
393642536 gbvrt175.seq
355134416 gbvrt176.seq
470602746 gbvrt177.seq
448657488 gbvrt178.seq
384724558 gbvrt179.seq
497173924 gbvrt18.seq
432320923 gbvrt180.seq
471132362 gbvrt181.seq
497676594 gbvrt182.seq
207882210 gbvrt183.seq
397267013 gbvrt184.seq
366771863 gbvrt185.seq
351249970 gbvrt186.seq
309532358 gbvrt187.seq
296271444 gbvrt188.seq
286321426 gbvrt189.seq
481350583 gbvrt19.seq
268164730 gbvrt190.seq
253329800 gbvrt191.seq
494939336 gbvrt192.seq
424426418 gbvrt193.seq
410896883 gbvrt194.seq
369957025 gbvrt195.seq
169574120 gbvrt196.seq
426847158 gbvrt197.seq
496824472 gbvrt198.seq
434394575 gbvrt199.seq
499837305 gbvrt2.seq
400795564 gbvrt20.seq
494362940 gbvrt200.seq
61896390 gbvrt201.seq
431425030 gbvrt202.seq
474666078 gbvrt203.seq
479195533 gbvrt204.seq
352877912 gbvrt205.seq
479777961 gbvrt206.seq
497464627 gbvrt207.seq
432868094 gbvrt208.seq
439843808 gbvrt209.seq
488197715 gbvrt21.seq
469531790 gbvrt210.seq
496015817 gbvrt211.seq
488626307 gbvrt212.seq
432135676 gbvrt213.seq
70119528 gbvrt214.seq
491056051 gbvrt215.seq
328508705 gbvrt216.seq
497328806 gbvrt217.seq
499238966 gbvrt218.seq
187508760 gbvrt219.seq
479291185 gbvrt22.seq
490842556 gbvrt220.seq
463385772 gbvrt221.seq
446788975 gbvrt222.seq
438416202 gbvrt223.seq
170595769 gbvrt224.seq
451342688 gbvrt225.seq
474563355 gbvrt226.seq
461335548 gbvrt227.seq
436658187 gbvrt228.seq
154682616 gbvrt229.seq
480798341 gbvrt23.seq
456837606 gbvrt230.seq
488930196 gbvrt231.seq
466502331 gbvrt232.seq
455725140 gbvrt233.seq
453475816 gbvrt234.seq
462276007 gbvrt235.seq
497473221 gbvrt236.seq
499283767 gbvrt237.seq
481742871 gbvrt238.seq
54779872 gbvrt239.seq
499274582 gbvrt24.seq
477445338 gbvrt240.seq
495314530 gbvrt241.seq
486008997 gbvrt242.seq
489201368 gbvrt243.seq
499536480 gbvrt244.seq
347470388 gbvrt245.seq
1068402516 gbvrt246.seq
1067356333 gbvrt247.seq
896844819 gbvrt248.seq
805318347 gbvrt249.seq
483255310 gbvrt25.seq
718662677 gbvrt250.seq
556944666 gbvrt251.seq
299728838 gbvrt252.seq
293507186 gbvrt253.seq
484357811 gbvrt254.seq
130768604 gbvrt255.seq
874873715 gbvrt256.seq
685858825 gbvrt257.seq
627564227 gbvrt258.seq
610271897 gbvrt259.seq
484154141 gbvrt26.seq
543871783 gbvrt260.seq
284797667 gbvrt261.seq
269299175 gbvrt262.seq
474717664 gbvrt263.seq
402979396 gbvrt264.seq
343325815 gbvrt265.seq
450550965 gbvrt266.seq
494368803 gbvrt267.seq
470723064 gbvrt268.seq
470514883 gbvrt269.seq
65325644 gbvrt27.seq
229726831 gbvrt270.seq
499999671 gbvrt271.seq
499997161 gbvrt272.seq
499998926 gbvrt273.seq
18837922 gbvrt274.seq
499997248 gbvrt275.seq
499989867 gbvrt276.seq
499999275 gbvrt277.seq
124759518 gbvrt278.seq
445682876 gbvrt279.seq
437233554 gbvrt28.seq
474231618 gbvrt280.seq
490948606 gbvrt281.seq
332589082 gbvrt282.seq
477156039 gbvrt283.seq
499226352 gbvrt284.seq
477696169 gbvrt285.seq
353039605 gbvrt286.seq
438196164 gbvrt287.seq
489809255 gbvrt288.seq
460938782 gbvrt289.seq
488520688 gbvrt29.seq
425935803 gbvrt290.seq
463058640 gbvrt291.seq
486385420 gbvrt292.seq
437842391 gbvrt293.seq
440417012 gbvrt294.seq
475637321 gbvrt295.seq
477247535 gbvrt296.seq
464765084 gbvrt297.seq
442158629 gbvrt298.seq
490038950 gbvrt299.seq
467954750 gbvrt3.seq
456456384 gbvrt30.seq
437760826 gbvrt300.seq
442760644 gbvrt301.seq
386023782 gbvrt302.seq
474714280 gbvrt303.seq
485233797 gbvrt304.seq
481701496 gbvrt305.seq
437638720 gbvrt306.seq
484571077 gbvrt307.seq
497401344 gbvrt308.seq
473482376 gbvrt309.seq
337132552 gbvrt31.seq
467112365 gbvrt310.seq
171814162 gbvrt311.seq
85205330 gbvrt312.seq
671198197 gbvrt313.seq
590897252 gbvrt314.seq
569239246 gbvrt315.seq
521483379 gbvrt316.seq
518191557 gbvrt317.seq
413907798 gbvrt318.seq
491950349 gbvrt319.seq
446089299 gbvrt32.seq
443427082 gbvrt320.seq
399672190 gbvrt321.seq
288063541 gbvrt322.seq
447682143 gbvrt323.seq
458968414 gbvrt324.seq
489671978 gbvrt325.seq
498333218 gbvrt326.seq
249806054 gbvrt327.seq
449206571 gbvrt328.seq
492547884 gbvrt329.seq
379213975 gbvrt33.seq
481880513 gbvrt330.seq
498774154 gbvrt331.seq
111733219 gbvrt332.seq
436873334 gbvrt333.seq
440148969 gbvrt334.seq
482571941 gbvrt335.seq
484107234 gbvrt336.seq
52095057 gbvrt337.seq
470800028 gbvrt338.seq
472090268 gbvrt339.seq
458139031 gbvrt34.seq
484740940 gbvrt340.seq
476579517 gbvrt341.seq
487431970 gbvrt342.seq
391563647 gbvrt343.seq
455738434 gbvrt344.seq
373020280 gbvrt345.seq
430677277 gbvrt346.seq
493479067 gbvrt347.seq
489511330 gbvrt348.seq
496625891 gbvrt349.seq
111157660 gbvrt35.seq
496023577 gbvrt350.seq
483316423 gbvrt351.seq
455697611 gbvrt352.seq
463738379 gbvrt353.seq
476553580 gbvrt354.seq
382729569 gbvrt355.seq
388762659 gbvrt356.seq
162516535 gbvrt357.seq
364042246 gbvrt358.seq
406118404 gbvrt359.seq
402140937 gbvrt36.seq
490080005 gbvrt360.seq
499117150 gbvrt361.seq
496745927 gbvrt362.seq
114457470 gbvrt363.seq
483642213 gbvrt364.seq
486499113 gbvrt365.seq
480199921 gbvrt366.seq
449130925 gbvrt367.seq
493582352 gbvrt368.seq
455855740 gbvrt369.seq
345094744 gbvrt37.seq
496938106 gbvrt370.seq
445299021 gbvrt371.seq
488289465 gbvrt372.seq
456295928 gbvrt373.seq
491344127 gbvrt374.seq
433632055 gbvrt375.seq
461359229 gbvrt376.seq
352990890 gbvrt377.seq
486129256 gbvrt378.seq
433069569 gbvrt379.seq
499274310 gbvrt38.seq
468000100 gbvrt380.seq
213511428 gbvrt381.seq
464521429 gbvrt382.seq
484103168 gbvrt383.seq
469113528 gbvrt384.seq
441506917 gbvrt385.seq
388757745 gbvrt386.seq
491752782 gbvrt387.seq
465458984 gbvrt388.seq
463577414 gbvrt389.seq
359197842 gbvrt39.seq
475333006 gbvrt390.seq
32860891 gbvrt391.seq
448180683 gbvrt392.seq
468563387 gbvrt393.seq
487321652 gbvrt394.seq
466578054 gbvrt395.seq
479179652 gbvrt396.seq
463026596 gbvrt397.seq
420071062 gbvrt398.seq
457719226 gbvrt399.seq
179100370 gbvrt4.seq
495493755 gbvrt40.seq
490464485 gbvrt400.seq
443384835 gbvrt401.seq
462824598 gbvrt402.seq
334830757 gbvrt403.seq
476386342 gbvrt404.seq
491788802 gbvrt405.seq
450398569 gbvrt406.seq
454795466 gbvrt407.seq
469602269 gbvrt408.seq
452609759 gbvrt409.seq
478307083 gbvrt41.seq
497531511 gbvrt410.seq
437442433 gbvrt411.seq
342108062 gbvrt412.seq
427821552 gbvrt413.seq
472175035 gbvrt414.seq
474308742 gbvrt415.seq
115706604 gbvrt416.seq
462970947 gbvrt417.seq
483824917 gbvrt418.seq
480993826 gbvrt419.seq
479569827 gbvrt42.seq
425541655 gbvrt420.seq
482200158 gbvrt421.seq
494081566 gbvrt422.seq
405268917 gbvrt423.seq
462160991 gbvrt424.seq
99044719 gbvrt425.seq
495727890 gbvrt426.seq
499457203 gbvrt427.seq
496827401 gbvrt428.seq
495182596 gbvrt429.seq
499582791 gbvrt43.seq
157867363 gbvrt430.seq
474797238 gbvrt431.seq
439268361 gbvrt432.seq
419636722 gbvrt433.seq
471975427 gbvrt434.seq
294229625 gbvrt435.seq
418033300 gbvrt436.seq
453670883 gbvrt437.seq
492403889 gbvrt438.seq
439486134 gbvrt439.seq
486190602 gbvrt44.seq
438375278 gbvrt440.seq
477518353 gbvrt441.seq
490480491 gbvrt442.seq
480679107 gbvrt443.seq
492157733 gbvrt444.seq
199437741 gbvrt445.seq
478924327 gbvrt446.seq
438315028 gbvrt447.seq
439741604 gbvrt448.seq
461529329 gbvrt449.seq
267175695 gbvrt45.seq
488438312 gbvrt450.seq
103295169 gbvrt451.seq
483017127 gbvrt452.seq
466200874 gbvrt453.seq
411265058 gbvrt454.seq
486575674 gbvrt455.seq
297876207 gbvrt456.seq
429098988 gbvrt457.seq
438830218 gbvrt458.seq
481726385 gbvrt459.seq
14152653 gbvrt46.seq
485911064 gbvrt460.seq
435037055 gbvrt461.seq
493235159 gbvrt462.seq
482533224 gbvrt463.seq
124789632 gbvrt464.seq
323032683 gbvrt465.seq
369600226 gbvrt466.seq
457093781 gbvrt467.seq
436813210 gbvrt468.seq
496330530 gbvrt469.seq
21384662 gbvrt47.seq
495693233 gbvrt470.seq
466752026 gbvrt471.seq
199939234 gbvrt472.seq
480396248 gbvrt473.seq
461404102 gbvrt474.seq
489903935 gbvrt475.seq
388326134 gbvrt476.seq
442642585 gbvrt477.seq
169256572 gbvrt478.seq
440392633 gbvrt479.seq
90973101 gbvrt48.seq
432958380 gbvrt480.seq
462429871 gbvrt481.seq
434207860 gbvrt482.seq
452119370 gbvrt483.seq
247980402 gbvrt484.seq
499951059 gbvrt49.seq
448778544 gbvrt5.seq
499998959 gbvrt50.seq
499999488 gbvrt51.seq
55937633 gbvrt52.seq
499998355 gbvrt53.seq
270377649 gbvrt54.seq
500000211 gbvrt55.seq
121291825 gbvrt56.seq
499999198 gbvrt57.seq
448469288 gbvrt58.seq
499997355 gbvrt59.seq
490703641 gbvrt6.seq
29160938 gbvrt60.seq
444263099 gbvrt61.seq
499999021 gbvrt62.seq
388880510 gbvrt63.seq
499997496 gbvrt64.seq
280117336 gbvrt65.seq
499997870 gbvrt66.seq
500000033 gbvrt67.seq
491274442 gbvrt68.seq
499630950 gbvrt69.seq
499120716 gbvrt7.seq
499990415 gbvrt70.seq
462471618 gbvrt71.seq
202128841 gbvrt72.seq
123737443 gbvrt73.seq
483315318 gbvrt74.seq
481925744 gbvrt75.seq
499146212 gbvrt76.seq
499983703 gbvrt77.seq
297372571 gbvrt78.seq
492211550 gbvrt79.seq
483704557 gbvrt8.seq
492375887 gbvrt80.seq
479677491 gbvrt81.seq
480814553 gbvrt82.seq
362168611 gbvrt83.seq
487931186 gbvrt84.seq
465950606 gbvrt85.seq
489430322 gbvrt86.seq
352376679 gbvrt87.seq
465372186 gbvrt88.seq
488788789 gbvrt89.seq
263807195 gbvrt9.seq
189348250 gbvrt90.seq
451948482 gbvrt91.seq
443703248 gbvrt92.seq
400719178 gbvrt93.seq
427517644 gbvrt94.seq
319264824 gbvrt95.seq
275756309 gbvrt96.seq
252640763 gbvrt97.seq
251496345 gbvrt98.seq
466369516 gbvrt99.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 102014 184376369
BCT10 102 246510870
BCT100 45 210864282
BCT100 515 239197049
BCT100 1741 221923984
BCT100 11 22317190
BCT100 86 222746849
BCT100 78 227354684
BCT100 3023 245927078
BCT100 1230 124242115
BCT100 1412 261424764
BCT100 47 241352896
BCT100 45 243003094
BCT101 45 212727898
BCT101 2180 269716913
BCT101 945 54278114
BCT101 2284 261463112
BCT101 87 288890299
BCT101 417 278222635
BCT101 3023 263078339
BCT101 11940 19905115
BCT101 25214 42009480
BCT101 118295 188753564
BCT101 115183 191770135
BCT102 76 222861078
BCT102 91845 166416633
BCT102 97698 200784599
BCT102 119656 192955776
BCT102 55088 295544386
BCT102 122365 202389743
BCT102 70739 268197689
BCT102 640 85747921
BCT102 358 274616850
BCT102 156 207619882
BCT102 208 205768159
BCT103 40 115080869
BCT103 197 205113543
BCT103 200 205637754
BCT103 173 202326691
BCT103 45 60784238
BCT103 179 205883676
BCT103 202 206537177
BCT103 226 205678653
BCT103 173 206520918
BCT103 37 50683886
BCT103 237 205937725
BCT104 112 227959956
BCT104 326 220433021
BCT104 258 227572011
BCT104 901 291037816
BCT104 190 265293031
BCT104 19380 272066450
BCT104 5460 10133324
BCT105 129 231316827
BCT106 99 245428056
BCT107 87 223381451
BCT108 59 181990919
BCT109 93 237302287
BCT11 143 242657671
BCT110 103 223843089
BCT111 62 225168570
BCT112 64 140507059
BCT113 89 229551845
BCT114 90 230404163
BCT115 99 240991650
BCT116 27 42382325
BCT117 94 226656782
BCT118 118 229172914
BCT119 127 232212861
BCT12 168 262541373
BCT120 90 178403076
BCT121 114 212138354
BCT122 76 223040870
BCT123 111 225956545
BCT124 125 221492878
BCT125 4 6013748
BCT126 246 222256023
BCT127 104 221252195
BCT128 100 224644129
BCT129 83 222703364
BCT13 8 14890521
BCT130 21 86233168
BCT131 68 221578114
BCT132 87 219795809
BCT133 87 223588406
BCT134 80 226303150
BCT135 20 45564131
BCT136 124 217933644
BCT137 53 217706139
BCT138 90 227492926
BCT139 57 149506400
BCT14 165 232257568
BCT140 94 223837173
BCT141 73 221711999
BCT142 122 215811464
BCT143 80 227727095
BCT144 8 8657925
BCT145 159 220206896
BCT146 84 220629983
BCT147 79 216070642
BCT148 141 227102717
BCT149 107 224394264
BCT15 150 236302365
BCT150 80 221199213
BCT151 92 196245950
BCT152 115 225967887
BCT153 92 220409897
BCT154 158 214217907
BCT155 88 207032597
BCT156 140 220978157
BCT157 63 217844098
BCT158 90 215013764
BCT159 125 217101319
BCT16 187 250598312
BCT160 88 223616604
BCT161 21 65066945
BCT162 174 220602866
BCT163 128 221993348
BCT164 118 216449560
BCT165 170 220678969
BCT166 54 177570665
BCT167 104 218683705
BCT168 113 217389079
BCT169 151 218678288
BCT17 219 231641963
BCT170 108 219330740
BCT171 112 226939239
BCT172 130 201487093
BCT173 94 226698129
BCT174 104 222093509
BCT175 93 221389007
BCT176 125 221012882
BCT177 94 220173020
BCT178 135 221682180
BCT179 48 89786798
BCT18 31 58194184
BCT180 162 220699377
BCT181 100 223727909
BCT182 96 223995439
BCT183 95 219439398
BCT184 71 223304376
BCT185 129 228001663
BCT186 150 229208112
BCT187 77 216466477
BCT188 11 10188678
BCT189 100 233591727
BCT19 135 235079883
BCT190 96 224680213
BCT191 133 222280876
BCT192 85 221811199
BCT193 26 92438538
BCT194 119 222185746
BCT195 151 231715107
BCT196 72 216080650
BCT197 81 120955479
BCT198 111 216184725
BCT199 156 227708035
BCT2 106 226805638
BCT20 131 231843219
BCT200 111 220250972
BCT201 89 136614524
BCT202 133 229717687
BCT203 109 213797140
BCT204 111 220064957
BCT205 77 222877345
BCT206 19 34014599
BCT207 98 220152536
BCT208 132 227699493
BCT209 126 229823053
BCT21 109 220733955
BCT210 115 247492878
BCT211 116 229072476
BCT212 35 100612124
BCT213 131 216438017
BCT214 93 226438829
BCT215 108 224089005
BCT216 116 221458112
BCT217 65 122261042
BCT218 127 225144984
BCT219 137 258852104
BCT22 212 222430645
BCT220 100 226684234
BCT221 159 219265722
BCT222 71 116660995
BCT223 123 222422665
BCT224 115 218469346
BCT225 89 219209021
BCT226 103 229936404
BCT227 104 209481600
BCT228 104 234499310
BCT229 94 222201735
BCT23 50 66104168
BCT230 95 222593575
BCT231 105 225137188
BCT232 98 229933616
BCT233 106 224550172
BCT234 90 192942285
BCT235 104 221826114
BCT236 108 221051727
BCT237 98 226007841
BCT238 76 270744187
BCT239 75 254647899
BCT24 174 220036188
BCT240 101 225874656
BCT241 178 218571314
BCT242 132 228118798
BCT243 58 111799670
BCT244 303 275292038
BCT245 119 219435892
BCT246 114 219246925
BCT247 53 88783408
BCT248 89 220099828
BCT249 87 228427298
BCT25 157 217996559
BCT250 82 236651858
BCT251 106 224032415
BCT252 39 81227217
BCT253 60 216868170
BCT254 120 221119124
BCT255 86 223426276
BCT256 85 217663772
BCT257 31 72411893
BCT258 157 275025230
BCT259 82 232627723
BCT26 52 221902715
BCT260 84 220566907
BCT261 144 212385076
BCT262 20 28670539
BCT263 109 262921422
BCT264 72 217635148
BCT265 100 214909619
BCT266 79 210171996
BCT267 143 306547296
BCT268 72 239204396
BCT269 88 216728836
BCT27 110 224934926
BCT270 131 224161084
BCT271 140 264048514
BCT272 50 101444202
BCT273 146 273570514
BCT274 114 257004034
BCT275 35 229012536
BCT276 60 215899496
BCT277 112 219135997
BCT278 126 219604182
BCT279 95 249332001
BCT28 204 233470802
BCT280 78 222741730
BCT281 14 34821419
BCT282 124 215159011
BCT283 98 220607386
BCT284 65 210721442
BCT285 137 230450043
BCT286 114 227067240
BCT287 109 229190301
BCT288 88 225088899
BCT289 80 141524915
BCT29 3 27676824
BCT290 106 218843831
BCT291 82 215186387
BCT292 95 234056453
BCT293 98 187209491
BCT294 93 235647841
BCT295 104 235928514
BCT296 69 223063860
BCT297 105 213470710
BCT298 119 216777827
BCT299 166 226651969
BCT3 37542 125814925
BCT30 83 236556551
BCT300 161 212763762
BCT301 157 238023030
BCT302 8 17431560
BCT303 101 230275411
BCT304 119 225277295
BCT305 156 250483403
BCT306 117 235914627
BCT307 10 46450140
BCT308 123 226718502
BCT309 112 212578426
BCT31 96 221838262
BCT310 91 227407856
BCT311 111 218543332
BCT312 153 221137906
BCT313 155 212286893
BCT314 119 183827081
BCT315 127 225491526
BCT316 106 222744013
BCT317 83 218273834
BCT318 70 215964942
BCT319 123 196813336
BCT32 96 219800168
BCT320 87 241506031
BCT321 110 227851319
BCT322 82 219259803
BCT323 52 214399303
BCT324 90 197873444
BCT325 113 220728285
BCT326 129 231228144
BCT327 125 212458214
BCT328 94 219289732
BCT329 148 223216642
BCT33 117 236937870
BCT330 3 10254404
BCT331 124 248813935
BCT332 110 222498371
BCT333 82 228432498
BCT334 61 221300332
BCT335 89 186031355
BCT336 128 238885544
BCT337 201 232731845
BCT338 144 217080977
BCT339 134 215029591
BCT34 50 70336694
BCT340 118 217111970
BCT341 41 76975466
BCT342 139 245503240
BCT343 169 279754521
BCT344 165 215010867
BCT345 135 218768734
BCT346 19 125140083
BCT347 72 229560250
BCT348 126 238154065
BCT349 742 221695520
BCT35 83 218320760
BCT350 398 217882477
BCT351 95 232152237
BCT352 6 15239951
BCT353 115 224523179
BCT354 120 214271004
BCT355 102 211428284
BCT356 127 217681230
BCT357 188 233278336
BCT358 230 225229102
BCT359 129 223160743
BCT36 114 237396740
BCT360 75 164588533
BCT361 136 222929134
BCT362 146 220643724
BCT363 142 217749525
BCT364 131 229168171
BCT365 145 233120869
BCT366 97 238465297
BCT367 59 129171418
BCT368 113 227348795
BCT369 143 228415697
BCT37 78 221036502
BCT370 133 230301712
BCT371 143 217809476
BCT372 84 228448881
BCT373 13 27883457
BCT374 130 230534195
BCT375 120 226303849
BCT376 77 223089727
BCT377 90 220325038
BCT378 58 219031718
BCT379 50 220953317
BCT38 152 233575208
BCT380 132 225967417
BCT381 48 19128392
BCT382 200 233036939
BCT383 127 252087880
BCT384 114 227136753
BCT385 215 225277178
BCT386 74 105630813
BCT387 90 239192530
BCT388 114 247991308
BCT389 46 214210162
BCT39 134 203809854
BCT390 53 216377196
BCT391 19 73275105
BCT392 128 213375994
BCT393 113 228373833
BCT394 72 224187533
BCT395 133 247411727
BCT396 182 232684152
BCT397 114 216401796
BCT398 110 214834558
BCT399 62 126238712
BCT4 41290 139250707
BCT40 162 235716785
BCT400 184 265248059
BCT401 184 238017458
BCT402 469 227648052
BCT403 123 230691656
BCT404 160 240032463
BCT405 104 233630145
BCT406 110 215297540
BCT407 109 230735808
BCT408 84 216238233
BCT409 94 218004732
BCT41 163 291534255
BCT410 102 226314622
BCT411 155 220876767
BCT412 68 123957640
BCT413 89 221294643
BCT414 108 228032164
BCT415 120 225520882
BCT416 153 335842367
BCT417 110 218250059
BCT418 101 285163697
BCT419 55 131018393
BCT42 102 224594658
BCT420 116 223524149
BCT421 153 221386449
BCT422 99 215448259
BCT423 94 224434864
BCT424 157 223587766
BCT425 118 230273588
BCT426 119 221798255
BCT427 82 94432839
BCT428 122 226585208
BCT429 153 219365274
BCT43 128 231164362
BCT430 149 229541054
BCT431 159 230173281
BCT432 131 218220461
BCT433 21 41744019
BCT434 129 231508633
BCT435 141 220573282
BCT436 141 220438911
BCT437 101 217783001
BCT438 94 221873764
BCT439 108 231480669
BCT44 28 51874352
BCT440 119 234050616
BCT441 100 313072351
BCT442 88 215834731
BCT443 101 137773450
BCT444 123 217943213
BCT445 125 223387893
BCT446 93 216431058
BCT447 101 256544346
BCT448 67 188984278
BCT449 118 212264610
BCT45 164 221117526
BCT450 113 224096535
BCT451 111 221803154
BCT452 115 211305566
BCT453 43 81514768
BCT454 144 219919128
BCT455 104 251665529
BCT456 156 212575427
BCT457 159 212139624
BCT458 12 11443917
BCT459 238 214458452
BCT46 182 226510942
BCT460 129 214250986
BCT461 99 218510804
BCT462 117 230291203
BCT463 123 262063092
BCT464 78 178549235
BCT465 103 236047200
BCT466 127 236790346
BCT467 131 219550029
BCT468 104 228221181
BCT469 91 216460991
BCT47 249 222464459
BCT470 53 217868736
BCT471 81 148217592
BCT472 165 216872086
BCT473 119 219438729
BCT474 114 229553940
BCT475 134 213504721
BCT476 11 41867039
BCT477 78 220992704
BCT478 139 212603090
BCT479 157 216271864
BCT48 138 188825985
BCT480 317 213898340
BCT481 364 210657095
BCT482 117 212804246
BCT483 134 211491923
BCT484 150 212215499
BCT485 174 222080619
BCT486 168 211415286
BCT487 49 74787780
BCT488 161 208257957
BCT489 162 212193463
BCT49 120 223338641
BCT490 114 210605338
BCT491 157 213126972
BCT492 132 209356669
BCT493 131 195243107
BCT494 183 210687290
BCT495 116 210811583
BCT496 136 211510245
BCT497 167 220748430
BCT498 55 112883059
BCT499 156 239757304
BCT5 20642 162919204
BCT50 142 230822034
BCT500 132 228642948
BCT501 212 229686477
BCT502 114 221407292
BCT503 13 30166462
BCT504 112 230828773
BCT505 126 221442497
BCT506 130 232586607
BCT507 108 232367088
BCT508 114 88624884
BCT509 107 232838404
BCT51 129 226320491
BCT510 96 224202359
BCT511 110 224180420
BCT512 69 230451487
BCT513 119 247887479
BCT514 111 267612902
BCT515 71 144393115
BCT516 184 216765022
BCT517 123 232248162
BCT518 132 222732283
BCT519 118 215196560
BCT52 150 220302048
BCT520 193 220065332
BCT521 123 225435430
BCT522 141 225643357
BCT523 2 9711339
BCT524 90 256897498
BCT525 142 214248519
BCT526 96 214226027
BCT527 155 215359968
BCT528 29 57789619
BCT529 140 218732960
BCT53 87 219806516
BCT530 109 225107446
BCT531 89 216531385
BCT532 169 225245387
BCT533 83 69720141
BCT534 157 237479776
BCT535 137 340179435
BCT536 129 246757216
BCT537 188 271554474
BCT538 127 219640401
BCT539 70 232305542
BCT54 91 222909225
BCT540 113 219878224
BCT541 29 90299175
BCT542 119 220313347
BCT543 89 220615423
BCT544 91 230065071
BCT545 117 224365217
BCT546 116 216182878
BCT547 149 220134009
BCT548 15 22174228
BCT549 125 216431578
BCT55 490 154911302
BCT550 139 217127904
BCT551 127 231713695
BCT552 120 216867760
BCT553 285 221512732
BCT554 63 80282166
BCT555 139 228155956
BCT556 96 240199682
BCT557 86 218203266
BCT558 170 210933694
BCT559 134 217729188
BCT56 5200 7533877
BCT560 175 209625406
BCT561 79 96733079
BCT562 156 208447709
BCT563 127 240984651
BCT564 128 222248609
BCT565 160 221935754
BCT566 95 150336580
BCT567 160 225500184
BCT568 50 213452168
BCT569 230 254160025
BCT57 10402 13141863
BCT570 132 234547809
BCT571 90 221019009
BCT572 128 191258602
BCT573 153 215988330
BCT574 126 276622167
BCT575 205 209499795
BCT576 142 249238352
BCT577 98 257053887
BCT578 10 28305238
BCT579 126 229584098
BCT58 53921 202024569
BCT580 140 225797801
BCT581 146 228175936
BCT582 98 220515926
BCT583 96 219200729
BCT584 14 36127315
BCT585 123 221651394
BCT586 130 226062430
BCT587 103 221052628
BCT588 100 222269888
BCT589 94 218107342
BCT59 185 208765651
BCT590 125 230964292
BCT591 48 128546625
BCT592 128 228496151
BCT593 146 223925807
BCT594 166 215804467
BCT595 151 224697554
BCT596 117 221724909
BCT597 112 194039034
BCT598 206 242745918
BCT599 115 230743055
BCT6 2600 37759883
BCT60 101 231004346
BCT600 183 208573489
BCT601 96 221504128
BCT602 73 229935992
BCT603 163 214524829
BCT604 156 178907953
BCT605 116 219456772
BCT606 62 209085404
BCT607 57 210359709
BCT608 92 227600991
BCT609 168 213402623
BCT61 122 221744163
BCT610 50 155752781
BCT611 83 216352839
BCT612 94 212393257
BCT613 158 239142521
BCT614 198 292195202
BCT615 71 137520829
BCT616 134 222118709
BCT617 42 214577135
BCT618 37 214639852
BCT619 169 234699017
BCT62 105 223658793
BCT620 64 148941997
BCT621 93 213934681
BCT622 94 215092310
BCT623 111 223110357
BCT624 144 220055980
BCT625 97 219628619
BCT626 116 214575844
BCT627 92 213611278
BCT628 96 111301995
BCT629 125 221173811
BCT63 132 225901521
BCT630 105 243553672
BCT631 112 219526221
BCT632 116 225797430
BCT633 126 230802156
BCT634 98 351154002
BCT635 136 383849965
BCT636 91 317300604
BCT637 170 225029563
BCT638 149 219841110
BCT639 146 231629710
BCT64 121 221767226
BCT640 121 274279377
BCT641 82 80855366
BCT642 117 217993852
BCT643 101 220308758
BCT644 85 219851191
BCT645 176 273793462
BCT646 12 37505206
BCT647 166 225544876
BCT648 148 232388729
BCT649 122 215093873
BCT65 143 222824414
BCT650 313 216930339
BCT651 100 219463728
BCT652 11 23786760
BCT653 153 253634546
BCT654 116 228188490
BCT655 116 216124769
BCT656 147 216105979
BCT657 130 209963367
BCT658 43 65651458
BCT659 113 206842483
BCT66 144 225008783
BCT660 112 219246720
BCT661 177 210384578
BCT662 138 220364043
BCT663 68 39649748
BCT664 137 242501423
BCT665 146 212177855
BCT666 99 226813904
BCT667 184 224843837
BCT668 81 195236495
BCT669 189 243551574
BCT67 132 146571992
BCT670 134 226438869
BCT671 117 224143649
BCT672 97 216124505
BCT673 92 105994657
BCT674 125 218988791
BCT675 143 245814903
BCT676 192 225512710
BCT677 48 211639657
BCT678 57 213979570
BCT679 93 187672950
BCT68 255 227294457
BCT680 85 213343638
BCT681 121 216390365
BCT682 84 218626001
BCT683 84 234501343
BCT684 86 194623312
BCT685 170 215443584
BCT686 145 219530550
BCT687 327 213392641
BCT688 58 214355238
BCT689 83 230013920
BCT69 86 220119558
BCT690 175 247617354
BCT691 155 225734536
BCT692 19 53083384
BCT693 73 212371616
BCT694 92 217821699
BCT695 106 223435480
BCT696 140 207591800
BCT697 138 210023829
BCT698 34 63064456
BCT699 142 206612759
BCT7 1310 133308362
BCT70 113 224688543
BCT700 117 213883354
BCT701 136 219396034
BCT702 80 217057439
BCT703 97 179738098
BCT704 122 220472990
BCT705 85 241011219
BCT706 106 226130274
BCT707 147 218319286
BCT708 102 210742911
BCT709 123 229109402
BCT71 128 222273877
BCT710 68 124914102
BCT711 104 223025233
BCT712 106 217782989
BCT713 123 226271822
BCT714 137 243256026
BCT715 53 88148326
BCT716 107 217566484
BCT717 74 218950444
BCT718 120 225051478
BCT719 145 214500516
BCT72 135 219988879
BCT720 88 111987983
BCT721 86 213573894
BCT722 130 217540925
BCT723 123 210871336
BCT724 171 239325822
BCT725 118 223254380
BCT726 118 212792592
BCT727 59 98012374
BCT728 88 208008157
BCT729 72 217592870
BCT73 111 162805198
BCT730 75 215572501
BCT731 170 208410267
BCT732 88 214362512
BCT733 85 183148077
BCT734 150 220495306
BCT735 74 209792743
BCT736 67 208772721
BCT737 169 212721867
BCT738 56 116045619
BCT739 127 218573367
BCT74 136 223054995
BCT740 152 218178207
BCT741 124 208139762
BCT742 147 218716826
BCT743 57 107102767
BCT744 143 232831805
BCT745 167 218748651
BCT746 262 219114964
BCT747 93 238194838
BCT748 132 210704841
BCT749 86 158084866
BCT75 112 217399067
BCT750 99 206684971
BCT751 98 210825210
BCT752 82 210376022
BCT753 150 216788200
BCT754 115 218211256
BCT755 100 213353437
BCT756 108 205648079
BCT757 8 32296581
BCT758 128 230171908
BCT759 109 220940165
BCT76 131 223635367
BCT760 122 210197947
BCT761 124 203730251
BCT762 135 208376116
BCT763 110 200379906
BCT764 123 211751375
BCT765 133 205963114
BCT766 123 199946665
BCT767 109 202839658
BCT768 105 200392301
BCT769 46 59924951
BCT77 121 221481204
BCT770 96 210680253
BCT771 101 212225052
BCT772 126 215817254
BCT773 90 206369463
BCT774 167 210992359
BCT775 195 258965701
BCT776 119 231112938
BCT777 109 210143469
BCT778 130 213292892
BCT779 197 245781780
BCT78 138 232661918
BCT780 109 221741520
BCT781 112 214860861
BCT782 72 103526615
BCT783 131 211804663
BCT784 118 225036977
BCT785 77 207460102
BCT786 87 215400166
BCT787 16 59746765
BCT788 118 208676078
BCT789 151 208821074
BCT79 108 225781339
BCT790 168 227462150
BCT791 86 215601192
BCT792 9 50951519
BCT793 78 221812250
BCT794 125 223032976
BCT795 136 225597849
BCT796 170 218721653
BCT797 37 58721844
BCT798 144 208238457
BCT799 86 211315283
BCT8 191 234251938
BCT80 38 50860113
BCT800 106 217742593
BCT801 110 201658386
BCT802 96 225256070
BCT803 25 36290348
BCT804 129 204889894
BCT805 103 202948623
BCT806 140 205719895
BCT807 88 222930553
BCT808 113 179073871
BCT809 85 218127589
BCT81 95 230912422
BCT810 132 212837999
BCT811 86 243898793
BCT812 97 212907772
BCT813 166 237402783
BCT814 201 263770266
BCT815 99 223006138
BCT816 143 210323440
BCT817 98 219942289
BCT818 142 245685040
BCT819 109 233953813
BCT82 117 227983621
BCT820 99 216382412
BCT821 69 136626198
BCT822 130 206130775
BCT823 99 216262761
BCT824 129 207799444
BCT825 149 234032211
BCT826 102 209682883
BCT827 48 55430861
BCT828 98 210426593
BCT829 119 210404603
BCT83 160 232898310
BCT830 89 236879950
BCT831 90 217207547
BCT832 84 206836362
BCT833 43 84419270
BCT834 144 230739437
BCT835 245 225179941
BCT836 106 228848346
BCT837 118 204410837
BCT838 126 215550917
BCT839 60 101151697
BCT84 154 221704284
BCT840 145 217007941
BCT841 126 229854359
BCT842 188 218271826
BCT843 147 213841952
BCT844 126 211345566
BCT845 109 214927660
BCT846 237 214427233
BCT847 127 205241292
BCT848 84 203384302
BCT849 33 208503476
BCT85 128 238275556
BCT850 162 208682056
BCT851 19 24508163
BCT852 121 206012040
BCT853 134 253645887
BCT854 91 208721495
BCT855 109 211968410
BCT856 74 204017635
BCT857 80 177247697
BCT858 103 244946133
BCT859 147 216740775
BCT86 114 230664549
BCT860 152 224621999
BCT861 149 218941117
BCT862 100 211978733
BCT863 33 50154087
BCT864 144 226846865
BCT865 109 243762283
BCT866 119 203954018
BCT867 111 226625184
BCT868 106 208252725
BCT869 75 220555339
BCT87 54 123393656
BCT870 102 213800622
BCT871 112 217846282
BCT872 131 220268724
BCT873 165 219593903
BCT874 89 218619835
BCT875 57 92158520
BCT876 156 259811004
BCT877 183 215544431
BCT878 233 202926599
BCT879 197 228742072
BCT88 300 239582260
BCT880 211 232615292
BCT881 124 218850701
BCT882 102 152952492
BCT883 264 217543179
BCT884 151 199782010
BCT885 96 209282491
BCT886 61 206431798
BCT887 128 203977672
BCT888 3 5631743
BCT889 132 204137212
BCT89 142 231562727
BCT890 166 214365529
BCT891 120 220575393
BCT892 112 214645394
BCT893 54 213275421
BCT894 28 110334477
BCT895 81 218955165
BCT896 81 206513189
BCT897 108 212895574
BCT898 152 197957610
BCT899 107 214114443
BCT9 133 236750743
BCT90 354 225466658
BCT900 108 215569816
BCT901 11 29121495
BCT902 90 220588272
BCT903 125 202101680
BCT904 126 202053537
BCT905 136 210137333
BCT906 119 212063498
BCT907 2 56129
BCT908 73 214240962
BCT909 86 227534342
BCT91 110 222922994
BCT910 104 202437537
BCT911 131 198976882
BCT912 43 46334664
BCT913 113 207620208
BCT914 142 208403791
BCT915 122 210078046
BCT916 149 209414135
BCT917 72 111959512
BCT918 111 211196089
BCT919 118 212601858
BCT92 120 208517065
BCT920 115 255258643
BCT921 102 283937523
BCT922 34 135021183
BCT923 192 323349985
BCT924 177 296533131
BCT925 128 229419034
BCT926 155 225090648
BCT927 115 203586737
BCT928 109 233285819
BCT929 86 219652176
BCT93 120 227473574
BCT930 114 222283031
BCT931 23 54218728
BCT932 100 207889507
BCT933 98 203097699
BCT934 147 213548069
BCT935 110 210090861
BCT936 52 117100238
BCT937 91 211499617
BCT938 113 220715595
BCT939 126 217110287
BCT94 99 226611423
BCT940 132 209612017
BCT941 45 44858285
BCT942 139 224141832
BCT943 106 207515284
BCT944 109 217502713
BCT945 105 217317133
BCT946 101 94439679
BCT947 528 115589384
BCT948 1589 2511957
BCT949 3172 5268484
BCT95 90 224039666
BCT950 6338 7796395
BCT951 12613 14997690
BCT952 25523 27672494
BCT953 50566 54072396
BCT954 148873 156716109
BCT955 14210 193517056
BCT956 3297 203942569
BCT957 2512 213432676
BCT958 7212 212654349
BCT959 164 249069009
BCT96 98 225070223
BCT960 39928 39703867
BCT961 75131 183087384
BCT962 11028 200062814
BCT963 6078 200796727
BCT964 100695 182725025
BCT965 60982 67424103
BCT966 149210 156932387
BCT967 84530 88114091
BCT968 144585 151089372
BCT969 25893 25555617
BCT97 58 138528232
BCT970 132569 167531110
BCT971 31496 43702420
BCT972 116478 178543263
BCT973 7603 16996686
BCT974 33015 54143530
BCT975 40044 220970664
BCT976 4508 318755808
BCT977 3034 43961507
BCT978 5034 225438591
BCT979 3847 224092509
BCT98 53 211054879
BCT980 1442 273316652
BCT981 109 222593498
BCT982 55 216844860
BCT983 70 213822191
BCT984 34 137765382
BCT985 69 224394912
BCT986 364 238323955
BCT987 889 289911825
BCT988 316 85816731
BCT989 1274 198668008
BCT99 45 210584326
BCT990 287 209619920
BCT991 559 377168493
BCT992 919 316619406
BCT993 271 80140439
BCT994 3148 246273076
BCT995 677 253307538
BCT996 380 388957404
BCT997 318 215497381
BCT998 362 393266490
BCT999 364 392445913
ENV1 189936 141862723
ENV10 83 219720293
ENV11 122 232511710
ENV12 159 212287027
ENV13 79 218543763
ENV14 157880 171944571
ENV15 81206 46611081
ENV16 218967 102566373
ENV17 176355 159881667
ENV18 19595 17086020
ENV19 204686 124198790
ENV2 110079 181379911
ENV20 186311 145969928
ENV21 209228 131011030
ENV22 180831 144717354
ENV23 1252 1679399
ENV24 155432 156521079
ENV25 244834 67513554
ENV26 92644 21374075
ENV27 220959 118335235
ENV28 255264 109061988
ENV29 205163 126335257
ENV3 104974 172639457
ENV30 27420 25899715
ENV31 152287 158743433
ENV32 201173 103412131
ENV33 68234 51315191
ENV34 213271 108914748
ENV35 170977 153757979
ENV36 135003 163679797
ENV37 11563 15753400
ENV38 179911 128295039
ENV39 218037 118475426
ENV4 126 289839815
ENV40 78541 41743248
ENV41 143979 98000846
ENV42 100616 112273432
ENV43 130605 80421103
ENV44 173933 138863958
ENV45 163622 139549256
ENV46 179878 114643421
ENV47 200965 107345641
ENV48 196346 109547800
ENV49 111595 97826521
ENV5 89 221856772
ENV50 158037 134815999
ENV51 145071 136774292
ENV52 169155 47811798
ENV53 172153 133099688
ENV54 210921 100424378
ENV55 142451 62215281
ENV56 216484 84261358
ENV57 212739 92634161
ENV58 108071 43433590
ENV59 224265 98776492
ENV6 107 218303630
ENV60 224774 91723196
ENV61 142960 92501157
ENV62 198343 110962019
ENV63 182971 90536433
ENV64 183523 120192272
ENV65 54769 44036443
ENV66 128629 186314172
ENV67 223269 135703859
ENV68 235363 93587379
ENV69 95554 44025219
ENV7 70 217972325
ENV70 194507 112023061
ENV71 131093 170957035
ENV72 67598 134769130
ENV73 41591 215295054
ENV74 136525 144621655
ENV75 77466 185155761
ENV76 46687 226087010
ENV77 91333 275718746
ENV78 88496 296480694
ENV79 258 391242346
ENV8 18 57298556
ENV80 3431 127011835
ENV9 76 217162029
EST1 152676 59069390
EST10 155716 67095973
EST100 152778 76471565
EST101 145010 99279907
EST102 145172 85252768
EST103 148873 93081688
EST104 7515 4350644
EST105 149617 109417790
EST106 135201 99318378
EST107 136259 97454300
EST108 136240 94831240
EST109 2404 1587299
EST11 163527 69169482
EST110 136751 77270907
EST111 176402 105757023
EST112 193950 119224074
EST113 236922 141664136
EST114 6627 4069381
EST115 229453 127643708
EST116 181415 102870914
EST117 190249 93414076
EST118 5248 4073334
EST119 148552 100253258
EST12 150881 64818035
EST120 154735 119130491
EST121 166280 97900067
EST122 22063 15461205
EST123 130028 82530428
EST124 83543 30920786
EST125 36769 12485692
EST126 84106 31034635
EST127 84264 34515269
EST128 33711 11378339
EST129 85031 32709177
EST13 186630 83471161
EST130 82017 34968192
EST131 83454 35266094
EST132 84118 32965334
EST133 14468 5903340
EST134 83460 51063090
EST135 173481 87480434
EST136 170361 77647991
EST137 145527 91797238
EST138 29659 18775715
EST139 140355 87014374
EST14 104811 47840316
EST140 149335 97877743
EST141 157292 78661333
EST142 181198 92623099
EST143 8928 5198058
EST144 141571 76041135
EST145 151619 73235123
EST146 148412 87034276
EST147 155766 83575958
EST148 11706 6903282
EST149 166215 102160051
EST15 197325 111627306
EST150 202194 107310927
EST151 158867 93286369
EST152 102222 51075859
EST153 155639 79042501
EST154 135075 80133731
EST155 141690 88158876
EST156 165810 85752287
EST157 9314 5218716
EST158 178955 104146744
EST159 218711 94419121
EST16 147207 104727496
EST160 145779 85813988
EST161 161375 87629602
EST162 3062 1523802
EST163 140660 82396713
EST164 132522 83740466
EST165 147239 88250074
EST166 146464 80718105
EST167 20644 10465585
EST168 117769 61073260
EST169 115690 61941713
EST17 156583 83438215
EST170 122419 54128062
EST171 121107 48630686
EST172 29423 11431564
EST173 122215 48678047
EST174 125709 48482605
EST175 165795 83310643
EST176 172205 75576921
EST177 24657 15513157
EST178 147743 104364925
EST179 163429 99358064
EST18 190951 116800077
EST180 205284 116217156
EST181 167108 93350542
EST182 154079 103286743
EST183 134219 92993843
EST184 10781 6013701
EST185 146582 94120876
EST186 154988 80945678
EST187 131949 71060625
EST188 160846 90600470
EST189 13393 8468221
EST19 177400 113022366
EST190 148840 87645185
EST191 153698 95464921
EST192 175523 99185391
EST193 140423 77123132
EST194 5092 4172247
EST195 123967 64273734
EST196 162722 90850517
EST197 173183 99602742
EST198 149609 92840514
EST199 6210 3892188
EST2 157282 60510852
EST20 71000 55722012
EST200 164744 79130838
EST201 122492 84332756
EST202 163358 96332572
EST203 163857 96044709
EST204 14395 6879298
EST205 5847 2580354
EST206 111150 63073430
EST207 151170 87095461
EST208 107194 63524616
EST209 164131 100717476
EST21 194381 109138766
EST210 168271 124553548
EST211 82827 67366748
EST212 186242 95036481
EST213 145260 90138733
EST214 87567 65796037
EST215 141914 85219333
EST216 137898 75149598
EST217 95604 30686008
EST218 146894 86267439
EST219 148594 82459905
EST22 179794 92387328
EST220 141359 94228947
EST221 155420 90008351
EST222 9706 6814092
EST223 161771 99542731
EST224 154058 93650716
EST225 123359 88321639
EST226 146028 90245814
EST227 6976 4224742
EST228 128831 82021098
EST229 127856 89666249
EST23 107402 50556226
EST230 44462 31954010
EST231 156429 83331488
EST232 167399 92029721
EST233 166930 92691445
EST234 158125 88082990
EST235 163896 91508682
EST236 163228 92242200
EST237 166033 91294921
EST238 154891 85088026
EST239 168030 90687163
EST24 190972 61390762
EST240 187909 98489047
EST241 191311 107041774
EST242 168381 100323964
EST243 180025 103224685
EST244 190025 112759300
EST245 186323 113230756
EST246 178010 115392887
EST247 7071 5607359
EST248 140634 86212237
EST249 212632 138839121
EST25 136527 39211071
EST250 226959 111340152
EST251 164069 113913134
EST252 183146 95756964
EST253 197974 98471029
EST254 123046 89289573
EST255 7475 5185523
EST256 140224 82365172
EST257 206165 112641063
EST258 162517 106389114
EST259 93643 92349537
EST26 102354 27619605
EST260 15362 19994089
EST261 147622 99189632
EST262 150767 89756528
EST263 139176 101742893
EST264 216336 99353332
EST265 4565 2821766
EST266 133636 96436124
EST267 129480 90283987
EST268 135526 98313237
EST269 113350 81420942
EST27 201338 85169852
EST270 17516 11104500
EST271 136224 84348047
EST272 125703 85851017
EST273 127789 96576509
EST274 36548 26163923
EST275 126643 89388805
EST276 116524 79042651
EST277 138898 83679903
EST278 145962 114898436
EST279 15579 11020136
EST28 19821 8893541
EST280 125395 117388350
EST281 132433 98775254
EST282 162337 97562555
EST283 165664 104470663
EST284 19257 12070221
EST285 142244 92439543
EST286 168943 115108709
EST287 151678 103899230
EST288 136291 103153979
EST289 3472 2297545
EST29 203801 100091766
EST290 159549 97229973
EST291 222526 90766361
EST292 152836 111325212
EST293 160406 71767282
EST294 10503 1187900
EST295 208917 37980980
EST296 212285 83331327
EST297 150079 115258622
EST298 168109 97764449
EST299 154827 103149238
EST3 156018 54727763
EST30 216481 109022941
EST300 169052 109970400
EST301 149395 109822175
EST302 2197 1476231
EST303 180745 102235670
EST304 178556 93090304
EST305 168973 109472164
EST306 158897 104102836
EST307 2411 1923896
EST308 225880 106203457
EST309 266222 115902028
EST31 153855 67071563
EST310 185440 112103160
EST311 151096 28710776
EST312 227985 99544771
EST313 175513 100319329
EST314 156180 99893192
EST315 159722 95007804
EST316 479 361426
EST317 166298 114042738
EST318 179945 95180012
EST319 143780 97257262
EST32 149562 63751558
EST320 188320 110423173
EST321 187359 49128427
EST322 201668 33864078
EST323 174165 95392257
EST324 14774 9233448
EST325 158235 113265480
EST326 184738 110428476
EST327 167428 97750567
EST328 165965 109745188
EST329 165849 71375282
EST33 165159 65680081
EST330 127634 80036426
EST331 121236 80456540
EST332 146640 101332396
EST333 22486 8250892
EST334 250611 26632520
EST335 254708 23392212
EST336 152004 94195783
EST337 152251 98608210
EST338 150976 99681932
EST339 145898 92253111
EST34 147004 64493309
EST340 237629 43480316
EST341 185640 80872134
EST342 4027 4970633
EST343 168840 99775969
EST344 163966 101133216
EST345 145648 92755775
EST346 189443 103114377
EST347 156148 109739284
EST348 153297 101566189
EST349 2426 915498
EST35 162552 70856093
EST350 184230 108290864
EST351 169884 94656881
EST352 169173 105206551
EST353 178636 59717910
EST354 195269 72030896
EST355 194748 75388710
EST356 197291 74551080
EST357 134728 70211808
EST358 174807 127367579
EST359 148391 85100581
EST36 160815 65981092
EST360 150483 86625647
EST361 121476 94901460
EST362 5932 4701523
EST363 142701 94368059
EST364 155330 94309089
EST365 162012 90113788
EST366 157009 100315910
EST367 23643 10396066
EST368 45656 24624838
EST369 155293 104537031
EST37 107941 33682655
EST370 137832 97018853
EST371 158406 101968297
EST372 152636 109694799
EST373 30266 25783558
EST374 173528 146728187
EST375 163544 85444380
EST376 127571 80894386
EST377 137822 94036599
EST378 51338 35949456
EST379 131619 88276056
EST38 99513 30489875
EST380 137093 89601408
EST381 139337 96986761
EST382 147156 97099902
EST383 51251 41095912
EST384 164148 86536266
EST385 143623 81414337
EST386 144917 86069192
EST387 144188 103734681
EST388 155671 93199334
EST389 137838 87384737
EST39 99154 31399112
EST390 132358 84149156
EST391 20621 12735139
EST392 196942 107257732
EST393 136851 75001285
EST394 92969 54570705
EST395 120408 80237774
EST396 23482 14313208
EST397 131137 82988342
EST398 119642 76596711
EST399 147274 80748116
EST4 142972 56362966
EST40 98816 29786908
EST400 210375 82563096
EST401 30532 12823311
EST402 163628 84364287
EST403 163914 99171502
EST404 159146 95828757
EST405 125989 81300696
EST406 12161 7969381
EST407 129505 86703580
EST408 137395 90180185
EST409 178556 111879524
EST41 39236 11600145
EST410 154174 93122560
EST411 27981 12146305
EST412 166700 91996739
EST413 168828 124880119
EST414 87409 56147622
EST415 69678 41105952
EST416 34127 16800877
EST417 137488 79941871
EST418 82455 49433301
EST419 139695 56837590
EST42 101326 31351096
EST420 148165 29996844
EST421 148030 30296764
EST422 162600 80122839
EST423 28322 14992272
EST424 201213 115842274
EST425 237755 108748070
EST426 220152 107479554
EST427 127106 74508992
EST428 128057 85803248
EST429 131704 80409324
EST43 102633 36243427
EST430 93228 56881081
EST431 174105 110064955
EST432 213136 84698644
EST433 106574 28506785
EST434 183471 112008437
EST435 203905 111386178
EST436 180307 106396407
EST437 199637 118042696
EST438 132935 62223660
EST439 110330 60167533
EST44 95475 48218258
EST440 162601 108614110
EST441 181152 115720728
EST442 108077 86015819
EST443 177004 139599957
EST444 150295 90619060
EST445 54250 34510266
EST446 166056 106956443
EST447 178219 101078638
EST448 42963 24524631
EST449 195466 106587863
EST45 121121 52335541
EST450 183935 94237774
EST451 52147 38920690
EST452 189910 115818986
EST453 180010 117991294
EST454 54575 33990107
EST455 196573 133887305
EST456 219857 123775014
EST457 190087 126956582
EST458 189241 147388649
EST459 310 264791
EST46 55810 33167886
EST460 204237 155999097
EST461 192186 115130551
EST462 160758 96336999
EST463 181246 94918045
EST464 7406 614573
EST465 53496 4381716
EST466 158232 12239421
EST467 144975 12987161
EST468 147925 29931089
EST469 148356 29501756
EST47 176556 89017465
EST470 8452 1761940
EST471 148043 30264080
EST472 141212 81174487
EST473 171368 100067589
EST474 161648 110828410
EST475 19450 13804348
EST476 160786 92773669
EST477 150648 104119784
EST478 133680 93215925
EST479 141644 98055796
EST48 158183 65088145
EST480 16394 8452879
EST481 157369 103673906
EST482 146437 105286243
EST483 162015 97563450
EST484 165796 50902827
EST485 11903 1870288
EST486 160476 40344382
EST487 150806 102149648
EST488 146642 96521392
EST489 170853 112303455
EST49 162221 91938358
EST490 21883 11861733
EST491 132527 75702844
EST492 189749 107907416
EST493 149390 109146835
EST494 53584 36369591
EST495 126855 87064282
EST496 145499 90195929
EST497 147345 88597360
EST498 163204 89119617
EST499 37036 18893940
EST5 162046 62591557
EST50 154877 80580295
EST500 151785 92116569
EST501 155952 91949431
EST502 168251 101940332
EST503 136389 85423858
EST504 15950 9025714
EST505 100253 71169364
EST506 78626 60620272
EST507 97471 64748244
EST508 143349 80447229
EST509 37265 21239218
EST51 156390 74771983
EST510 120626 73365540
EST511 133392 87396068
EST512 135163 79259009
EST513 151533 92857854
EST514 47048 25601310
EST515 155600 85748129
EST516 184596 110426846
EST517 120081 78936396
EST518 178684 94922801
EST519 5742 2180441
EST52 108219 61222574
EST520 52576 18674859
EST521 182569 100663650
EST522 152148 81321895
EST523 23053 13928703
EST524 162316 94446797
EST525 211236 123658554
EST526 30185 19341621
EST527 147958 99624045
EST528 158446 97595891
EST529 134305 87490150
EST53 153906 88947034
EST530 128605 87865201
EST531 26182 16357153
EST532 178675 74362205
EST533 179100 79391228
EST534 198856 83506649
EST535 194861 80609089
EST536 4095 1379666
EST537 178841 95307232
EST538 174076 102227567
EST539 180191 107920861
EST54 154191 84965745
EST540 172258 103856477
EST541 196663 126493129
EST542 186425 103119121
EST543 178904 82831722
EST544 148028 94300205
EST545 206518 125003286
EST546 205657 126701639
EST547 188926 108266858
EST548 208317 121345654
EST549 34317 17820709
EST55 152220 92234215
EST550 154052 96415299
EST551 188315 117674408
EST552 166547 98818629
EST553 133848 98348660
EST554 8666 7053012
EST555 157219 92146041
EST556 170364 84880278
EST557 149253 85158880
EST558 151162 81932859
EST559 11898 7113660
EST56 150018 69957229
EST560 156484 79967111
EST561 181237 106306680
EST562 162166 102980888
EST563 175037 107738299
EST564 4095 2823328
EST565 170706 117073091
EST566 183779 113547121
EST567 129219 83790320
EST568 168574 97322346
EST569 185637 110176864
EST57 142162 76714634
EST570 39338 26266140
EST571 204465 119127975
EST572 269500 91747576
EST573 25706 9441749
EST574 262208 83553217
EST575 157843 95706673
EST576 156061 104112677
EST577 162591 58135590
EST578 92203 36397309
EST58 151712 83218730
EST59 161193 65788370
EST6 166228 65026396
EST60 144589 70133092
EST61 160365 89939140
EST62 150337 92592984
EST63 150109 99270886
EST64 157599 94515357
EST65 2729 1149637
EST66 154753 103415401
EST67 162949 82998651
EST68 166589 84840478
EST69 142352 77836923
EST7 163850 67729799
EST70 148303 82498115
EST71 148982 86080694
EST72 148452 92219101
EST73 150506 87393909
EST74 3367 1993359
EST75 29919 18235506
EST76 186623 102758272
EST77 170455 90769208
EST78 212135 115450370
EST79 179537 103352293
EST8 161034 67849081
EST80 2595 1769868
EST81 196745 121640362
EST82 167532 93332595
EST83 136013 63286520
EST84 128083 62610791
EST85 11185 5740613
EST86 150319 92587484
EST87 154531 96912480
EST88 130223 66329267
EST89 140169 89287993
EST9 169413 69378292
EST90 14619 7602591
EST91 183459 91893008
EST92 204450 119806817
EST93 202065 108012137
EST94 192053 90423413
EST95 203798 86996774
EST96 145904 86952848
EST97 137792 84712145
EST98 158921 76750167
EST99 9280 6073374
GSS1 172818 126565512
GSS10 15063 14534273
GSS100 156116 139401502
GSS101 16660 10968419
GSS102 168722 143967545
GSS103 157878 109069542
GSS104 156130 106446313
GSS105 152737 105718247
GSS106 168006 122784077
GSS107 149452 126270618
GSS108 161684 125096048
GSS109 186495 115926183
GSS11 145620 106560749
GSS110 16919 10327274
GSS111 185687 119751799
GSS112 201287 103923207
GSS113 219830 124101551
GSS114 87638 57037950
GSS115 151982 114076675
GSS116 155174 118808984
GSS117 155138 118870658
GSS118 163305 106817350
GSS119 37490 21563377
GSS12 199531 104011176
GSS120 179013 131661113
GSS121 189765 117491847
GSS122 166053 55057548
GSS123 169938 76249060
GSS124 3108 2065491
GSS125 161448 105035511
GSS126 188862 124689407
GSS127 200296 82001429
GSS128 168219 79987234
GSS129 137268 94431217
GSS13 191750 84122819
GSS130 129855 104605133
GSS131 132043 108777560
GSS132 132451 106048276
GSS133 8056 5958858
GSS134 135214 112032054
GSS135 56598 47104660
GSS136 132584 107786768
GSS137 139149 116140565
GSS138 140043 114408742
GSS139 138251 109584898
GSS14 173813 89348055
GSS140 4155 2820771
GSS141 134784 106426486
GSS142 134049 108003847
GSS143 134400 111531585
GSS144 138188 116474348
GSS145 4675 3643453
GSS146 139468 108106612
GSS147 136810 113648547
GSS148 136898 113473892
GSS149 137299 112649085
GSS15 1942 990420
GSS150 559 466085
GSS151 137155 110923756
GSS152 134480 106278327
GSS153 133002 107665198
GSS154 138659 116136290
GSS155 1985 1674795
GSS156 127182 92203837
GSS157 174122 105056445
GSS158 184364 110063230
GSS159 162423 108623888
GSS16 167950 83915732
GSS160 177517 102495279
GSS161 195395 128347977
GSS162 201539 133261442
GSS163 200715 134061851
GSS164 181019 126535857
GSS165 198341 136948587
GSS166 196713 139067120
GSS167 196064 138671402
GSS168 174299 134354206
GSS169 144474 97339661
GSS17 159733 81434885
GSS170 138053 80502012
GSS171 165315 73484620
GSS172 130293 57961944
GSS173 162971 140972883
GSS174 170923 113504023
GSS175 80882 52990649
GSS176 191836 128985792
GSS177 195995 117721523
GSS178 29060 15232802
GSS179 180225 98140530
GSS18 155956 85599361
GSS180 181302 123365801
GSS181 178800 126906476
GSS182 181098 127179984
GSS183 19114 12799890
GSS184 165902 130533276
GSS185 170769 155442034
GSS186 219492 123624062
GSS187 216568 103419657
GSS188 17938 8362456
GSS189 210015 95106166
GSS19 153559 95946744
GSS190 162425 134536276
GSS191 16879 16812210
GSS192 125540 102753347
GSS193 122235 93469471
GSS194 156641 154268782
GSS195 167926 158459909
GSS196 131396 104305071
GSS197 149360 107958474
GSS198 170079 141603399
GSS199 173853 119767432
GSS2 172571 106974251
GSS20 153654 72719206
GSS200 20792 12076547
GSS201 181326 133978343
GSS202 184903 120111167
GSS203 180120 93026884
GSS204 172833 121727487
GSS205 189431 117159380
GSS206 189632 116856204
GSS207 21296 12387505
GSS208 200656 130020228
GSS209 215713 142627344
GSS21 106599 59132134
GSS210 217639 140378671
GSS211 166383 136378793
GSS212 152394 108659129
GSS213 159516 120127536
GSS214 159222 144721751
GSS215 159808 141641241
GSS216 160025 145012269
GSS217 161623 143744366
GSS218 162207 142682743
GSS219 161901 124660013
GSS22 132522 64635660
GSS220 168118 139542770
GSS221 162158 116272085
GSS222 180642 88789528
GSS223 2275 1543221
GSS224 251369 52150506
GSS225 262481 40466091
GSS226 262523 40408947
GSS227 122800 38229504
GSS228 253355 52912344
GSS229 182565 86129448
GSS23 125192 56723722
GSS230 188824 55952203
GSS231 154340 118464017
GSS232 177033 144334259
GSS233 160566 145786280
GSS234 158963 146486119
GSS235 175119 110481562
GSS236 238210 57319690
GSS237 198718 101419800
GSS238 228550 39520519
GSS239 119400 74782163
GSS24 133968 72981771
GSS240 173535 111783710
GSS241 148014 90085518
GSS242 140464 83790991
GSS243 159730 149647456
GSS244 6503 5533776
GSS245 112668 95722541
GSS246 180351 149222837
GSS247 172952 122406011
GSS248 201906 127716686
GSS249 188212 120277412
GSS25 142794 74274291
GSS250 166175 94403497
GSS251 159865 84500591
GSS252 156428 119869599
GSS253 203515 148105542
GSS254 14310 9406216
GSS255 171523 67875770
GSS256 176316 96175653
GSS257 195480 152066346
GSS258 199052 153893384
GSS259 8581 7079434
GSS26 12574 5388027
GSS260 197610 157072181
GSS261 197570 124238096
GSS262 194874 142538969
GSS263 853 588710
GSS264 214431 131244295
GSS265 189953 57620998
GSS266 211774 108913136
GSS267 177797 157192397
GSS268 163847 150141472
GSS269 233829 131848785
GSS27 140896 65655631
GSS270 241255 120361822
GSS28 159847 79832355
GSS29 156451 92519127
GSS3 138091 115757733
GSS30 164864 85230462
GSS31 10282 5319388
GSS32 171961 102867176
GSS33 182793 109077642
GSS34 182266 87042106
GSS35 173002 102201374
GSS36 190487 103919871
GSS37 162239 112347665
GSS38 160362 98313234
GSS39 173083 108442870
GSS4 140070 112435838
GSS40 4467 3211536
GSS41 183985 122974505
GSS42 181741 117322404
GSS43 52286 27335335
GSS44 177820 102905200
GSS45 164518 141969870
GSS46 179633 148569334
GSS47 139686 92499212
GSS48 182873 132017102
GSS49 181617 114554523
GSS5 12740 9526334
GSS50 204428 116967955
GSS51 185581 99459566
GSS52 211954 108037045
GSS53 211747 108318359
GSS54 197283 132772792
GSS55 158243 124832316
GSS56 185583 139405028
GSS57 196772 63136393
GSS58 171739 96411428
GSS59 157707 106161954
GSS6 152750 116376137
GSS60 23373 13575160
GSS61 166615 156644394
GSS62 177188 98818477
GSS63 161235 115245018
GSS64 172262 112292681
GSS65 175437 118749924
GSS66 184317 127706706
GSS67 205680 128787401
GSS68 187487 111746271
GSS69 904 494120
GSS7 170822 119987739
GSS70 200507 134082593
GSS71 215979 158545254
GSS72 188980 137988156
GSS73 173702 107612445
GSS74 198148 111946385
GSS75 140507 76313882
GSS76 163068 95818066
GSS77 10997 7015314
GSS78 159270 97756741
GSS79 159481 96970229
GSS8 177098 108890889
GSS80 172278 114346124
GSS81 170756 109404389
GSS82 174615 122489482
GSS83 188951 105344114
GSS84 175437 126363935
GSS85 163968 106294793
GSS86 1150 906691
GSS87 189248 108544814
GSS88 180902 113819623
GSS89 166588 117808805
GSS9 141916 118718103
GSS90 192391 105665595
GSS91 10240 5928398
GSS92 213831 107550639
GSS93 226833 89047322
GSS94 213068 138993481
GSS95 183490 92580894
GSS96 94686 37020965
GSS97 193805 75823638
GSS98 201086 123394316
GSS99 191020 122180795
HTC1 41190 63371632
HTC2 32318 72271528
HTC3 32081 77888423
HTC4 84851 50686507
HTC5 129506 161161965
HTC6 125282 123135242
HTC7 137566 130735831
HTC8 68694 61911760
HTG1 3784 374870703
HTG10 2848 363016285
HTG11 1976 365940103
HTG12 1714 382089084
HTG13 1718 381796340
HTG14 1659 383118453
HTG15 1835 380424998
HTG16 1750 361896240
HTG17 1843 380599315
HTG18 1752 382301790
HTG19 1775 381824019
HTG2 5068 373604329
HTG20 1891 380883515
HTG21 2135 355865123
HTG22 2426 376351102
HTG23 2269 379507879
HTG24 2442 381163865
HTG25 2175 382733656
HTG26 2070 368006459
HTG27 2074 380458182
HTG28 2061 380108509
HTG29 1047 202962639
HTG3 2556 370662362
HTG30 2040 379446758
HTG31 2203 375546591
HTG32 986 170706729
HTG33 2152 379221269
HTG34 2348 376393195
HTG35 1372 195850538
HTG36 2462 370234045
HTG37 2428 372528369
HTG38 1015 169191937
HTG39 2235 381490266
HTG4 2735 369989641
HTG40 2336 385145188
HTG41 1069 180930974
HTG42 2312 384776536
HTG43 2363 384490832
HTG44 906 155597869
HTG45 2500 379735659
HTG46 2319 385244375
HTG47 927 158722850
HTG48 2315 385567657
HTG49 2293 386023883
HTG5 2500 373389217
HTG50 900 149450476
HTG51 2237 385154833
HTG52 2106 380011723
HTG53 657 122585305
HTG54 2010 379525743
HTG55 1981 378955508
HTG56 1184 193581815
HTG57 2144 380658486
HTG58 2686 383430148
HTG59 2972 383122016
HTG6 2 386956
HTG60 885 128384665
HTG61 2959 380503057
HTG62 3012 366231486
HTG63 2990 372824610
HTG64 2953 336850403
HTG65 3178 359117111
HTG66 3179 359260560
HTG67 3186 360427818
HTG68 3128 367889098
HTG69 2913 377859052
HTG7 2327 375791086
HTG70 1846 312468258
HTG71 3415 365492036
HTG72 2071 381329139
HTG73 1668 298160154
HTG74 2088 382520375
HTG75 2244 384445864
HTG76 1669 296247510
HTG77 2201 385233869
HTG78 2249 384504439
HTG79 3218 384021459
HTG8 1500 384347777
HTG80 2165 384532378
HTG81 3034 373211752
HTG82 2131 233207227
HTG9 1582 384062276
INV1 154249 140151336
INV10 4 353796308
INV100 19 393479571
INV100 3 236174852
INV100 5 333202408
INV100 7 380888452
INV100 6 288483784
INV100 3 359596411
INV100 3 275853845
INV100 5 376167017
INV100 7 369632890
INV100 15 378314108
INV100 17 368087933
INV101 18 363756879
INV101 5 133748391
INV101 20 388296339
INV101 17 379457536
INV101 20 368530964
INV101 5 394539175
INV101 1 71901920
INV101 6 370194894
INV101 8 316109534
INV101 1 2140038457
INV101 1 1533311695
INV102 5 243308800
INV102 1 991394496
INV102 1 709211797
INV102 1 559013835
INV102 1 538612828
INV102 1 476618521
INV102 1 348474640
INV102 1 332259893
INV102 1 287425978
INV102 1 237816702
INV102 1 222571878
INV103 39 334947085
INV103 2 391571136
INV103 8 340292240
INV103 1 47220557
INV103 4 366546274
INV103 12 379725079
INV103 19 391162514
INV103 10 251573840
INV103 19 379932152
INV103 33 382987660
INV103 33 386339958
INV104 16 388094550
INV104 30 353746939
INV104 21 371601066
INV104 6 362567176
INV104 13 390937191
INV104 12 231701502
INV104 27 388004708
INV104 229 382141802
INV104 33 392005379
INV104 11 192522327
INV104 20 349696121
INV105 15 286886243
INV105 9 386500094
INV105 11 373924042
INV105 9 250287188
INV105 16 392208593
INV105 30 375590146
INV105 20 381850848
INV105 9 220479775
INV105 3 349443465
INV105 3 121655962
INV105 1 378734160
INV106 1 276873094
INV106 1 272287048
INV106 6 307813224
INV106 29 391276627
INV106 16 383716194
INV106 34 374759466
INV106 5 262281928
INV106 11 371329702
INV106 6 368879584
INV106 7 350337011
INV106 14 345060509
INV107 1 234867409
INV107 28 376473495
INV107 20 387688055
INV107 25 387549397
INV107 16 273291927
INV107 21 391659234
INV107 15 388003948
INV107 17 392782098
INV107 22 384497843
INV107 1 384599746
INV107 1 375927842
INV108 1 301373441
INV108 5 382993214
INV108 19 385797313
INV108 11 123214675
INV108 3 392646952
INV108 11 381074049
INV108 23 391735799
INV108 18 390168307
INV108 2 42007124
INV108 17 349645545
INV108 36 391559871
INV109 1 299223332
INV109 15 393037217
INV109 17 380153622
INV109 3 59787137
INV109 18 391697154
INV109 18 366312255
INV109 3 337894111
INV109 4 302073392
INV109 2 299644653
INV109 2 270514050
INV109 3 389949835
INV11 6 363887313
INV110 1 264325503
INV110 3 377785151
INV110 1 117072231
INV110 7 379476447
INV110 13 370594929
INV110 19 385355871
INV110 19 310143194
INV110 24 379964624
INV110 23 389484464
INV110 18 384799792
INV110 11 311697054
INV111 1 233496210
INV111 19 385416179
INV111 23 381933246
INV111 21 387246911
INV111 4 249799159
INV111 2 366882438
INV111 14 388370346
INV111 21 372413558
INV111 11 364644469
INV111 9 299858585
INV111 3 322474280
INV112 1 211810051
INV112 5 373079097
INV112 6 253444959
INV112 1 278847389
INV112 2 381917736
INV112 5 382304965
INV112 10 386062363
INV112 10 259701476
INV112 13 376291971
INV112 17 379702260
INV112 14 391466716
INV113 1 189869738
INV113 23 381561736
INV113 7 104919562
INV113 17 384568933
INV113 4 354385143
INV113 5 393615696
INV113 5 350509167
INV113 13 170433122
INV113 41 385022073
INV113 30 380703697
INV113 20 392681339
INV114 71333 280248538
INV114 13 369303117
INV114 3 121760452
INV114 10 368178692
INV114 15 386351526
INV114 16 393205423
INV114 22 382093519
INV114 5 84901051
INV114 23 391606292
INV114 19 384186373
INV114 24 387846790
INV115 81704 67103956
INV115 20 373516354
INV115 4 111080816
INV115 18 393422118
INV115 46 378688286
INV115 19 382845041
INV115 14 380720656
INV115 16 377993913
INV115 13 388384596
INV115 15 353225248
INV115 10 385225146
INV116 167095 134109160
INV116 11 273470899
INV116 12 363823232
INV116 18 371293482
INV116 18 391994412
INV116 31 390819384
INV116 6 350425796
INV116 14 392098573
INV116 29 373609145
INV116 17 389590392
INV116 16 381486986
INV117 126882 112526423
INV117 15 318246839
INV117 17 388617783
INV117 14 389176964
INV117 29 259715661
INV117 4 364567413
INV117 8 381014917
INV117 2 78434448
INV117 5 350286208
INV117 2 290331975
INV117 2 278888238
INV118 37136 273256295
INV118 2 276514222
INV118 2 269676904
INV118 4 363956289
INV118 18 391284265
INV118 12 224045865
INV118 19 391324862
INV118 17 390982751
INV118 18 376274198
INV118 19 352401134
INV118 3 302186515
INV119 2779 371575686
INV119 4 353711471
INV119 5 357741396
INV119 13 382478042
INV119 12 224411599
INV119 17 376440323
INV119 17 366693890
INV119 13 391571027
INV119 18 382117156
INV119 3 51115388
INV119 24 358079042
INV12 9 371306258
INV120 44 370097884
INV120 12 377073348
INV120 21 382278417
INV120 30 359479577
INV120 2 70328500
INV120 13 381531391
INV120 10 308545783
INV120 3 357081424
INV120 3 303625532
INV120 2 181194408
INV120 13 384377122
INV121 24 379270301
INV121 33 392079687
INV121 13 343474254
INV121 1 226676804
INV121 1 219059534
INV121 16 385377860
INV121 22 389649401
INV121 14 386739832
INV121 14 369921279
INV121 1 61636059
INV121 7 366264750
INV122 5 76533839
INV122 9 350557811
INV122 15 365667369
INV122 6 378807618
INV122 190 393479694
INV122 10 373214505
INV122 7 128813925
INV122 37 384493639
INV122 27 388854011
INV122 23 380037898
INV122 28 363846557
INV123 32 391299062
INV123 15 377681854
INV123 22 393673783
INV123 9 130141504
INV123 20 389123558
INV123 20 387294169
INV123 14 389119304
INV123 19 379601315
INV123 23 386448258
INV123 8 389213531
INV123 13 380257717
INV124 25 362900281
INV124 204 387365574
INV124 30 392954113
INV124 3 276039202
INV124 2 378921420
INV124 2 303390991
INV124 9 391074667
INV124 16 390694906
INV124 12 366488514
INV124 4 325784878
INV124 6 389357642
INV125 18 380479131
INV125 9 384120626
INV125 11 376230233
INV125 5 157146748
INV125 15 387407218
INV125 10 372793310
INV125 13 386573559
INV125 15 366464331
INV125 25 368796884
INV125 14 394572131
INV125 15 272825452
INV126 19 390062857
INV126 7 382020802
INV126 3 377751995
INV126 1 74373700
INV126 6 372848766
INV126 19 392995865
INV126 20 361450650
INV126 18 393654662
INV126 27 368630202
INV126 24 392519924
INV126 20 384861097
INV127 5 134896453
INV127 24 394625452
INV127 21 320922556
INV127 4 339818558
INV127 6 372821066
INV127 12 375257232
INV127 18 356987095
INV127 14 392597749
INV127 21 390274896
INV127 3 43344510
INV127 31 388699035
INV128 18 373966012
INV128 27 388119446
INV128 10 369434192
INV128 17 377251515
INV128 4 346682597
INV128 3 85114833
INV128 22 388207738
INV128 17 378212285
INV128 16 392106212
INV128 25 393533165
INV128 6 365268265
INV129 24 386584721
INV129 9 317988506
INV129 13 387631941
INV129 19 375812714
INV129 6 360702987
INV129 9 377395012
INV129 315 360903659
INV129 24 386975977
INV129 2 20618579
INV129 11 379797353
INV129 7 271219600
INV13 15 383308273
INV130 8 380395300
INV130 6 392152830
INV130 13 379500142
INV130 21 377719287
INV130 17 385022185
INV130 3 60281174
INV130 8 344365302
INV130 4 370341263
INV130 5 385484997
INV130 3 361480762
INV130 2 227816091
INV131 19 379365223
INV131 3 326627480
INV131 3 179785975
INV131 1 394411929
INV131 1 208357731
INV131 2 387387157
INV131 28 393959523
INV131 241 387119275
INV131 22 379489872
INV131 23 385909353
INV131 7 124975265
INV132 9 138772803
INV132 15 390696136
INV132 18 371915036
INV132 16 382295963
INV132 15 370940962
INV132 8 363964332
INV132 7 216076461
INV132 1 222508353
INV132 2 378391780
INV132 11 365473561
INV132 4 178163008
INV133 28 391443580
INV133 24 386512327
INV133 26 391903437
INV133 36 382490299
INV133 14 376797262
INV133 8 203772100
INV133 21 389229967
INV133 14 386982868
INV133 19 389026688
INV133 10 374195572
INV133 7 158156167
INV134 28 392100242
INV134 15 377259953
INV134 23 388223446
INV134 14 372625691
INV134 19 382678381
INV134 10 189595137
INV134 24 380015923
INV134 20 388962198
INV134 14 379590905
INV134 13 301439739
INV134 15 378313646
INV135 45 382097969
INV135 15 386611886
INV135 23 392780439
INV135 14 300976708
INV135 22 355579415
INV135 6 382504563
INV135 8 311266892
INV135 3 335903695
INV135 1 91272002
INV135 4 340601518
INV135 5 393178719
INV136 27 372689086
INV136 7 378352357
INV136 8 368654020
INV136 3 55757405
INV136 1 219663937
INV136 2 347956425
INV136 5 371419038
INV136 12 376377240
INV136 16 384236082
INV136 8 176370631
INV136 18 372019888
INV137 18 385206419
INV137 24 386509465
INV137 24 389713698
INV137 31 307760477
INV137 5 386523964
INV137 1 28255227
INV137 5 90894419
INV137 1 485851375
INV137 1 214862200
INV137 8 378994418
INV137 19 376407609
INV138 12 373566826
INV138 46 376414438
INV138 3 388122302
INV138 11 318389619
INV138 3 234762902
INV138 2 315919502
INV138 6 393647630
INV138 11 381373389
INV138 19 381074705
INV138 22 386497102
INV138 21 390526659
INV139 1 94407144
INV139 254 366101051
INV139 12 386296471
INV139 16 387655277
INV139 21 383151662
INV139 20 383401877
INV139 19 344640379
INV139 1 82766246
INV139 17 385091065
INV139 20 387924663
INV139 12 388536663
INV14 23 362467755
INV140 15 381614547
INV140 8 219178196
INV140 11 367097380
INV140 13 382777311
INV140 13 359364339
INV140 7 252534006
INV140 7 348359881
INV140 6 327698438
INV140 2 316788101
INV140 3 312494531
INV140 4 204379861
INV141 29 387067226
INV141 1 406294527
INV141 1 310928733
INV141 3 388958877
INV141 11 148169598
INV141 1 249786838
INV141 2 319646621
INV141 4 298015822
INV141 1 281865375
INV141 1 241717587
INV141 10 375364887
INV142 25 384930026
INV142 17 384501009
INV142 11 328663993
INV142 1 106314825
INV142 4 339541539
INV142 7 369695073
INV142 5 344800758
INV142 8 394204524
INV142 4 119862796
INV142 10 365101424
INV142 18 388033671
INV143 18 381070342
INV143 26 393220942
INV143 12 266980887
INV143 19 392458449
INV143 55 389557696
INV143 24 387260689
INV143 13 234291481
INV143 7 258353618
INV143 2 295700062
INV143 7 366943025
INV143 11 381355472
INV144 96888 235175056
INV144 4 106561761
INV144 19 343847635
INV144 17 382516650
INV144 2 332743733
INV144 6 313828708
INV144 16 380123343
INV144 45 361967714
INV144 3 372946856
INV144 7 266485410
INV144 18 382230867
INV145 124542 97379247
INV145 10 304685791
INV145 3 347667496
INV145 20 363448675
INV145 26 391194852
INV145 9 375785816
INV145 10 364023583
INV145 9 272133891
INV145 9 363725267
INV145 8 384234607
INV145 10 393372120
INV146 28942 319697553
INV146 40 329899252
INV146 6 337260709
INV146 5 383946385
INV146 12 302989156
INV146 19 376745921
INV146 15 386872820
INV146 19 377921066
INV146 21 391511415
INV146 5 268714484
INV146 2 354551436
INV147 28941 347133943
INV147 1 157299779
INV147 3 175039039
INV147 1 258850354
INV147 2 335699355
INV147 4 247610254
INV147 1 210654766
INV147 2 362253048
INV147 2 291631295
INV147 2 121261647
INV147 1 373316775
INV148 20 388604938
INV148 1 242235330
INV148 1 230154751
INV148 1 215250610
INV148 11 384181851
INV148 21 394628944
INV148 21 388317282
INV148 5 124958072
INV148 20 371325954
INV148 17 377167253
INV148 16 316992586
INV149 15 389699299
INV149 8 380596977
INV149 3 59344420
INV149 26 368094122
INV149 14 385505339
INV149 18 337616521
INV149 2 326309498
INV149 4 392502457
INV149 5 316388481
INV149 10 382487467
INV149 14 367500819
INV15 29 382177169
INV150 16 252138391
INV150 17 393579082
INV150 16 320660384
INV150 5 358120367
INV150 8 361433354
INV150 3 310200528
INV150 16 382164179
INV150 24 382990678
INV150 14 386676724
INV150 20 389628974
INV150 9 139734111
INV151 34 391108680
INV151 30 384304423
INV151 22 379619161
INV151 5 201083147
INV151 1 214309029
INV151 2 362516173
INV151 2 344553920
INV151 2 335374504
INV151 2 321615305
INV151 2 309892614
INV151 2 295904703
INV152 71 392017627
INV152 2 292629611
INV152 2 287511714
INV152 2 281066585
INV152 3 371349787
INV152 23 393225346
INV152 13 347530107
INV152 4 341473635
INV152 4 373447781
INV152 5 352685990
INV152 20 386769473
INV153 24 388974367
INV153 15 361943918
INV153 9 358194592
INV153 11 383437796
INV153 12 371566673
INV153 29 394011208
INV153 28 385746331
INV153 18 302475867
INV153 4 318142276
INV153 11 388330882
INV153 6 356025686
INV154 21 381982755
INV154 25 390407770
INV154 17 150566893
INV154 2 352537966
INV154 2 276070255
INV154 24 393379081
INV154 43 374993362
INV154 23 391094723
INV154 26 389040069
INV154 17 334905483
INV154 6 351795300
INV155 20 377528210
INV155 13 391964421
INV155 31 333085123
INV155 1 240654870
INV155 1 223236985
INV155 3 226917127
INV155 1 225692979
INV155 1 215602707
INV155 2 359154098
INV155 2 283138276
INV155 3 366799603
INV156 24 388990898
INV156 3 307774329
INV156 5 386006823
INV156 6 377763960
INV156 17 380578375
INV156 23 179650194
INV156 9 279714746
INV156 1 319955300
INV156 4 294686109
INV156 3 364144297
INV156 11 369858529
INV157 29 394663938
INV157 26 367540634
INV157 9 377516512
INV157 10 371704098
INV157 12 343109056
INV157 10 354589932
INV157 34 375616881
INV157 19 394326882
INV157 21 374608767
INV157 23 392617132
INV157 19 390763580
INV158 27 393364046
INV158 21 373694902
INV158 20 389092152
INV158 6 342447720
INV158 6 392638958
INV158 17 377689199
INV158 27 389728640
INV158 22 354327927
INV158 14 387821915
INV158 24 384209358
INV158 18 387080188
INV159 23 381713426
INV159 27 368588306
INV159 22 392029793
INV159 14 327862994
INV159 19 377119881
INV159 17 307555546
INV159 3 353482681
INV159 5 299619810
INV159 1 132666048
INV159 3 317464440
INV159 7 393544312
INV16 25 391264799
INV160 137 350719386
INV160 19 384876011
INV160 22 371202890
INV160 12 198837579
INV160 23 355220600
INV160 10 359923815
INV160 2 335082113
INV160 6 386079520
INV160 5 230433460
INV160 5 352992863
INV160 5 380688199
INV161 4 381900476
INV161 7 352664180
INV161 9 377429293
INV161 12 394660557
INV161 10 197942219
INV161 2 336892074
INV161 3 370983084
INV161 3 332872960
INV161 1 123574484
INV161 5 334741585
INV161 6 361874674
INV162 24 389620289
INV162 1 600392024
INV162 1 498054485
INV162 6 212627368
INV162 3 241875280
INV162 2 286554524
INV162 9 387182087
INV162 14 386910348
INV162 17 374265432
INV162 12 327252261
INV162 16 290303689
INV163 33 393229173
INV163 4 388534210
INV163 7 367452973
INV163 9 347348840
INV163 6 318055136
INV163 2 231996794
INV163 7 379250551
INV163 13 385052985
INV163 14 392864015
INV163 23 389418814
INV163 24 358524871
INV164 9 344807465
INV164 11 358125685
INV164 6 377157459
INV164 5 313090362
INV164 1 203836987
INV164 2 361472882
INV164 7 389230467
INV164 2 66154651
INV164 19 379925762
INV164 26 382380400
INV164 7 340680974
INV165 23 323415557
INV165 11 368263801
INV165 15 378509559
INV165 11 160650367
INV165 3 346301993
INV165 4 227914153
INV165 1 463878994
INV165 1 411919547
INV165 3 385717261
INV165 9 382692631
INV165 12 390490662
INV166 32 372756064
INV166 4 66996290
INV166 3 374261553
INV166 4 259154223
INV166 2 338881051
INV166 2 297311018
INV166 8 367421825
INV166 4 151351292
INV166 8 326797151
INV166 2 273333741
INV166 4 277445847
INV167 20 384740836
INV167 1 262796939
INV167 2 271972204
INV167 1 127864911
INV167 7 367980411
INV167 8 350419278
INV167 8 346802129
INV167 7 388895464
INV167 6 332687782
INV167 17 389980029
INV167 19 275721668
INV168 25 385708589
INV168 2 316756308
INV168 5 378077717
INV168 8 376434480
INV168 22 386292603
INV168 14 359535040
INV168 31 393401082
INV168 23 252185357
INV168 21 393889915
INV168 25 385063393
INV168 31 389476731
INV169 29 388680045
INV169 28 383285214
INV169 29 383108478
INV169 30 382677493
INV169 4 368098288
INV169 10 361306401
INV169 3 310174203
INV169 5 377713589
INV169 5 310344155
INV169 5 388826641
INV169 17 355257629
INV17 19 392660452
INV170 22 323658394
INV170 5 277866332
INV170 7 377579832
INV170 6 331962748
INV170 8 379965026
INV170 6 351494758
INV170 7 325767769
INV170 1 305569956
INV170 1 202803143
INV170 5 370802707
INV170 20 387233220
INV171 25 386606940
INV171 17 383557345
INV171 12 367544820
INV171 15 379680131
INV171 8 367593407
INV171 12 383019718
INV171 8 342062699
INV171 14 347824666
INV171 1 54263138
INV171 12 355903329
INV171 6 247193371
INV172 22 384360764
INV172 2 339071690
INV172 2 311526032
INV172 11 376067292
INV172 15 392012949
INV172 14 382723066
INV172 21 393287380
INV172 30 386815739
INV172 4 70209508
INV172 20 393833935
INV172 23 371772514
INV173 22 375170759
INV173 36 378152407
INV173 7 361576036
INV173 3 144800141
INV173 12 386123069
INV173 18 379682883
INV173 24 376237200
INV173 18 382676377
INV173 10 136249824
INV173 17 376448086
INV173 24 392500034
INV174 31 394116451
INV174 23 358451346
INV174 12 387353786
INV174 9 196688578
INV174 7 352292992
INV174 10 379488587
INV174 22 377064691
INV174 16 383674032
INV174 5 109367460
INV174 18 286866675
INV174 3 347598182
INV175 20 281624502
INV175 5 338175262
INV175 4 383058601
INV175 1 247560496
INV175 4 303728199
INV175 1 271964629
INV175 1 239161613
INV175 2 386396440
INV175 2 162310632
INV175 1 370326948
INV175 3 388116385
INV176 11 364532943
INV176 6 377917711
INV176 5 354494059
INV176 7 379606228
INV176 12 240888112
INV176 28 359911917
INV176 7 236235409
INV176 2 379651703
INV176 2 347329764
INV176 2 321027264
INV176 2 301226685
INV177 14 378464462
INV177 1 146202077
INV177 2 275982907
INV177 8 379231808
INV177 13 381766812
INV177 1 195322241
INV177 2 321367667
INV177 2 287611822
INV177 3 363118937
INV177 151 318674679
INV177 3 211854900
INV178 38 390437780
INV178 8 376981019
INV178 7 363245700
INV178 6 378101022
INV178 5 256321261
INV178 18 388042686
INV178 23 382786746
INV178 13 372130825
INV178 25 317222528
INV178 1 138004034
INV178 3 360707963
INV179 20 259303673
INV179 4 357311906
INV179 5 346948291
INV179 14 370286180
INV179 7 318431914
INV179 26 393842626
INV179 22 386509625
INV179 10 353087157
INV179 10 387832607
INV179 10 373670327
INV179 4 333077632
INV18 20 372860966
INV180 35 382133951
INV180 5 364543032
INV180 6 393941015
INV180 6 353983694
INV180 7 378037394
INV180 7 341953960
INV180 10 353005371
INV180 16 394332096
INV180 34 394329872
INV180 22 222473678
INV180 1 276355679
INV181 38912 329097860
INV181 1 217944636
INV181 1 197031954
INV181 5 380718072
INV181 2 341485480
INV181 2 308085231
INV181 2 281366780
INV181 3 343008649
INV181 6 394632706
INV181 15 88517410
INV181 40 393860896
INV182 150897 102338830
INV182 21 389178549
INV182 23 390279201
INV182 11 366024924
INV182 15 383815095
INV182 6 233774553
INV182 5 318744297
INV182 1 271406195
INV182 1 240115956
INV182 1 234010456
INV182 1 222850789
INV183 33143 23766450
INV183 1 222041990
INV183 1 214774154
INV183 1 208864772
INV183 2 385457695
INV183 1 173785391
INV183 2 328914304
INV183 2 280661178
INV183 3 348023719
INV183 3 321038252
INV183 4 383266743
INV184 149054 103688283
INV184 4 360652640
INV184 3 225220179
INV184 5 343830006
INV184 19 391034512
INV184 33 377901333
INV184 3 285907573
INV184 5 365873602
INV184 12 352551386
INV184 13 388990812
INV184 20 378129919
INV185 152024 116275272
INV185 3 74847337
INV185 19 384569499
INV185 164 363844843
INV185 25 388002625
INV185 24 394108272
INV185 25 388456233
INV185 7 189882940
INV185 12 374058399
INV185 13 369064937
INV185 22 386405232
INV186 122365 84058081
INV186 46 380037167
INV186 14 385050370
INV186 20089 220418311
INV187 154877 113577401
INV188 153318 120331979
INV189 54949 36671310
INV19 37209 127015937
INV190 153092 110242305
INV191 153398 114918009
INV192 39145 33919171
INV193 141663 88564577
INV194 147685 93928644
INV195 44883 33915010
INV196 148165 97285400
INV197 139432 81643923
INV198 42661 25296150
INV199 138615 82881829
INV2 2291 316412759
INV20 129080 165753959
INV200 138426 82991925
INV201 52979 35047492
INV202 139291 83577925
INV203 135371 98983171
INV204 74599 58389158
INV205 141943 107980743
INV206 149727 121383217
INV207 155505 117823416
INV208 118719 183817499
INV209 35616 86282658
INV21 207 346774014
INV210 181112 235169059
INV211 218151 167649786
INV212 38629 187147326
INV213 800 42674647
INV214 566 40635863
INV215 8037 115580217
INV216 23265 332345847
INV217 23319 172531536
INV218 67585 303875862
INV219 121343 264933975
INV22 93 331307518
INV220 66775 80327893
INV221 180562 231780487
INV222 41599 303967104
INV223 314 393292454
INV224 1015 105322314
INV225 2059 383654064
INV226 2 41011863
INV227 591 361654729
INV228 8 378508614
INV229 974 354275690
INV23 3 136766944
INV230 6 380479040
INV231 2 95552909
INV232 22 390382246
INV233 10036 362338941
INV234 376 361065125
INV235 200 339574406
INV236 28 363750328
INV237 25 362372590
INV238 18 224818646
INV239 552 321019135
INV24 14 359428768
INV240 2 371500015
INV241 2 289902239
INV242 2965 358959205
INV243 59309 333102202
INV244 34 383065485
INV245 19 393344928
INV246 14 327270017
INV247 27 393651567
INV248 32 390738662
INV249 24 383706815
INV25 9 363281720
INV250 25 382049854
INV251 31 378115211
INV252 13 297748085
INV253 18 387848062
INV254 24 381271345
INV255 36 390867092
INV256 34 389743485
INV257 26 391141334
INV258 19 292893418
INV259 11 371260264
INV26 52 355336707
INV260 19 391738075
INV261 12 391781067
INV262 13 372901688
INV263 32 389502535
INV264 22 330410978
INV265 29 389284801
INV266 38 387663352
INV267 17 367589223
INV268 12 387517245
INV269 17 362786034
INV27 14 371434550
INV270 10 320557524
INV271 13 376469258
INV272 35 380323776
INV273 26 392110960
INV274 24 388964019
INV275 21 391745060
INV276 22 309540561
INV277 27 392282931
INV278 24 388632304
INV279 12 375724207
INV28 78 134821644
INV280 16 393313708
INV281 13 392068868
INV282 10 277290815
INV283 15 358735036
INV284 11 386907833
INV285 40 377177573
INV286 21 392427759
INV287 5 215849302
INV288 15 382505853
INV289 743 382889760
INV29 6 384224499
INV290 26 386022184
INV291 28 394591284
INV292 7 307846648
INV293 4 182170525
INV294 2 342421305
INV295 2 269826459
INV296 18 385786230
INV297 1901 346423954
INV298 8862 318236250
INV299 11615 311304128
INV3 104315 181652316
INV30 14 390998271
INV300 29313 84782847
INV301 137007 98938577
INV302 129604 76455969
INV303 119655 73653149
INV304 151081 93749327
INV305 144113 102739864
INV306 68663 59261874
INV307 151292 123308784
INV308 150035 121848111
INV309 87026 70797368
INV31 25 372322353
INV310 149122 116254473
INV311 142888 122176042
INV312 101976 123043180
INV313 142073 131912978
INV314 144087 117375612
INV315 101135 179749872
INV316 1904 379068870
INV317 3187 259260839
INV318 96781 321023124
INV319 217342 232110336
INV32 18 383937723
INV320 60949 250981301
INV321 103988 292596017
INV322 28973 364551361
INV323 1764 378352969
INV324 2739 197024699
INV325 184144 268358078
INV326 1785 378880292
INV327 5583 374469857
INV328 20768 153711624
INV329 288223 205808194
INV33 26 392368732
INV330 1224 379793465
INV331 4515 373876603
INV332 92490 210334617
INV333 391527 140904810
INV334 109733 258294965
INV335 80040 286704883
INV336 3569 375757529
INV337 31480 357683960
INV338 16121 41281259
INV339 298725 199657065
INV34 36 374901277
INV340 214334 249067665
INV341 2226 377046597
INV342 19303 366955288
INV343 16948 41978773
INV344 298408 186907243
INV345 1355 379516794
INV346 3687 378313727
INV347 136930 300095839
INV348 38349 357698579
INV349 664 92151452
INV35 4 251686535
INV350 8529 370827851
INV351 197744 256830145
INV352 359558 128682792
INV353 93023 322972837
INV354 2568 378355489
INV355 61847 343439542
INV356 72069 24187260
INV357 120471 75688752
INV358 94927 39113285
INV359 95395 36856289
INV36 3 241225934
INV360 96300 35428309
INV361 95315 37549073
INV362 23262 12375863
INV363 95730 37222297
INV364 111003 72746155
INV365 139266 111932316
INV366 11756 9561349
INV367 145716 131129708
INV368 146118 121028931
INV369 17690 351348620
INV37 3 393880593
INV370 9 121813966
INV371 15 379655485
INV372 6 355188453
INV373 1 239744465
INV374 1 231634122
INV375 1 221096292
INV376 1 220877407
INV377 1 216720617
INV378 1 210676062
INV379 2 387811394
INV38 3 261336042
INV380 2 329972158
INV381 2 302384449
INV382 20 360081608
INV383 9 301825222
INV384 23 382490317
INV385 23 380735444
INV386 18 387931948
INV387 33 390736486
INV388 795 381170065
INV389 20 391287680
INV39 3 322765503
INV390 2 32244328
INV391 27 388830496
INV392 21 386972019
INV393 9 351834369
INV394 5 163634948
INV395 1 292306469
INV396 1 164045107
INV397 2 318230244
INV398 868 391036523
INV399 30 390895475
INV4 59678 271717887
INV40 2 265971290
INV400 25 383908286
INV401 25 388289419
INV402 3 49480870
INV403 25 384967191
INV404 26 391463882
INV405 22 392427991
INV406 26 383547221
INV407 26 265978999
INV408 6 371290168
INV409 13 374069663
INV41 4 328757598
INV410 19 385560269
INV411 15 373391572
INV412 13 350978987
INV413 22 386100611
INV414 24 386055502
INV415 23 389090030
INV416 31 366704932
INV417 12 307588661
INV418 24 393914970
INV419 16 362929629
INV42 5 378753109
INV420 8 361035446
INV421 13 369493806
INV422 13 384884009
INV423 18 390461886
INV424 22 394170044
INV425 11 336163521
INV426 6 353407420
INV427 7 372089599
INV428 3 84055545
INV429 9 390327029
INV43 5 371191486
INV430 19 393988728
INV431 11 137914990
INV432 1 346874609
INV433 1 248688513
INV434 1 195213701
INV435 21 389226046
INV436 16 380802157
INV437 17 384888603
INV438 24 390785021
INV439 14 272669524
INV44 4 376987297
INV440 19 394017224
INV441 17 391933486
INV442 7 291754234
INV443 2 360067285
INV444 1 158111693
INV445 5 390880948
INV446 1 269711166
INV447 1 265788494
INV448 5 389225578
INV449 8 84827761
INV45 4 293537168
INV450 32 385135770
INV451 29 391336068
INV452 26 380265073
INV453 8 257485661
INV454 20 383534134
INV455 18 388997674
INV456 13 372064491
INV457 12 246225518
INV458 18 394216238
INV459 18 380558243
INV46 4 373434888
INV460 10 378653212
INV461 35 286756574
INV462 57 386542022
INV463 41 394290459
INV464 30 391877099
INV465 23 388833300
INV466 17 384297034
INV467 310 391634117
INV468 26 381054851
INV469 8 105967983
INV47 42 369246043
INV470 29 389236155
INV471 23 387510109
INV472 25 393194949
INV473 29 393406758
INV474 10 389413895
INV475 12 256001243
INV476 25 382453876
INV477 25 387644779
INV478 17 390017898
INV479 13 185974631
INV48 71 345464815
INV480 1 252586203
INV481 2 382245123
INV482 1 170640157
INV483 3 172715237
INV484 1 265601162
INV485 1 235131548
INV486 8 377013040
INV487 18 389308576
INV488 6 76294397
INV489 2 316929497
INV49 11 126310825
INV490 5 371999024
INV491 13 377525467
INV492 22 380131966
INV493 4 94235370
INV494 20 386111019
INV495 10 330750052
INV496 8 388492156
INV497 29 385235322
INV498 3 68204675
INV499 1 375708846
INV5 85 394194283
INV50 33 389894099
INV500 177 377903380
INV501 3 72566929
INV502 18 393806697
INV503 12 375328864
INV504 13 388485421
INV505 17 389690952
INV506 10 355855682
INV507 12 388165924
INV508 5 66893570
INV509 2 334507981
INV51 24 300399380
INV510 2 271847796
INV511 9 384970046
INV512 14 380331769
INV513 17 331062789
INV514 4 353245537
INV515 5 361980503
INV516 1 66459093
INV517 6 375950524
INV518 11 380698960
INV519 13 393299321
INV52 7 368066952
INV520 16 371834617
INV521 4 107829629
INV522 16 390859621
INV523 35 393136677
INV524 18 389411089
INV525 80 348191458
INV526 10 366985680
INV527 18 382945053
INV528 3 55752453
INV529 23 351194891
INV53 17 353983817
INV530 4 361297550
INV531 19 383086968
INV532 16 391635138
INV533 22 382293034
INV534 15 196098011
INV535 12 326431359
INV536 3 345780114
INV537 4 385052575
INV538 6 392605260
INV539 17 135120912
INV54 7 374779506
INV540 1 319032388
INV541 1 282837000
INV542 1 278321370
INV543 1 265031889
INV544 1 264456228
INV545 1 255727343
INV546 1 255305493
INV547 1 230784347
INV548 9 392641003
INV549 28 356306819
INV55 1 208110490
INV550 2 278332741
INV551 8 361353987
INV552 10 379658367
INV553 13 380787037
INV554 8 386860579
INV555 6 361028373
INV556 3 168396230
INV557 7 375518624
INV558 10 375539956
INV559 5 355133492
INV56 2 302887577
INV560 12 346368422
INV561 4 128335036
INV562 18 344289019
INV563 6 343424801
INV564 6 355424926
INV565 9 361129815
INV566 1 209131117
INV567 2 365485920
INV568 2 326453370
INV569 2 310804349
INV57 3 341397147
INV570 3 355594170
INV571 7 341653095
INV572 49 372335313
INV573 6 201861407
INV574 19 385553829
INV575 11 389495243
INV576 41 318939638
INV577 7 359994759
INV578 11 363361177
INV579 18 352506103
INV58 3 306059974
INV580 2 121342079
INV581 11 370878851
INV582 38 392392993
INV583 39 383674587
INV584 29 392907305
INV585 24 381869223
INV586 13 164951452
INV587 41 380881169
INV588 15 386326246
INV589 9 137942415
INV59 4 375190511
INV590 1 410988561
INV591 2 347081175
INV592 2 60458881
INV593 1 429819325
INV594 1 230177572
INV595 2 394052085
INV596 35 354776612
INV597 7 318208416
INV598 5 336561253
INV599 7 357043306
INV6 84 293302731
INV60 4 333576383
INV600 7 262116983
INV601 1 170575982
INV602 2 287036945
INV603 2 275604705
INV604 3 367947227
INV605 3 342256987
INV606 5 256835876
INV607 13 321847088
INV608 5 332460113
INV609 95 319933371
INV61 5 348361494
INV610 12 328718900
INV611 9 217598510
INV612 20 352503315
INV613 9 379049671
INV614 14 374215308
INV615 15 347131978
INV616 3 328312092
INV617 4 369177951
INV618 3 246468438
INV619 5 376372316
INV62 14 387211070
INV620 11 376604103
INV621 17 381822991
INV622 22 391138986
INV623 6 54648714
INV624 12 377183847
INV625 30 388952266
INV626 3 326197890
INV627 3 271412684
INV628 6 360181556
INV629 18 382522482
INV63 13 392726641
INV630 24 379871629
INV631 21 312971658
INV632 22 381784561
INV633 21 380590911
INV634 13 371720425
INV635 17 390781836
INV636 3 78204341
INV637 17 377301939
INV638 12 357316205
INV639 6 368644317
INV64 66 317360954
INV640 9 270151474
INV641 12 189039214
INV642 1 244108438
INV643 1 210424776
INV644 2 347597490
INV645 2 286016373
INV646 2 120783828
INV647 22 392193755
INV648 13 360806743
INV649 11 375564408
INV65 4 328154363
INV650 9 362288897
INV651 3 377576368
INV652 4 158823784
INV653 12 376095937
INV654 6 372905819
INV655 7 388366567
INV656 7 351386075
INV657 12 377915288
INV658 10 168222845
INV659 21 336280653
INV66 3 230854823
INV660 11 387853015
INV661 17 383594904
INV662 12 371624632
INV663 4 205127384
INV664 1 255265360
INV665 1 230794410
INV666 2 372619140
INV667 2 311523487
INV668 13 393665610
INV669 24 199571394
INV67 5 362121003
INV670 2 323510804
INV671 12 381394394
INV672 12 281321844
INV673 6 301645505
INV674 3 327580854
INV675 2 283053804
INV676 4 358883688
INV677 3 313487646
INV678 12 372628339
INV679 11 296511468
INV68 211 385264302
INV680 12 205288598
INV681 1 329103898
INV682 1 266482116
INV683 1 255371252
INV684 1 249620899
INV685 11 381319634
INV686 28 382489592
INV687 15 383181010
INV688 13 350686833
INV689 1 90894639
INV69 55 389266884
INV690 5 367141834
INV691 4 355766912
INV692 6 390997169
INV693 1 283143227
INV694 7 385962722
INV695 18 390420686
INV696 14 352409616
INV697 3 310319640
INV698 1 94671628
INV699 4 375545906
INV7 170 364968923
INV70 16 251967525
INV700 2 330374624
INV701 9 385008187
INV702 36 348936130
INV703 7 362657616
INV704 12 375776805
INV705 21 386373372
INV706 28 385558874
INV707 2 30875957
INV708 30 377576257
INV709 16 383023174
INV71 24 388112032
INV710 25 385163881
INV711 20 289852567
INV712 11 387811488
INV713 13 388478264
INV714 20 388641472
INV715 37 387165660
INV716 14 208952549
INV717 33 393285708
INV718 13 364621498
INV719 12 378544770
INV72 39 380190174
INV720 14 393303348
INV721 17 283001740
INV722 25 393022599
INV723 6 259595995
INV724 2 306898484
INV725 22 392724989
INV726 11 81108636
INV727 1 334972678
INV728 1 327956322
INV729 4 369938243
INV73 33 379073437
INV730 10 387945021
INV731 6 333511012
INV732 3 390034570
INV733 6 388490213
INV734 37 293380102
INV735 3 330508129
INV736 3 304092200
INV737 4 386935527
INV738 16 364918260
INV739 10 392609098
INV74 50 299834692
INV740 30 381546124
INV741 2 331139274
INV742 5 390800394
INV743 2 93184197
INV744 9 363742103
INV745 11 374818742
INV746 13 353874383
INV747 29 353592845
INV748 6 313902203
INV749 2 325968719
INV75 20 393500649
INV750 2 326866526
INV751 2 294862287
INV752 2 277963616
INV753 1 135489923
INV754 5 389105293
INV755 21 334259074
INV756 19 374293438
INV757 21 257681977
INV758 15 378008119
INV759 18 345890599
INV76 19 386117294
INV760 9 374177525
INV761 13 282334662
INV762 13 367448714
INV763 14 383036237
INV764 9 337662876
INV765 4 285079875
INV766 13 380626621
INV767 20 391060643
INV768 17 236492487
INV769 1 253604678
INV77 20 393838616
INV770 1 244180387
INV771 2 385719063
INV772 2 323852856
INV773 3 391496974
INV774 69 343048078
INV775 3 58690555
INV776 1 427500052
INV777 1 280788551
INV778 1 231232069
INV779 2 365961697
INV78 9 185353717
INV780 2 306037738
INV781 2 294194033
INV782 8 383537417
INV783 10 382401646
INV784 15 373941744
INV785 2 278659155
INV786 5 350216916
INV787 5 342671345
INV788 7 377861791
INV789 14 385594223
INV79 16 368214362
INV790 25 241789371
INV791 2 304382108
INV792 5 380650692
INV793 6 108274197
INV794 30 387029729
INV795 27 330887562
INV796 3 314705854
INV797 4 344406745
INV798 5 389867528
INV799 5 353121931
INV8 5 352575630
INV80 17 373531597
INV800 14 392298773
INV801 2 53978732
INV802 17 382363442
INV803 13 374918202
INV804 15 379396417
INV805 103 385952128
INV806 20 386688731
INV807 18 382007266
INV808 57 153866701
INV809 5 219711870
INV81 17 378099553
INV810 2 319873814
INV811 6 380185718
INV812 3 381341903
INV813 1 111009446
INV814 5 379226736
INV815 12 393993623
INV816 22 391120037
INV817 20 316738233
INV818 1 263587734
INV819 2 374750442
INV82 11 222599361
INV820 2 338140745
INV821 2 298578205
INV822 5 384869169
INV823 30 387739996
INV824 13 296449972
INV825 18 279137441
INV826 2 322765580
INV827 3 390029089
INV828 4 345523436
INV829 2 287481868
INV83 17 378099553
INV830 3 368157705
INV831 4 330380185
INV832 2 273986171
INV833 11 380263283
INV834 21 357807916
INV835 12 391993231
INV836 8 369418028
INV837 9 378821074
INV838 10 378877305
INV839 2 122089777
INV84 18 381766905
INV840 7 366744808
INV841 18 393384596
INV842 28 374632208
INV843 17 380406226
INV844 10 104480107
INV845 1 298134333
INV846 6 372478433
INV847 7 273110839
INV848 1 174811163
INV849 1 246577358
INV85 18 381766905
INV850 3 380592957
INV851 8 336515494
INV852 5 388249994
INV853 7 360174377
INV854 8 393835422
INV855 7 326451249
INV856 18 390226185
INV857 4 212448392
INV858 2 361639366
INV859 11 389090510
INV86 11 244247504
INV860 24 261483440
INV861 20 187767331
INV862 1 300440965
INV863 1 255158195
INV864 1 235639307
INV865 1 234027751
INV866 5 364518894
INV867 1 52122333
INV868 17 394627877
INV869 24 372312688
INV87 18 381766905
INV870 5 353472817
INV871 6 348815087
INV872 3 142239958
INV873 10 371554285
INV874 10 389038857
INV875 15 393343847
INV876 354 351174080
INV877 61 370950558
INV878 13 377490054
INV879 17 362779264
INV88 18 381766905
INV880 1 215246178
INV881 1 179976030
INV882 2 326215908
INV883 12 393295794
INV884 17 355147463
INV885 7 364022270
INV886 8 232711543
INV887 10 320236834
INV888 5 374560279
INV889 5 347050153
INV89 17 378099553
INV890 6 365683735
INV891 8 350757240
INV892 8 330705725
INV893 7 319315304
INV894 8 294380847
INV895 8 300070536
INV896 5 296140165
INV897 7 321898042
INV898 8 344779364
INV899 5 204172647
INV9 7 383441747
INV90 10 214458835
INV900 8 363714706
INV901 8 335684798
INV902 7 325614821
INV903 8 343203705
INV904 8 295765726
INV905 4 296872836
INV906 1 277791574
INV907 2 374437900
INV908 3 384355230
INV909 4 287970803
INV91 17 373531597
INV910 8 310860357
INV911 1 87642240
INV912 3 322074102
INV913 5 350860081
INV914 3 341421742
INV915 3 303252646
INV916 3 274953531
INV917 5 354560190
INV918 4 293401691
INV919 5 291612199
INV92 17 376354888
INV920 6 363161146
INV921 7 367190402
INV922 1 63881323
INV923 7 369938164
INV924 24 385109501
INV925 29 371254400
INV926 3 369936174
INV927 3 324539581
INV928 4 365244967
INV929 5 389493350
INV93 17 378128112
INV930 6 394661900
INV931 13 382083182
INV932 31 381763837
INV933 28 392125926
INV934 4 128300843
INV935 4 359450428
INV936 5 357390477
INV937 10 360971319
INV938 10 388368184
INV939 12 376602273
INV94 11 244218945
INV940 78 347723211
INV941 3 159381941
INV942 8 277689252
INV943 2 308292894
INV944 4 378776770
INV945 3 224250587
INV946 2 353669327
INV947 3 365790299
INV948 5 373092601
INV949 25 383158187
INV95 18 377201651
INV950 13 390048803
INV951 10 389033966
INV952 13 387771417
INV953 15 383558849
INV954 8 145928775
INV955 16 387212131
INV956 17 373736547
INV957 10 387894809
INV958 13 380870662
INV959 36 385258928
INV96 19 384750213
INV960 13 163501620
INV961 28 381827489
INV962 22 374847337
INV963 2 310213387
INV964 4 223537066
INV965 1 311186714
INV966 4 305252952
INV967 1 117261666
INV968 4 325431757
INV969 5 343105299
INV97 19 386574986
INV970 8 390057518
INV971 11 390412576
INV972 18 344362951
INV973 4 389304644
INV974 8 374713972
INV975 4 67335450
INV976 1 354881887
INV977 1 306296502
INV978 2 379020699
INV979 10 369838626
INV98 11 217953999
INV980 2 26750373
INV981 1 249865697
INV982 3 387636064
INV983 14 388824602
INV984 16 387485480
INV985 8 379220830
INV986 6 382970618
INV987 3 146110617
INV988 10 369487108
INV989 12 390659631
INV99 18 390383119
INV990 23 390394397
INV991 25 366663447
INV992 15 378170753
INV993 12 180879245
INV994 22 392034752
INV995 12 386348701
INV996 10 373953727
INV997 6 388811552
INV998 25 386609090
INV999 13 334938607
MAM1 32379 323874651
MAM10 26814 24994146
MAM100 5 369689861
MAM101 5 392803577
MAM102 6 298207437
MAM103 3 363734450
MAM104 1 118519168
MAM105 3 328935722
MAM106 4 359964523
MAM107 4 383777488
MAM108 5 381968701
MAM109 4 345040697
MAM11 13731 20581276
MAM110 3 176472919
MAM111 6 356825309
MAM112 3 354814440
MAM113 3336 333279354
MAM114 67905 268565277
MAM115 99249 191859317
MAM116 31558 287425325
MAM117 4 274800947
MAM118 4 294612101
MAM119 4 368804057
MAM12 3445 7368868
MAM120 5 360824188
MAM121 3 381844289
MAM122 4 323611747
MAM123 5 314441637
MAM124 278 273083750
MAM125 1 216965501
MAM126 1 210729441
MAM127 2 349064804
MAM128 2 311803703
MAM129 2 284093331
MAM13 107 699953
MAM130 3 348809871
MAM131 4 369368223
MAM132 5 363867118
MAM133 1 61486999
MAM134 391 303038843
MAM135 2 387082860
MAM136 2 304198725
MAM137 3 374133223
MAM138 3 326166110
MAM139 4 378433792
MAM14 20 277696380
MAM140 4 343736516
MAM141 26 156134288
MAM142 2 295910882
MAM143 3 365955123
MAM144 3 347352947
MAM145 3 322237442
MAM146 4 341689478
MAM147 5 362834364
MAM148 7 390905713
MAM149 3 258595851
MAM15 1 249270926
MAM150 2 333773690
MAM151 3 387942990
MAM152 3 354718536
MAM153 2 226942227
MAM154 3 311333393
MAM155 4 346893067
MAM156 5 358087510
MAM157 7 370527586
MAM158 141 52864919
MAM159 2 381699852
MAM16 2 343930246
MAM160 2 379453767
MAM161 2 323756069
MAM162 3 363198547
MAM163 2 215864552
MAM164 4 373314142
MAM165 5 370562270
MAM166 3 229138897
MAM167 2 357862388
MAM168 1 148378616
MAM169 2 277983130
MAM17 3 325384739
MAM170 3 347551233
MAM171 3 317094091
MAM172 4 359797234
MAM173 5 367203739
MAM174 2 35182349
MAM175 3 344892062
MAM176 3 310823791
MAM177 4 343820600
MAM178 5 380959867
MAM179 5 326724081
MAM18 1 90795278
MAM180 2 125670854
MAM181 6 349136452
MAM182 5 249014812
MAM183 4 263893466
MAM184 2 255070854
MAM185 2 283025985
MAM186 3 333227068
MAM187 3 347405297
MAM188 3 311786266
MAM189 3 370283980
MAM19 4 322903327
MAM190 3 367382503
MAM191 3 376930704
MAM192 2 186941709
MAM193 1 212679785
MAM194 1 200210433
MAM195 2 301321370
MAM196 2 204542634
MAM197 4 342554685
MAM198 6 373951174
MAM199 9 394516191
MAM2 22268 277085082
MAM20 4 298795355
MAM200 1 178365832
MAM201 2 317576479
MAM202 3 382289813
MAM203 3 333151314
MAM204 4 387058184
MAM205 1 88847605
MAM206 5 393069609
MAM207 5 297820775
MAM208 2 370199356
MAM209 2 296330659
MAM21 6 353843759
MAM210 3 378321649
MAM211 3 341779801
MAM212 4 389646286
MAM213 3 260392119
MAM214 5 252937523
MAM215 1 210889723
MAM216 2 390094915
MAM217 3 369279389
MAM218 1 134025529
MAM219 3 382647393
MAM22 5 329700903
MAM220 3 348525342
MAM221 4 385414949
MAM222 8 367669076
MAM223 3 338644129
MAM224 4 384410696
MAM225 4 321255648
MAM226 5 366955574
MAM227 2 129330055
MAM228 6 369468462
MAM229 7 368094007
MAM23 2 289079565
MAM230 3 278321486
MAM231 2 356989359
MAM232 2 294642091
MAM233 3 374469516
MAM234 3 321593661
MAM235 4 372512269
MAM236 5 394669051
MAM237 6 352162926
MAM238 3 338100906
MAM239 3 320896055
MAM24 3 348530310
MAM240 4 391714968
MAM241 5 389929348
MAM242 10 346252126
MAM243 1 234112155
MAM244 1 222567163
MAM245 2 360432915
MAM246 3 330590648
MAM247 4 366004254
MAM248 5 346781633
MAM249 18 241194090
MAM25 4 336581445
MAM250 1 248793850
MAM251 1 230256221
MAM252 1 228110630
MAM253 2 379305370
MAM254 2 357708012
MAM255 2 332346077
MAM256 8 383124560
MAM257 1 188105751
MAM258 2 350144535
MAM259 2 286698385
MAM26 5 375256260
MAM260 3 356425192
MAM261 3 316253659
MAM262 4 371964282
MAM263 5 393252436
MAM264 4 100914822
MAM265 1 217416870
MAM266 1 206141883
MAM267 2 387441900
MAM268 2 314669017
MAM269 2 288652274
MAM27 6 373952570
MAM270 3 377887044
MAM271 4 388342449
MAM272 8036 263383893
MAM28 8 377813420
MAM29 5 379300313
MAM3 2 316219032
MAM30 1 38035513
MAM31 5 285741626
MAM32 5 342804543
MAM33 8 370485433
MAM34 6 316655225
MAM35 4 238884849
MAM36 4 355768297
MAM37 6 355037276
MAM38 7 389945117
MAM39 6 319172640
MAM4 2 376685399
MAM40 5 323047396
MAM41 4 347221982
MAM42 5 288444151
MAM43 5 375232988
MAM44 5 248962388
MAM45 1 277956744
MAM46 1 154038104
MAM47 3 374028897
MAM48 2 298256496
MAM49 3 355148320
MAM5 2 295769989
MAM50 3 355658200
MAM51 3 369352591
MAM52 7 388919640
MAM53 1 59476289
MAM54 2 289417684
MAM55 1 221841827
MAM56 2 345133505
MAM57 2 274271110
MAM58 3 354610750
MAM59 3 316782920
MAM6 2 385026516
MAM60 13 382926794
MAM61 54 7614329
MAM62 215 34073042
MAM63 431 71272130
MAM64 861 68509101
MAM65 1706 2411269
MAM66 6879 6176592
MAM67 110526 193403794
MAM68 33191 281608286
MAM69 4 358286156
MAM7 3 316699161
MAM70 5 387739617
MAM71 5 335893012
MAM72 6 364021592
MAM73 6 304412506
MAM74 10 386743576
MAM75 132573 153972381
MAM76 117935 169478038
MAM77 8496 7426311
MAM78 1 716413629
MAM79 1 662751787
MAM8 5 343489620
MAM80 1 611347268
MAM81 1 464895054
MAM82 1 288121652
MAM83 3 338107697
MAM84 1 223449203
MAM85 1 210645437
MAM86 1 201318998
MAM87 1 197708286
MAM88 2 320231256
MAM89 2 293750401
MAM9 933 216317382
MAM90 3 367535284
MAM91 4 351244600
MAM92 367 269065793
MAM93 1 203623556
MAM94 2 383513587
MAM95 4 383666147
MAM96 5 381503248
MAM97 263 390074346
MAM98 2 265153725
MAM99 4 366992153
PAT1 420060 157354283
PAT10 304138 130867531
PAT100 352852 189327041
PAT101 310862 206556098
PAT102 261889 226571161
PAT103 130469 96637053
PAT104 304402 217824161
PAT105 276793 236021165
PAT106 255575 243191966
PAT107 219302 91982645
PAT108 185286 167791554
PAT109 193743 145685458
PAT11 236000 217102698
PAT110 99369 56253543
PAT111 244010 110313663
PAT112 143101 226372350
PAT113 78462 27199293
PAT114 88270 271848197
PAT115 224845 124890764
PAT116 225595 104795482
PAT117 1438 4521973
PAT118 247765 75673289
PAT119 230776 33741646
PAT12 83481 75660869
PAT120 94886 123403652
PAT121 98574 119749391
PAT122 81936 115812708
PAT123 202979 107720634
PAT124 26273 9055851
PAT125 203753 100524714
PAT126 183494 80758738
PAT127 117402 19496593
PAT128 249514 208801641
PAT129 384339 114595216
PAT13 242994 211781414
PAT130 54376 7592936
PAT131 283234 179644992
PAT132 123902 298028332
PAT133 110603 304050297
PAT134 393154 122356229
PAT135 289903 158317133
PAT136 13444 9053266
PAT137 287137 182628882
PAT138 409364 14056923
PAT139 496790 33315054
PAT14 328208 148438838
PAT140 525210 7878150
PAT141 153480 3896903
PAT142 377383 123749333
PAT143 245739 106353938
PAT144 259895 238802744
PAT145 4634 392128968
PAT146 190899 207809354
PAT147 308470 120437803
PAT148 140524 153724833
PAT149 6434 91722304
PAT15 63798 1594950
PAT150 177885 181303248
PAT151 71547 185116657
PAT152 75797 115786173
PAT153 75754 115775578
PAT154 46230 38674753
PAT155 245081 68541184
PAT156 202132 63183317
PAT157 264557 57807328
PAT158 309555 83973857
PAT159 458769 54678316
PAT16 197467 165309742
PAT160 227775 118065838
PAT161 359505 132219033
PAT162 288076 50680518
PAT163 154910 4648005
PAT164 228342 77240328
PAT165 228222 72940292
PAT166 281346 18592211
PAT167 65059 7149742
PAT168 153380 170208828
PAT169 73414 134988828
PAT17 217861 141775743
PAT170 74138 123431971
PAT171 137210 84284016
PAT172 175218 2628270
PAT173 233543 99258108
PAT174 198424 145045453
PAT175 229757 110455331
PAT176 105674 68106468
PAT177 80124 122466507
PAT178 260804 46028890
PAT179 294811 4422165
PAT18 217806 104610120
PAT180 7895 118425
PAT181 278538 10765362
PAT182 99587 135915370
PAT183 220908 105875885
PAT184 23922 35278744
PAT185 143999 206566501
PAT186 173285 186742155
PAT187 70129 243259642
PAT188 6542 8869371
PAT189 137168 133366031
PAT19 238917 105580979
PAT190 136589 204923242
PAT191 208571 98960049
PAT192 284102 31395277
PAT193 26291 42269637
PAT194 264589 66935450
PAT195 227269 82111943
PAT196 179588 5746816
PAT197 194345 81150973
PAT198 52348 9088648
PAT199 82690 146051882
PAT2 329678 203029667
PAT20 217485 131790681
PAT200 75930 116106222
PAT201 76058 115438165
PAT202 205771 85563217
PAT203 2801 56020
PAT204 342231 6844620
PAT205 341891 7168782
PAT206 341071 7503562
PAT207 331154 110021550
PAT208 268658 230373189
PAT209 282624 222310160
PAT21 295531 53380168
PAT210 192664 139614235
PAT211 276098 235021090
PAT212 188385 291326630
PAT213 137484 196232251
PAT214 247191 246690030
PAT215 11728 387687504
PAT216 313354 152356909
PAT217 244602 252477336
PAT218 160029 300870611
PAT219 215545 135077252
PAT22 146945 94866926
PAT220 172971 290885692
PAT221 266021 215702033
PAT222 351332 145811436
PAT223 304085 76036686
PAT224 317818 206630332
PAT225 43590 365712261
PAT226 151381 180550783
PAT227 338212 193787787
PAT228 332520 206353769
PAT229 155792 199233054
PAT23 196054 155782932
PAT230 249094 251157045
PAT231 209852 277995521
PAT232 184404 195925874
PAT233 326554 210405939
PAT234 203551 272092254
PAT235 99377 335866542
PAT236 108195 332037529
PAT237 262379 184432748
PAT238 10553 3893045
PAT239 223882 118359990
PAT24 279883 73143527
PAT240 272868 62593635
PAT241 204517 140753600
PAT242 283956 19296326
PAT243 274469 22245925
PAT244 281624 22162860
PAT245 286514 14630240
PAT246 287155 13479675
PAT247 96564 20012546
PAT248 263509 44902329
PAT249 293106 5569014
PAT25 228121 146709629
PAT250 337152 75444577
PAT251 207126 270199202
PAT252 330273 192780592
PAT253 253593 160160166
PAT254 145599 308869479
PAT255 133194 316274917
PAT256 333017 206505321
PAT257 289809 232761570
PAT258 265784 29184711
PAT259 256574 81412648
PAT26 208817 140778194
PAT260 244602 100214081
PAT261 225069 71610298
PAT27 63078 54091824
PAT28 304662 206975876
PAT29 321045 202870000
PAT3 50199 20266137
PAT30 69609 127456994
PAT31 217213 274043600
PAT32 399532 38379558
PAT33 255490 168750319
PAT34 232022 138091307
PAT35 62923 29392798
PAT36 159604 193117909
PAT37 187245 152012324
PAT38 211992 134514047
PAT39 97888 9820583
PAT4 329466 180384567
PAT40 349664 21561844
PAT41 269135 102155446
PAT42 166 390395449
PAT43 7284 386170254
PAT44 91554 5256927
PAT45 304606 19422510
PAT46 304621 19407682
PAT47 188128 183518573
PAT48 31167 33402871
PAT49 100015 274294276
PAT5 261939 200084543
PAT50 347902 22047460
PAT51 356635 6776065
PAT52 92449 1756531
PAT53 351467 15875870
PAT54 360979 6858601
PAT55 133572 2537868
PAT56 360626 6851894
PAT57 359974 6839506
PAT58 125418 2711844
PAT59 535700 100616524
PAT6 217680 164402766
PAT60 111356 330233433
PAT61 289774 158820679
PAT62 481491 50382930
PAT63 225647 89298195
PAT64 254295 194538815
PAT65 328265 204073571
PAT66 172094 140785645
PAT67 349862 190728733
PAT68 612603 75778089
PAT69 132887 40797313
PAT7 247416 122521672
PAT70 484033 127126269
PAT71 126354 109119371
PAT72 150168 307250321
PAT73 318626 211710240
PAT74 51881 214846609
PAT75 189165 289007376
PAT76 317843 207880789
PAT77 123868 129694058
PAT78 342751 192409991
PAT79 362616 180214431
PAT8 224246 103110068
PAT80 20467 17346132
PAT81 311143 212599739
PAT82 414691 138165335
PAT83 481149 57356673
PAT84 327469 49354802
PAT85 456811 82501683
PAT86 157643 116017944
PAT87 166944 185725555
PAT88 315018 151644990
PAT89 225039 179148346
PAT9 153356 78054872
PAT90 161471 40739107
PAT91 548289 10417491
PAT92 499577 9491963
PAT93 509421 32468072
PAT94 211222 45802544
PAT95 257666 203185753
PAT96 387962 140930961
PAT97 39820 44653056
PAT98 361773 186862184
PAT99 415062 154422395
PHG1 8931 217002211
PHG2 4741 226299034
PHG3 5297 215856667
PHG4 4997 231993305
PHG5 6971 227836566
PHG6 4299 225875394
PHG7 774 17365386
PLN1 135596 171509314
PLN10 18946 157439113
PLN100 1 333667882
PLN100 1 578502594
PLN100 127 369812338
PLN100 10 389503495
PLN100 10 374804231
PLN100 8 300501703
PLN100 10 369372075
PLN100 1042 169430586
PLN100 1 605966608
PLN100 1 703076930
PLN100 1 495911329
PLN101 1 302574826
PLN101 1 796169439
PLN101 1 779372321
PLN101 1 665561653
PLN101 1 757165295
PLN101 1 852704148
PLN101 1 623698249
PLN101 1 745048881
PLN101 1 677947850
PLN101 1 524289323
PLN101 1 726838826
PLN102 1 296818136
PLN102 1 701430346
PLN102 1 584133940
PLN102 1 622677745
PLN102 1 745712656
PLN102 1 490622797
PLN102 1 748850018
PLN102 1 753856519
PLN102 1 643890519
PLN102 699 30235861
PLN102 1 593930347
PLN103 1 257455782
PLN103 1 702775664
PLN103 1 494594617
PLN103 1 792837209
PLN103 1 812232696
PLN103 1 661835603
PLN103 1 750337041
PLN103 1 854463248
PLN103 1 623248023
PLN103 1 749950614
PLN103 1 673746810
PLN104 1 252943167
PLN104 1 520815567
PLN104 1 712547961
PLN104 1 703299309
PLN104 1 569771178
PLN104 1 620176429
PLN104 1 717542863
PLN104 1 493761083
PLN104 1 746502734
PLN104 1 752612656
PLN104 1 648661963
PLN105 1 225803546
PLN105 572 38290762
PLN105 1 540897063
PLN105 1 449127287
PLN105 1 425675180
PLN105 1 463192880
PLN105 1 485323027
PLN105 1 448461343
PLN105 1 493511962
PLN105 1 462796039
PLN105 1 589118817
PLN106 1 219123305
PLN106 1 638425132
PLN106 1 716105986
PLN106 1 613160974
PLN106 1 626220839
PLN106 1 551718542
PLN106 1 484215583
PLN106 1 532103454
PLN106 1 480949782
PLN106 1 455353809
PLN106 1 499214392
PLN107 2 394302667
PLN107 1 298028472
PLN107 1 528225653
PLN107 218 367788603
PLN107 6 375232671
PLN107 299 384945076
PLN107 9 251431714
PLN107 130 156049603
PLN107 1 593930347
PLN107 1 702775664
PLN107 1 494594617
PLN108 55 43040327
PLN108 1 792837209
PLN108 1 812232696
PLN108 1 661835603
PLN108 1 750337041
PLN108 1 854463248
PLN108 1 623248023
PLN108 1 749950614
PLN108 1 673746810
PLN108 1 520815567
PLN108 1 712547961
PLN109 15 305289289
PLN109 1 703299309
PLN109 1 569771178
PLN109 1 620176429
PLN109 1 717542863
PLN109 1 493761083
PLN109 1 746502734
PLN109 1 752612656
PLN109 1 648661963
PLN109 53 362278903
PLN109 6678 233646823
PLN11 29376 278343654
PLN110 2 286029496
PLN110 1 445829560
PLN110 1 657893865
PLN110 1 636117214
PLN110 1 520569408
PLN110 1 614738994
PLN110 1 536175046
PLN110 1 610578938
PLN110 4 16378138
PLN110 58 389996895
PLN110 14 385024567
PLN111 2 307738366
PLN111 30 368986150
PLN111 14 379761940
PLN111 14 388380456
PLN111 5 138123356
PLN111 14 386817082
PLN111 14 393670454
PLN111 28 388378543
PLN111 21 371825237
PLN111 14 382705053
PLN111 5 137783507
PLN112 2 269669619
PLN112 13 362021382
PLN112 14 384652328
PLN112 14 385328574
PLN112 14 387607699
PLN112 13 362161900
PLN112 7 192427420
PLN112 14 391787584
PLN112 14 371741286
PLN112 10 360532952
PLN112 5 370119782
PLN113 1 157681923
PLN113 8 393655910
PLN113 6 194621872
PLN113 23 318601285
PLN113 4 331833036
PLN113 6 383779503
PLN113 7 364418253
PLN113 6 168945745
PLN113 11 364495457
PLN113 13 371343624
PLN113 14 390506009
PLN114 40 376080648
PLN114 50 388504808
PLN114 129 388429313
PLN114 2 272777406
PLN114 3 366184951
PLN114 4 390049233
PLN114 26 393235158
PLN114 9 339543817
PLN114 86 386159307
PLN114 4 322858024
PLN114 1 79481305
PLN115 33 389701062
PLN115 5 345056615
PLN115 6 348214746
PLN115 7 349249048
PLN115 8 356243003
PLN115 3 198571596
PLN115 3 333480027
PLN115 53 388888259
PLN115 222 363108809
PLN115 10 364192173
PLN115 1 291295799
PLN116 106 384154506
PLN116 1 258385429
PLN116 1 310695138
PLN116 2 390386182
PLN116 1 268171085
PLN116 29 349658376
PLN116 6 349885803
PLN116 7 374035469
PLN116 5 384499932
PLN116 3 317526865
PLN116 4 348522543
PLN117 55 188199075
PLN117 121 392720692
PLN117 11 336203737
PLN117 2 287149637
PLN117 3 359070095
PLN117 10 373903616
PLN117 2 159588847
PLN117 5 371769032
PLN117 7 383050287
PLN117 9 373845120
PLN117 7 344699691
PLN118 2 324178388
PLN118 187 262122807
PLN118 1 865431811
PLN118 1 841368522
PLN118 1 772393794
PLN118 1 766078222
PLN118 1 735900830
PLN118 1 693266847
PLN118 1 690056233
PLN118 1 654671025
PLN118 1 681539918
PLN119 3 383186249
PLN119 1 650134427
PLN119 1 643737533
PLN119 1 547487370
PLN119 1 545352555
PLN119 1 528421643
PLN119 1 538505002
PLN119 1 487455108
PLN119 1 484156440
PLN119 1 426775217
PLN119 2 882175
PLN12 2660 334399488
PLN120 2 268356222
PLN120 1 1574527093
PLN120 1 1805244829
PLN120 1 1716769615
PLN120 1 1637815978
PLN120 1 1645877737
PLN120 1 1365994436
PLN120 1 1520236431
PLN120 21 341095642
PLN120 5 135803197
PLN120 14 377335903
PLN121 2 324123174
PLN121 14 378243710
PLN121 14 386520074
PLN121 14 381342717
PLN121 13 352824152
PLN121 1 158169978
PLN121 2 351634268
PLN121 1 279860179
PLN121 1 259520967
PLN121 2 294703259
PLN121 1 238633233
PLN122 3 363018427
PLN122 1 162496318
PLN122 1 420743833
PLN122 1 155907
PLN122 1 454733196
PLN122 1 446096000
PLN122 1 431552901
PLN122 1 379526086
PLN122 1 338376119
PLN122 1 315777457
PLN122 4 356829234
PLN123 27 379124606
PLN123 13 321943140
PLN123 1 77851525
PLN123 8 384718303
PLN123 44 392277346
PLN123 15 353953398
PLN123 10 239865754
PLN123 25 62927445
PLN123 1 475425392
PLN123 1 592785984
PLN123 1 369077699
PLN124 19 134550855
PLN124 1 639092456
PLN124 1 650132723
PLN124 1 502756319
PLN124 1 616552515
PLN124 1 734473537
PLN124 1 475660819
PLN124 1 624362023
PLN124 1 589372991
PLN124 1 401580522
PLN124 1 568783180
PLN125 57 390189770
PLN125 1 587942095
PLN125 1 429272691
PLN125 1 492611322
PLN125 1 588888971
PLN125 1 366110095
PLN125 1 602817757
PLN125 1 637984644
PLN125 1 484660871
PLN125 14 393517910
PLN125 13 380754168
PLN126 11 373036233
PLN126 7 360887511
PLN126 11 370515825
PLN126 7 255465082
PLN126 10 393847493
PLN126 16 394123581
PLN126 39 387990033
PLN126 40 384498328
PLN126 3 143841883
PLN126 41 297752645
PLN126 1 494422770
PLN127 8 357693623
PLN127 1 646201372
PLN127 1 587623253
PLN127 1 663525381
PLN127 1 626841358
PLN127 1 543353244
PLN127 1 664393216
PLN127 19 360304242
PLN127 5 346876740
PLN127 9 390980959
PLN127 12 332062075
PLN128 6 351635285
PLN128 1 63050874
PLN128 9 376864900
PLN128 12 372511925
PLN128 9 378086189
PLN128 11 263651859
PLN128 1 199739593
PLN128 2 344461905
PLN128 3 374253733
PLN128 4 381821281
PLN128 4 318572652
PLN129 12 293471641
PLN129 79 393635436
PLN129 2 159167131
PLN129 6 388559936
PLN129 8 340431512
PLN129 15 383095456
PLN129 9 394035375
PLN129 12 352824577
PLN129 10 351790580
PLN129 9 389123571
PLN129 11 385826758
PLN13 37 329935405
PLN130 78 341267500
PLN130 10 349341323
PLN130 12 386750055
PLN130 8 382846237
PLN130 4 317913936
PLN130 5 382620307
PLN130 5 361453536
PLN130 6 383120782
PLN130 6 325499506
PLN130 3 326992284
PLN130 3 309672594
PLN131 131 317758159
PLN131 2 199284186
PLN131 4 381810661
PLN131 4 368895169
PLN131 4 320171181
PLN131 5 360856103
PLN131 17 55384138
PLN131 11 382432891
PLN131 15 364788400
PLN131 9 365792098
PLN131 10 252904734
PLN132 130 348798505
PLN132 1 312506452
PLN132 1 298985297
PLN132 1 289954511
PLN132 1 267212794
PLN132 1 251527947
PLN132 1 246038259
PLN132 1 224067570
PLN132 2 394230861
PLN132 5 373151993
PLN132 1 88136734
PLN133 119 246756089
PLN133 5 375018439
PLN133 7 323770455
PLN133 4 345416027
PLN133 5 357817205
PLN133 24 297760884
PLN133 1 2143528264
PLN133 1 2138631366
PLN133 1 2132989935
PLN133 1 2142145023
PLN133 1 2142779784
PLN134 196 355571810
PLN134 1 124381055
PLN134 1 2112395848
PLN134 1 2144481838
PLN134 1 2133121580
PLN134 1 2141806609
PLN134 1 1870266305
PLN134 1 2134931027
PLN134 1 2108664250
PLN134 1 2146278775
PLN134 1 2117022170
PLN135 129 347273899
PLN135 1 1576301307
PLN135 1 2067099338
PLN135 1 2134690998
PLN135 1 2136662657
PLN135 1 2140543523
PLN135 1 1531582847
PLN135 1 2146571508
PLN135 1 2138192289
PLN135 1 2101175359
PLN135 1 2146227213
PLN136 99 327554070
PLN136 1 621086779
PLN136 1 2138605540
PLN136 1 2083688238
PLN136 1 2144314009
PLN136 1 2139184679
PLN136 1 172723629
PLN136 1 2132146989
PLN136 1 2133919239
PLN136 1 2133305249
PLN136 1 2100933269
PLN137 48 365833376
PLN137 1 143347570
PLN137 1 2134142781
PLN137 1 2145201137
PLN137 1 2137733646
PLN137 1 1914313492
PLN137 1 2145479601
PLN137 1 2114166385
PLN137 2 3701885723
PLN137 1 2141253099
PLN137 1 2119186544
PLN138 60 352557038
PLN138 1 2142175433
PLN138 1 1498831827
PLN138 1 1020192845
PLN138 10 321674204
PLN138 3 372349544
PLN138 6 295982055
PLN138 4 344625596
PLN138 10 373719939
PLN138 15 320687713
PLN138 1 454441500
PLN139 204 383855350
PLN139 1 579809636
PLN139 1 550374318
PLN139 1 490948109
PLN139 1 518445003
PLN139 1 441130372
PLN139 1 551897936
PLN139 1 453240013
PLN139 1 569675999
PLN139 1 567007916
PLN139 1 496544637
PLN14 46 124218893
PLN140 137 390468270
PLN140 1 522841693
PLN140 1 441744131
PLN140 1 573537543
PLN140 1 136709
PLN140 1 440949504
PLN140 1 581077694
PLN140 1 538841055
PLN140 1 486522400
PLN140 1 495793880
PLN140 1 435262547
PLN141 87 392025534
PLN141 1 535192930
PLN141 1 434100415
PLN141 1 544199803
PLN141 1 519958927
PLN141 1 477159420
PLN141 1 491531377
PLN141 1 429947770
PLN141 1 549923787
PLN141 1 136692
PLN141 1 448723479
PLN142 119 386912791
PLN142 1 594308209
PLN142 1 551310461
PLN142 1 480566411
PLN142 1 514909529
PLN142 1 428171329
PLN142 1 554483852
PLN142 1 446514975
PLN142 1 595495573
PLN142 1 561532561
PLN142 1 478334130
PLN143 3 18014739
PLN143 1 526451923
PLN143 1 430213863
PLN143 1 555327081
PLN143 1 136650
PLN143 1 447395284
PLN143 1 567447976
PLN143 1 561370202
PLN143 1 507274784
PLN143 1 511274163
PLN143 1 437061773
PLN144 69 334048427
PLN144 1 446215483
PLN144 1 433531554
PLN144 1 581715996
PLN144 1 545854294
PLN144 1 487585716
PLN144 1 502853016
PLN144 1 435966324
PLN144 1 439683703
PLN144 1 136703
PLN144 1 445299727
PLN145 15 374915998
PLN145 1 546259763
PLN145 1 492972200
PLN145 1 449037107
PLN145 1 491835565
PLN145 1 414293664
PLN145 1 509203637
PLN145 1 427060722
PLN145 1 517747186
PLN145 1 411139572
PLN145 1 463043347
PLN146 15 376631523
PLN146 1 472050116
PLN146 1 404594180
PLN146 1 525771240
PLN146 1 434184414
PLN146 1 556619333
PLN146 1 449827353
PLN146 1 435193785
PLN146 1 487657026
PLN146 1 420799321
PLN146 1 506847538
PLN147 117 268512615
PLN147 1 424111539
PLN147 1 529336321
PLN147 1 512598572
PLN147 1 464949005
PLN147 1 478050655
PLN147 1 405189081
PLN147 1 503245410
PLN147 1 136621
PLN147 1 433027506
PLN147 1 561888103
PLN148 100 319711472
PLN148 1 543643859
PLN148 1 465101524
PLN148 1 479577933
PLN148 1 370652462
PLN148 1 470832587
PLN148 1 444863034
PLN148 1 549613361
PLN148 1 475614129
PLN148 1 378582797
PLN148 1 484181993
PLN149 22 387363813
PLN149 1 428463662
PLN149 1 456054156
PLN149 1 406795410
PLN149 1 551691529
PLN149 1 469885103
PLN149 1 412545700
PLN149 1 437461740
PLN149 1 367632597
PLN149 1 503019622
PLN149 1 409096790
PLN15 9 366014477
PLN150 40 378828844
PLN150 1 553356059
PLN150 1 527086346
PLN150 1 439832876
PLN150 1 463419122
PLN150 1 412842520
PLN150 1 433607908
PLN150 1 136684
PLN150 1 438715154
PLN150 1 558432928
PLN150 1 525597199
PLN151 7 361494327
PLN151 1 499105699
PLN151 1 476315696
PLN151 1 404753456
PLN151 1 165207278
PLN151 1 428166829
PLN151 1 531985519
PLN151 1 528375571
PLN151 1 469190473
PLN151 1 499943225
PLN151 1 426883771
PLN152 314 319348366
PLN152 1 518242728
PLN152 1 452485612
PLN152 1 524598351
PLN152 1 551958270
PLN152 1 484316636
PLN152 1 477529720
PLN152 1 418513176
PLN152 1 253507736
PLN152 1 433963092
PLN152 1 546085745
PLN153 53 377264056
PLN153 1 545226034
PLN153 1 468073191
PLN153 1 460900303
PLN153 1 399389643
PLN153 2 147912467
PLN153 1 419675113
PLN153 1 529511041
PLN153 1 505002105
PLN153 1 493534736
PLN153 1 480438381
PLN154 112 343386395
PLN154 1 323037461
PLN154 1 513746860
PLN154 1 436583560
PLN154 1 553766941
PLN154 1 538205655
PLN154 1 496559787
PLN154 1 498664620
PLN154 1 420173649
PLN154 1 553712854
PLN154 1 444660800
PLN155 6 326759735
PLN155 1 548162194
PLN155 1 475391106
PLN155 1 422040451
PLN155 1 492582937
PLN155 1 315874374
PLN155 1 520872272
PLN155 1 432790581
PLN155 1 561166410
PLN155 1 497612547
PLN155 1 454958861
PLN156 17 340023864
PLN156 1 475241834
PLN156 1 398551120
PLN156 1 496364735
PLN156 1 136702
PLN156 1 445660949
PLN156 1 488646431
PLN156 1 501478063
PLN156 1 418342823
PLN156 1 491021198
PLN156 1 413178521
PLN157 115 393450449
PLN157 1 469438496
PLN157 1 410203331
PLN157 1 486823465
PLN157 1 532902629
PLN157 1 470057954
PLN157 1 477986613
PLN157 1 395248899
PLN157 1 540739613
PLN157 1 436072789
PLN157 1 565481604
PLN158 81 370027281
PLN158 1 530643946
PLN158 1 474248680
PLN158 1 489943422
PLN158 1 380851109
PLN158 1 488893700
PLN158 1 397601223
PLN158 1 542784013
PLN158 1 546813442
PLN158 1 410174162
PLN158 1 481229106
PLN159 29 394591747
PLN159 1 412422822
PLN159 1 503641832
PLN159 1 136682
PLN159 1 642634776
PLN159 1 827770304
PLN159 1 819590567
PLN159 1 657919172
PLN159 1 735222392
PLN159 1 640551262
PLN159 1 792951870
PLN16 2396 340681670
PLN160 78 345758298
PLN160 1 57931760
PLN160 1 641523445
PLN160 1 830702509
PLN160 1 817725293
PLN160 1 657518596
PLN160 1 728079018
PLN160 1 637620844
PLN160 1 792621069
PLN160 1 48899630
PLN160 1 424301551
PLN161 2 265995834
PLN161 1 363314422
PLN161 1 547589534
PLN161 1 457898396
PLN161 1 471623726
PLN161 1 398746676
PLN161 1 519419467
PLN161 1 435505876
PLN161 1 371211504
PLN161 1 505934463
PLN161 1 434488449
PLN162 3 380342000
PLN162 1 481399899
PLN162 1 415263271
PLN162 1 536522644
PLN162 1 437373607
PLN162 1 539223252
PLN162 1 520659461
PLN162 1 460375097
PLN162 1 458164519
PLN162 1 395065095
PLN162 1 530797330
PLN163 3 341478110
PLN163 1 437410857
PLN163 1 553413267
PLN163 1 511954845
PLN163 1 448722544
PLN163 1 479483748
PLN163 1 420024747
PLN163 1 540111372
PLN163 19 390222074
PLN163 6 385962772
PLN163 6 350186990
PLN164 4 364941990
PLN164 11 349705202
PLN164 8 347249232
PLN164 37 390578481
PLN164 21 351552576
PLN164 4 384166153
PLN164 4 344265953
PLN164 8 369490188
PLN164 36676 222778514
PLN165 2 267241309
PLN166 3 377845747
PLN167 2 218300262
PLN168 3 351455647
PLN169 3 282049637
PLN17 1949 233857567
PLN170 2 296748967
PLN171 2 276176029
PLN172 2 265406188
PLN173 3 366102397
PLN174 3 310633103
PLN175 1 90243615
PLN176 2 339450567
PLN177 2 383562320
PLN178 2 318742289
PLN179 2 356433379
PLN18 3 330514248
PLN180 2 302010261
PLN181 2 361337975
PLN182 41 389463936
PLN183 56 346155909
PLN184 28 344950285
PLN185 74 110183622
PLN186 46 387316355
PLN187 26 388412848
PLN188 45 383275027
PLN189 3 296654434
PLN19 37 343581774
PLN190 5 362932580
PLN191 3 174796239
PLN192 1 307467675
PLN193 1 240644346
PLN194 1 237923589
PLN195 1 251400564
PLN196 1 222005600
PLN197 2 353275669
PLN198 1 180355996
PLN199 18 373335959
PLN2 43073 277121087
PLN20 38 174497774
PLN200 193 309368743
PLN201 46 267785598
PLN202 2 278500643
PLN203 1 146154786
PLN204 2 291596214
PLN205 2 284209818
PLN206 3 380361118
PLN207 1 146314651
PLN208 1 262573928
PLN209 1 278118176
PLN21 9 363687061
PLN210 1 249859997
PLN211 1 281481746
PLN212 1 187643412
PLN213 1 272110166
PLN214 1 256679836
PLN215 1 252477622
PLN216 1 253096925
PLN217 1 292374568
PLN218 1 178437200
PLN219 19 385138080
PLN22 10 361166576
PLN220 8 385802779
PLN221 233 276801321
PLN222 5 294376703
PLN223 5 302707417
PLN224 7 303689386
PLN225 1 594546470
PLN226 1 587543788
PLN227 1 587190583
PLN228 1 583925327
PLN229 1 527343613
PLN23 11 366621684
PLN230 1 513337126
PLN231 1 453691697
PLN232 37 334786838
PLN233 8 340070582
PLN234 9 390483320
PLN235 7 343029522
PLN236 8 390116206
PLN237 30 391405029
PLN238 12 279030607
PLN239 15 349421970
PLN24 158 378806980
PLN240 9 359340843
PLN241 9 376777002
PLN242 47 376166701
PLN243 15 381998388
PLN244 16 390767870
PLN245 23 356914980
PLN246 6 394536461
PLN247 6 379300625
PLN248 4 282458791
PLN249 48 381927407
PLN25 1 337042926
PLN250 16 259608471
PLN251 4 351020507
PLN252 9 394649745
PLN253 3 133976330
PLN254 13 382257900
PLN255 11 361288517
PLN256 52 340110725
PLN257 6 335533055
PLN258 2 103073804
PLN259 52 388568687
PLN26 1 177533547
PLN260 51 383849244
PLN261 45 337047876
PLN262 1 494422770
PLN263 1 646201372
PLN264 1 587623253
PLN265 1 663525381
PLN266 1 626841358
PLN267 1 543353244
PLN268 1 664393216
PLN269 51 101478778
PLN27 1 292038349
PLN270 37 16871
PLN271 149 79314
PLN272 2469 93786416
PLN273 7181 18795412
PLN274 14346 29953091
PLN275 97592 209245603
PLN276 129576 90172129
PLN277 158757 148036381
PLN278 162647 146387076
PLN279 58045 31864949
PLN28 1 253125799
PLN280 181509 123930165
PLN281 49960 254172967
PLN282 41545 288268410
PLN283 72045 110649218
PLN284 98644 85504671
PLN285 49729 72847341
PLN286 25060 110564695
PLN287 13561 89764040
PLN288 1 774434471
PLN289 8305 28494037
PLN29 1 251194792
PLN290 1861 361385154
PLN291 5 372618381
PLN292 6 372447772
PLN293 6 368295254
PLN294 2 132503639
PLN295 498 311771607
PLN296 8 327823341
PLN297 6 343447962
PLN298 1 66465249
PLN299 1 474651383
PLN3 3690 380019006
PLN30 1 253267520
PLN300 1 612216829
PLN301 1 571018318
PLN302 1 574020038
PLN303 1 538550714
PLN304 1 514282554
PLN305 1 575541767
PLN306 134 336045988
PLN307 13675 307007082
PLN308 174185 123951780
PLN309 24775 16090838
PLN31 1 267785325
PLN310 148140 156039849
PLN311 149381 145727491
PLN312 87101 72030134
PLN313 154395 132577958
PLN314 163868 118478140
PLN315 25398 27608756
PLN316 148069 133559759
PLN317 126454 157685669
PLN318 167374 121300706
PLN319 116299 121241710
PLN32 1 175912755
PLN320 134561 149271517
PLN321 102264 122021935
PLN322 135561 149991524
PLN323 126496 162955596
PLN324 120494 166546762
PLN325 21369 19334094
PLN326 124170 164074144
PLN327 112838 172579701
PLN328 86183 159282387
PLN329 118852 171995295
PLN33 1 266007691
PLN330 110396 197448479
PLN331 51455 224672913
PLN332 3605 382178267
PLN333 16021 9202513
PLN334 19737 363518883
PLN335 10232 333664247
PLN336 302 288936846
PLN337 5 324373291
PLN338 1670 369972731
PLN339 1620 2256477
PLN34 1 244603042
PLN340 1384 387002570
PLN341 8 179149947
PLN342 1282 232633870
PLN343 1 522466905
PLN344 1 675310294
PLN345 1 628753756
PLN346 1 624247919
PLN347 1 599018945
PLN348 1 573247234
PLN349 1 634667502
PLN35 1 277312646
PLN350 8563 149646365
PLN351 1 727344967
PLN352 1 946003158
PLN353 1 965754312
PLN354 1 906459801
PLN355 1 876148008
PLN356 1 885153844
PLN357 1 899925126
PLN358 1 528437893
PLN359 4156 344360411
PLN36 129 378512983
PLN360 10 362580157
PLN361 4 120184706
PLN362 129 363594612
PLN363 404 366581476
PLN364 9 335385998
PLN365 130 308977848
PLN366 206 92200731
PLN367 16 383095167
PLN368 47 120890229
PLN369 1 541700351
PLN37 19736 83705922
PLN370 1 696809892
PLN371 1 655542733
PLN372 1 648987779
PLN373 1 622068216
PLN374 1 583456046
PLN375 1 654005093
PLN376 130 298375
PLN377 1 522466905
PLN378 1 675310294
PLN379 1 628753756
PLN38 96584 101383193
PLN380 1 624247919
PLN381 1 599018945
PLN382 1 573247234
PLN383 1 634667502
PLN384 344 95023900
PLN385 1 521073757
PLN386 1 672273650
PLN387 1 634137895
PLN388 1 624121443
PLN389 1 607506942
PLN39 113437 117621940
PLN390 1 564293627
PLN391 1 632401812
PLN392 1 520603772
PLN393 1 661076038
PLN394 1 626572591
PLN395 1 612852138
PLN396 1 598896166
PLN397 1 570629545
PLN398 1 623813090
PLN399 1 513014082
PLN4 3521 387668889
PLN40 57311 72144580
PLN400 1 653624577
PLN401 1 616219606
PLN402 1 610044819
PLN403 1 583417444
PLN404 1 550735148
PLN405 1 620104558
PLN406 1 536602846
PLN407 1 685423969
PLN408 1 640667275
PLN409 1 639123876
PLN41 28689 28922869
PLN410 1 612949391
PLN411 1 577192767
PLN412 1 641629864
PLN413 1 500012378
PLN414 1 648922534
PLN415 1 604770208
PLN416 1 597403059
PLN417 1 576456374
PLN418 1 556080982
PLN419 1 603311816
PLN42 2648 194594881
PLN420 1 512023576
PLN421 1 652551272
PLN422 1 615767531
PLN423 1 605571303
PLN424 1 592249714
PLN425 1 549757368
PLN426 1 616509610
PLN427 2 1184
PLN428 1 550024188
PLN429 1 710194481
PLN43 344 254550430
PLN430 1 661081403
PLN431 1 659460550
PLN432 1 630572514
PLN433 1 598618390
PLN434 1 658974642
PLN435 1 559656399
PLN436 1 717517502
PLN437 1 672450454
PLN438 1 665297378
PLN439 1 636785599
PLN44 400 261235914
PLN440 1 599706080
PLN441 1 675658265
PLN442 1 523168208
PLN443 1 671211297
PLN444 1 630677708
PLN445 1 623428415
PLN446 1 604298040
PLN447 1 558526623
PLN448 1 628419988
PLN449 1 495661851
PLN45 198 168828441
PLN450 1 640830439
PLN451 1 597781253
PLN452 1 600363860
PLN453 1 570178053
PLN454 1 534998810
PLN455 1 616598997
PLN456 1 537457279
PLN457 1 685947972
PLN458 1 649921694
PLN459 1 641099225
PLN46 298 258873545
PLN460 1 611845738
PLN461 1 581041262
PLN462 1 655783664
PLN463 1 521174834
PLN464 1 667717957
PLN465 1 631819663
PLN466 1 624692602
PLN467 1 597351075
PLN468 1 561737938
PLN469 1 629651422
PLN47 339 265493888
PLN470 1 524514255
PLN471 1 670202054
PLN472 1 631946783
PLN473 1 626743494
PLN474 1 600801835
PLN475 1 566971015
PLN476 1 629827058
PLN477 1 522114480
PLN478 1 671530377
PLN479 1 631910401
PLN48 485 350911896
PLN480 1 622474059
PLN481 1 598240357
PLN482 1 562137082
PLN483 1 633805855
PLN484 1 525723083
PLN485 1 684336246
PLN486 1 636053469
PLN487 1 629969872
PLN488 1 604087610
PLN489 1 568600391
PLN49 112 80604200
PLN490 1 640498578
PLN491 1 519546829
PLN492 1 665715246
PLN493 1 624683667
PLN494 1 621078253
PLN495 1 600910593
PLN496 1 558953701
PLN497 1 626840912
PLN498 1 543344542
PLN499 1 697540743
PLN5 97871 212329023
PLN50 455 379563194
PLN500 1 655862368
PLN501 1 646765634
PLN502 1 618540729
PLN503 1 587963859
PLN504 1 658085510
PLN505 449 378687213
PLN506 15 312691008
PLN507 20 111531882
PLN508 1 596211899
PLN509 1 705338699
PLN51 143 364543151
PLN510 1 493450010
PLN511 1 804285258
PLN512 1 810734643
PLN513 1 673981989
PLN514 1 754496630
PLN515 1 855759449
PLN516 1 614042580
PLN517 1 743847818
PLN518 1 673340788
PLN519 1 515668560
PLN52 92 268011045
PLN520 1 713320806
PLN521 1 703598484
PLN522 1 570159854
PLN523 1 625793224
PLN524 1 721110502
PLN525 1 459355444
PLN526 1 745201001
PLN527 1 749284433
PLN528 1 643344672
PLN529 1 595297365
PLN53 108 325736871
PLN530 1 688905267
PLN531 1 491807393
PLN532 1 769338634
PLN533 1 671568023
PLN534 1 635285330
PLN535 1 745618965
PLN536 1 839470345
PLN537 1 646400022
PLN538 1 747589525
PLN539 1 665179885
PLN54 17 390428741
PLN540 1 506585010
PLN541 1 703962928
PLN542 1 702438406
PLN543 1 568126671
PLN544 1 610851963
PLN545 1 707596419
PLN546 1 465558328
PLN547 1 734536914
PLN548 1 738743901
PLN549 1 636778132
PLN55 246 346776993
PLN550 1 602900890
PLN551 1 697493198
PLN552 1 490518203
PLN553 1 784661008
PLN554 1 810500911
PLN555 1 655314739
PLN556 1 752710991
PLN557 1 890847171
PLN558 1 621781073
PLN559 1 743084022
PLN56 155 383508558
PLN560 1 676741658
PLN561 1 509452426
PLN562 1 710124532
PLN563 1 480767623
PLN564 1 578021311
PLN565 1 620140791
PLN566 1 716573881
PLN567 1 476726550
PLN568 1 756324664
PLN569 1 977471539
PLN57 85 329381794
PLN570 1 642207261
PLN571 1 502612092
PLN572 1 646234737
PLN573 1 605172934
PLN574 1 593744788
PLN575 1 571972453
PLN576 1 545472572
PLN577 1 607667504
PLN578 1 590561804
PLN579 1 685720839
PLN58 15 388403916
PLN580 1 490910922
PLN581 1 782694893
PLN582 1 796420183
PLN583 1 650274702
PLN584 1 739889549
PLN585 1 848590828
PLN586 1 610626473
PLN587 1 738023571
PLN588 1 667607564
PLN589 1 506274898
PLN59 22 360710420
PLN590 1 701434008
PLN591 1 690770133
PLN592 1 567265955
PLN593 1 612987783
PLN594 1 704156067
PLN595 1 475327881
PLN596 1 732118298
PLN597 1 733931846
PLN598 1 636796232
PLN599 1 599764323
PLN6 111631 128056225
PLN60 6 376299569
PLN600 1 691313424
PLN601 1 493357854
PLN602 1 782685093
PLN603 1 786410271
PLN604 1 648139033
PLN605 1 744407562
PLN606 1 835583350
PLN607 1 623221719
PLN608 1 741299132
PLN609 1 669032550
PLN61 1 65870126
PLN610 1 517040482
PLN611 1 711661679
PLN612 1 708205786
PLN613 1 573398137
PLN614 1 583494258
PLN615 1 707105489
PLN616 1 471251328
PLN617 1 737453356
PLN618 1 736349413
PLN619 1 639162162
PLN62 93 388494695
PLN620 1 586755746
PLN621 1 704478343
PLN622 1 492109999
PLN623 1 791475352
PLN624 1 785940626
PLN625 1 661246824
PLN626 1 756990402
PLN627 1 858776195
PLN628 1 621195942
PLN629 1 754256086
PLN63 15 373888800
PLN630 1 670301833
PLN631 1 509263899
PLN632 1 708234589
PLN633 1 725120110
PLN634 1 575129590
PLN635 1 620883766
PLN636 1 727285804
PLN637 1 479660269
PLN638 1 745978486
PLN639 1 750160716
PLN64 9 363551984
PLN640 1 642428577
PLN641 1 591313643
PLN642 1 705330581
PLN643 1 495656580
PLN644 1 803232604
PLN645 1 790745243
PLN646 1 657494025
PLN647 1 759305888
PLN648 1 856542542
PLN649 1 628321883
PLN65 60 374148929
PLN650 1 754364263
PLN651 1 697113365
PLN652 1 504254270
PLN653 1 715354979
PLN654 1 713929667
PLN655 1 572943128
PLN656 1 626959190
PLN657 1 715714221
PLN658 1 483823121
PLN659 1 742917797
PLN66 14 212654302
PLN660 1 748536659
PLN661 1 643784981
PLN662 1 600654286
PLN663 1 685083685
PLN664 1 486317123
PLN665 1 794150360
PLN666 1 799857935
PLN667 1 655329108
PLN668 1 749763888
PLN669 1 838116175
PLN67 74 124609184
PLN670 1 610468321
PLN671 1 736551279
PLN672 1 666328382
PLN673 1 504826275
PLN674 1 702606209
PLN675 1 467876140
PLN676 1 566465558
PLN677 1 614421429
PLN678 1 698878671
PLN679 1 480431564
PLN68 8 358353307
PLN680 1 735408736
PLN681 1 969998116
PLN682 1 635024734
PLN683 10 3368
PLN684 1 595339094
PLN685 1 698605642
PLN686 1 499102108
PLN687 1 791748890
PLN688 1 797311483
PLN689 1 656817438
PLN69 3 347496433
PLN690 1 753360318
PLN691 1 845838138
PLN692 1 619661694
PLN693 1 752772853
PLN694 1 689709469
PLN695 1 509595892
PLN696 1 712797596
PLN697 1 710493282
PLN698 1 570643040
PLN699 1 619886155
PLN7 64212 184494355
PLN70 4 370651368
PLN700 1 705533140
PLN701 1 484551304
PLN702 1 740148362
PLN703 1 757233630
PLN704 1 642499559
PLN705 1 594006513
PLN706 1 693261537
PLN707 1 492948387
PLN708 1 781462734
PLN709 1 802944975
PLN71 2 271593360
PLN710 1 650275864
PLN711 1 756841830
PLN712 1 850623622
PLN713 1 614136911
PLN714 1 723255126
PLN715 1 669876730
PLN716 1 507533340
PLN717 1 712168462
PLN718 1 712339524
PLN719 1 564869106
PLN72 1 150766190
PLN720 1 619418949
PLN721 1 715454519
PLN722 1 478264344
PLN723 1 734693445
PLN724 1 749685439
PLN725 1 633598967
PLN726 1 782818162
PLN727 1 1022071454
PLN728 1 971920087
PLN729 1 827198496
PLN73 2 288204953
PLN730 1 867619200
PLN731 1 806566123
PLN732 1 1015700474
PLN733 1 742303966
PLN734 1 956173857
PLN735 1 916702776
PLN736 1 874517040
PLN737 1 816294110
PLN738 1 750216944
PLN739 1 862608691
PLN74 2 286787940
PLN740 20 4493
PLN741 175 140763171
PLN742 1 516505932
PLN743 1 665585731
PLN744 1 621516506
PLN745 1 610333535
PLN746 1 588218686
PLN747 1 561794515
PLN748 1 632540561
PLN749 118 87991
PLN75 2 295931502
PLN750 1 313789095
PLN751 1 248068439
PLN752 1 241454477
PLN753 1 251811976
PLN754 1 225452224
PLN755 1 173806927
PLN756 2 370152128
PLN757 168 374290347
PLN758 603 391598667
PLN759 10 362580157
PLN76 64 355204210
PLN760 7 281547701
PLN761 1 314258027
PLN762 1 394306295
PLN763 1 325599754
PLN764 1 288763641
PLN765 1 187311108
PLN766 1 277174932
PLN767 1 235078182
PLN768 15 332895745
PLN769 16436 36185494
PLN77 8 357495982
PLN770 5636 1862075
PLN771 5224 2478918
PLN772 1 563502314
PLN773 833 298337632
PLN774 1194 92707173
PLN775 1 594102056
PLN776 1 689851870
PLN777 1 495453186
PLN778 1 780798557
PLN779 1 801256715
PLN78 2 99419683
PLN780 1 651852609
PLN781 1 750843639
PLN782 1 830829764
PLN783 1 615552423
PLN784 1 744588157
PLN785 1 673617499
PLN786 1 509857067
PLN787 1 709773743
PLN788 1 713149757
PLN789 1 566080677
PLN79 7 376229618
PLN790 1 618079260
PLN791 1 720988478
PLN792 1 473592718
PLN793 1 736706236
PLN794 1 750620385
PLN795 1 638686055
PLN796 1 480980714
PLN797 6684 330577769
PLN798 3760 370633860
PLN799 10098 326491459
PLN8 21754 107220939
PLN80 6 342806685
PLN800 1753 12315783
PLN801 1 585266722
PLN802 1 681112512
PLN803 1 775448786
PLN804 1 790338525
PLN805 1 746673839
PLN806 1 836514780
PLN807 1 736872137
PLN808 1 676292951
PLN809 1 669155517
PLN81 6 347730275
PLN810 1 701372996
PLN811 1 615672275
PLN812 1 698614761
PLN813 1 728031845
PLN814 1 722970987
PLN815 12302 8480478
PLN816 94681 142561266
PLN817 109096 181644522
PLN818 87286 199563409
PLN819 84116 200951502
PLN82 6 350661716
PLN820 96871 192945694
PLN821 103815 189018150
PLN822 102082 189080571
PLN823 14738 36814224
PLN824 88875 206659305
PLN825 83861 206666241
PLN826 73451 223600224
PLN827 45309 139103023
PLN828 67826 232552006
PLN829 69384 218644325
PLN83 43 144640005
PLN830 62441 240706602
PLN831 2564 12796463
PLN832 63755 236315529
PLN833 49599 247040713
PLN834 46036 247946301
PLN835 25503 78383117
PLN836 63843 234366912
PLN837 52857 245142760
PLN838 54380 244353843
PLN839 54573 260728883
PLN84 144 326417895
PLN840 55756 240082554
PLN841 10661 44626589
PLN842 54033 252641061
PLN843 59190 235428140
PLN844 55736 243239679
PLN845 49338 178492104
PLN846 60647 237483113
PLN847 47884 255100680
PLN848 39903 279752871
PLN849 29642 172995606
PLN85 7 298887356
PLN850 54602 252806065
PLN851 88457 205186916
PLN852 62099 243990194
PLN853 60535 234547895
PLN854 37261 268612999
PLN855 6 357582661
PLN856 2 87027724
PLN857 1 528447123
PLN858 1 678170541
PLN859 1 639558213
PLN86 6 332369654
PLN860 1 629672760
PLN861 1 608467472
PLN862 1 565695744
PLN863 1 634886329
PLN864 1 532083992
PLN865 1 684376481
PLN866 1 642597466
PLN867 1 631979072
PLN868 1 607115911
PLN869 1 582960187
PLN87 50 340388796
PLN870 1 640026769
PLN871 1 608979116
PLN872 1 720972993
PLN873 1 501257520
PLN874 1 804602427
PLN875 1 808121247
PLN876 1 649118519
PLN877 1 758906661
PLN878 1 861141126
PLN879 1 642382296
PLN88 40 308864128
PLN880 1 759893476
PLN881 1 689766370
PLN882 1 531462149
PLN883 1 714517032
PLN884 1 717288350
PLN885 1 586345039
PLN886 1 626266972
PLN887 1 738085275
PLN888 1 505809789
PLN889 1 759124079
PLN89 2 108425436
PLN890 1 751612808
PLN891 1 653055523
PLN892 7 358620060
PLN893 687 177292972
PLN894 1 478410592
PLN895 1 530843944
PLN896 1 529541203
PLN897 1 616320322
PLN898 1 560314678
PLN899 1 552570299
PLN9 35208 291130285
PLN90 202 322775705
PLN900 1 477706438
PLN901 1 464083788
PLN902 1 411577152
PLN903 1 461076154
PLN904 1 463363089
PLN905 1 481348281
PLN906 1 411112127
PLN907 1 485809178
PLN908 1 525998845
PLN909 1 469027344
PLN91 6 336790634
PLN910 1 409103995
PLN911 1 460274876
PLN912 1 476570508
PLN913 1 445971407
PLN914 1 490396672
PLN915 1 426632976
PLN916 1 538887009
PLN917 1 574640544
PLN918 1 667652801
PLN919 1 573769737
PLN92 5 336035871
PLN920 1 579564072
PLN921 1 506557729
PLN922 1 469999753
PLN923 1 516880681
PLN924 1 454437434
PLN925 1 415133431
PLN926 1 489887590
PLN927 1 289026301
PLN928 1 490033736
PLN929 1 542991241
PLN93 6 326965702
PLN930 1 484002173
PLN931 1 527161174
PLN932 1 513237590
PLN933 1 458108957
PLN934 1 448178421
PLN935 1 577845554
PLN936 1 529955746
PLN937 1 534821622
PLN938 1 551069265
PLN939 1 588203704
PLN94 5 304407451
PLN940 1 459891171
PLN941 1 555382095
PLN942 1 455803086
PLN943 1 509477500
PLN944 1 582703961
PLN945 1 567151184
PLN946 1 459232789
PLN947 1 577255397
PLN948 1 441736736
PLN949 1 534335728
PLN95 20 316869596
PLN950 19 2859863
PLN951 1 613662638
PLN952 1 794474755
PLN953 1 760111594
PLN954 1 769810128
PLN955 1 715684684
PLN956 1 623890083
PLN957 1 755457679
PLN958 1 717109572
PLN959 1 817712742
PLN96 5 284426683
PLN960 1 864624966
PLN961 1 701857263
PLN962 1 726425509
PLN963 1 738041677
PLN964 1 767912069
PLN965 1 504659958
PLN966 1 662526948
PLN967 1 633282846
PLN968 1 534651777
PLN969 1 584285409
PLN97 8 327303441
PLN970 1 507261758
PLN971 1 659687352
PLN972 1 224073253
PLN973 1 198628823
PLN974 1 322486422
PLN975 1 260047251
PLN976 1 262402055
PLN977 1 330012911
PLN978 1 349800169
PLN979 1 354403191
PLN98 61 76849044
PLN980 1 317988395
PLN981 1 376468909
PLN982 313 342168471
PLN983 5 315557653
PLN984 18 309282167
PLN985 10 333088290
PLN986 79 344751863
PLN987 38 343074766
PLN988 5 325733636
PLN989 389 384262295
PLN99 2 355063454
PLN990 10 375480087
PLN991 10 379071384
PLN992 9 351388705
PLN993 2 74237962
PLN994 1 472108912
PLN995 1 611709054
PLN996 1 571129681
PLN997 1 563957086
PLN998 1 535211053
PLN999 1 496554540
PRI1 23047 60053106
PRI10 2265 387936439
PRI11 4375 381717987
PRI12 2068 191950792
PRI13 2459 391017609
PRI14 17344 243217043
PRI15 27929 79132073
PRI16 96050 166265556
PRI17 11025 363947920
PRI18 3741 383223079
PRI19 15303 353911286
PRI2 23840 319341223
PRI20 2239 172855211
PRI21 1 250749103
PRI22 1 238414537
PRI23 2 387789264
PRI24 2 351926207
PRI25 2 301224727
PRI26 2 270924633
PRI27 3 376243325
PRI28 4 374251276
PRI29 5 290585290
PRI3 2613 370370379
PRI30 42294 314449515
PRI31 19027 23602325
PRI32 53141 193817517
PRI33 4 351860731
PRI34 5 337827736
PRI35 3 297245061
PRI36 3 382019003
PRI37 2 285375381
PRI38 2 306826759
PRI39 2 354172067
PRI4 2409 360399901
PRI40 2 394680893
PRI41 1 242696752
PRI42 1 248387328
PRI43 17505 351769399
PRI44 118186 177543446
PRI45 43987 90998900
PRI46 74331 199953923
PRI47 54422 215579299
PRI48 34648 144367010
PRI49 69722 214218592
PRI5 2593 353874487
PRI50 97860 190630945
PRI51 1195 237597058
PRI52 1 190673448
PRI53 9368 358512524
PRI54 49031 210795082
PRI55 84608 191038365
PRI56 44979 263705863
PRI57 35827 298234600
PRI58 49708 88859202
PRI6 2112 282951291
PRI7 2729 356953890
PRI8 3181 362167571
PRI9 2423 385530941
ROD1 38463 309689602
ROD10 15053 352243468
ROD100 5 331474410
ROD101 2 318539651
ROD102 3 346986554
ROD103 2 195914539
ROD104 3 320471619
ROD105 2 303502892
ROD106 2 280790320
ROD107 3 392932004
ROD108 4 351698734
ROD109 2 368221265
ROD11 1336 2453179
ROD110 2 303625032
ROD111 2 292706097
ROD112 2 278161066
ROD113 3 373049758
ROD114 3 349653794
ROD115 3 308876130
ROD116 4 238660990
ROD117 2 379622902
ROD118 2 334811729
ROD119 2 307236712
ROD12 22213 347967024
ROD120 2 287806543
ROD121 3 391762678
ROD122 3 360814732
ROD123 3 314134467
ROD124 4 239932575
ROD125 2 373193903
ROD126 1 157584965
ROD127 2 299783671
ROD128 2 295158694
ROD129 3 388896513
ROD13 1002 157743814
ROD130 3 359745676
ROD131 3 334741362
ROD132 5 333237167
ROD133 2 317726462
ROD134 1 118876157
ROD135 3 341713382
ROD136 4 374029993
ROD137 3 389445867
ROD138 2 291998396
ROD139 2 278095263
ROD14 53466 238707384
ROD140 4 390852856
ROD141 2 370533799
ROD142 2 304047488
ROD143 2 292691026
ROD144 2 276929041
ROD145 3 372795034
ROD146 3 347692711
ROD147 3 308420172
ROD148 4 236625227
ROD149 2 370341452
ROD15 21658 310382782
ROD150 2 307760277
ROD151 2 294424009
ROD152 2 281871870
ROD153 3 372472209
ROD154 3 349207861
ROD155 2 214783614
ROD156 5 332654019
ROD157 2 367229262
ROD158 2 304331769
ROD159 2 288798215
ROD16 228306 97098819
ROD160 2 275554257
ROD161 2 251405689
ROD162 3 354090641
ROD163 3 326613543
ROD164 5 331013327
ROD165 2 368057253
ROD166 2 306226071
ROD167 1 147422267
ROD168 2 291393309
ROD169 3 385188841
ROD17 97458 65701988
ROD170 3 355338747
ROD171 3 326750920
ROD172 5 331081197
ROD173 1 196977572
ROD174 2 340285783
ROD175 2 310111918
ROD176 2 296020819
ROD177 2 268302591
ROD178 3 367814812
ROD179 3 354083518
ROD18 40454 251579014
ROD180 4 377434897
ROD181 2 58596888
ROD182 2 316597187
ROD183 3 346141334
ROD184 3 309646819
ROD185 3 235883790
ROD186 2 332395505
ROD187 2 297647048
ROD188 2 282771228
ROD189 4 393253035
ROD19 2 383374219
ROD190 2 311845466
ROD191 3 332317170
ROD192 4 331904146
ROD193 2 328442178
ROD194 2 293393805
ROD195 1 133371210
ROD196 2 271974197
ROD197 2 251802734
ROD198 13 271995219
ROD199 2 270496589
ROD2 1810 346955540
ROD20 2 353017828
ROD200 3 366902997
ROD201 3 316563723
ROD202 2 193388464
ROD203 4 334716799
ROD204 5 351324292
ROD205 7 371849360
ROD206 6 366049425
ROD207 3 376938858
ROD208 3 338808579
ROD209 4 381108299
ROD21 2 317259772
ROD210 4 323564818
ROD211 6 393907859
ROD212 8 351603620
ROD213 8 357587743
ROD214 1 188060799
ROD215 2 341922886
ROD216 2 316883888
ROD217 2 280377800
ROD218 3 347137656
ROD219 3 315189109
ROD22 2 289653994
ROD220 3 271011851
ROD221 5 354922138
ROD222 5 294688320
ROD223 2 387647059
ROD224 2 325165809
ROD225 2 311669100
ROD226 2 279641759
ROD227 3 378019186
ROD228 3 366857421
ROD229 4 391937005
ROD23 1 140975125
ROD230 3 259447828
ROD231 2 338914351
ROD232 1 159396618
ROD233 2 300967943
ROD234 2 278090573
ROD235 3 382029770
ROD236 3 346788880
ROD237 4 341355724
ROD238 3 299539788
ROD239 2 384716882
ROD24 3 385591618
ROD240 2 334812016
ROD241 2 317562325
ROD242 2 297867706
ROD243 3 391596307
ROD244 3 375850127
ROD245 3 319077903
ROD246 1 96079412
ROD247 4 372403099
ROD248 2 339353113
ROD249 2 291476052
ROD25 4 335044383
ROD250 3 361948668
ROD251 3 323820154
ROD252 4 334059592
ROD253 2 135967815
ROD254 6 388732520
ROD255 2 384840810
ROD256 2 325715141
ROD257 2 293400725
ROD258 3 361928079
ROD259 3 312575313
ROD26 5 356599364
ROD260 4 339307352
ROD261 6 387071614
ROD262 3 323777831
ROD263 2 323038558
ROD264 2 290396403
ROD265 3 353192969
ROD266 2 176309395
ROD267 4 317700958
ROD268 5 354035076
ROD269 5 364586500
ROD27 2 394024503
ROD270 2 377919911
ROD271 2 322351463
ROD272 2 275598125
ROD273 3 359387094
ROD274 4 359114848
ROD275 5 381796720
ROD276 5 291605963
ROD277 2 349406529
ROD278 2 332414924
ROD279 1 154951719
ROD28 2 369416674
ROD280 2 276957429
ROD281 3 340415119
ROD282 4 344898844
ROD283 5 391338277
ROD284 5 302617006
ROD285 2 360867642
ROD286 2 323987561
ROD287 2 295177884
ROD288 3 353085942
ROD289 4 349381944
ROD29 2 335852806
ROD290 5 391992857
ROD291 6 346362378
ROD292 2 318921425
ROD293 2 329179204
ROD294 1 153606186
ROD295 3 389462371
ROD296 3 321351180
ROD297 4 331856423
ROD298 6 392378592
ROD299 4 297015981
ROD3 1885 351998373
ROD30 2 300392300
ROD300 2 343527564
ROD301 3 385070196
ROD302 3 320857378
ROD303 4 353697838
ROD304 5 370381281
ROD305 6 372002468
ROD306 6 198546824
ROD307 1 239886027
ROD308 2 370791914
ROD309 2 305296299
ROD31 2 283621167
ROD310 3 391064350
ROD311 3 347656586
ROD312 3 320467346
ROD313 5 376772270
ROD314 20450 165054768
ROD32 3 348161973
ROD33 5 386542915
ROD34 154 237877425
ROD35 1 193958709
ROD36 2 350925653
ROD37 2 319642044
ROD38 2 276360533
ROD39 3 382322699
ROD4 1944 361078959
ROD40 3 366447402
ROD41 84 375321811
ROD42 2 329179204
ROD43 2 290564596
ROD44 3 362508543
ROD45 3 304367499
ROD46 5 385423505
ROD47 6 342729329
ROD48 3 325864489
ROD49 4 358685719
ROD5 1990 363733749
ROD50 4 302148481
ROD51 5 337904903
ROD52 6 385168143
ROD53 6 347801590
ROD54 6 283624907
ROD55 86700 225714581
ROD56 7726 215516903
ROD57 2 307631349
ROD58 2 273205312
ROD59 2 272523522
ROD6 306 57843793
ROD60 3 367476852
ROD61 3 318205593
ROD62 5 305035074
ROD63 2 318173246
ROD64 2 308990189
ROD65 2 273361793
ROD66 3 387778067
ROD67 3 350884214
ROD68 4 388911322
ROD69 4 237246301
ROD7 1975 368354297
ROD70 2 368078907
ROD71 2 295232279
ROD72 2 276158786
ROD73 3 370764878
ROD74 3 367374895
ROD75 5 389069045
ROD76 100 129934266
ROD77 2 318742393
ROD78 3 344928637
ROD79 4 373808507
ROD8 1990 369693686
ROD80 3 390678500
ROD81 2 278778348
ROD82 2 267696443
ROD83 2 294192228
ROD84 3 240341385
ROD85 2 368562428
ROD86 2 305746062
ROD87 2 295306346
ROD88 2 279190114
ROD89 1 126990816
ROD9 1959 368016559
ROD90 3 364697793
ROD91 3 342498328
ROD92 4 374582747
ROD93 3 249713888
ROD94 2 330770236
ROD95 2 292927924
ROD96 2 286762350
ROD97 3 381058419
ROD98 3 353678059
ROD99 3 326328631
STS1 170406 86844690
STS10 202241 61367008
STS11 167006 59450871
STS2 143556 63323860
STS3 8293 4868512
STS4 108725 63673512
STS5 110380 70041358
STS6 106165 81422843
STS7 122522 86626105
STS8 198951 60928175
STS9 8743 2376203
SYN1 54444 100627167
SYN10 2 382762979
SYN11 2 332214168
SYN12 4 386933112
SYN13 1 271050050
SYN14 2 294093621
SYN15 3 329883353
SYN16 4 353920981
SYN17 2 328712085
SYN18 4 357672913
SYN19 1 207870274
SYN2 1 271050050
SYN20 2 382762979
SYN21 2 332214168
SYN22 8 392789107
SYN23 99 283919894
SYN24 66358 200441007
SYN25 9183 352928592
SYN26 17230 334487459
SYN27 109323 160825698
SYN28 33235 99586137
SYN29 19571 280926383
SYN3 2 294093621
SYN4 3 329883353
SYN5 4 353920981
SYN6 1 64242768
SYN7 3 371658272
SYN8 2 250483958
SYN9 1 207870274
TSA1 233360 79647647
TSA10 168556 151807723
TSA100 63252 114802277
TSA101 79841 41351312
TSA102 82721 28609319
TSA103 67721 19747702
TSA104 84021 22863253
TSA105 84236 21912832
TSA106 84446 20981295
TSA107 134042 46621688
TSA108 155989 149784128
TSA109 183762 101519298
TSA11 157777 129834268
TSA110 46994 106959991
TSA111 136867 166252974
TSA112 166495 124901244
TSA113 97423 237859520
TSA114 99257 234633653
TSA115 12708 5978473
TSA116 134189 172362066
TSA117 127781 180160426
TSA118 129595 177105775
TSA119 121186 168272985
TSA12 97090 81392351
TSA120 161588 123667649
TSA121 122311 187541168
TSA122 147961 145186533
TSA123 94592 61300137
TSA124 136202 168455642
TSA125 159235 124954199
TSA126 156460 125810552
TSA127 123500 121448801
TSA13 143803 166125438
TSA14 181274 128537289
TSA15 66503 19953423
TSA16 206960 109167065
TSA17 187291 103573225
TSA18 49603 65723896
TSA19 154594 149438301
TSA2 222146 88664556
TSA20 216430 100054673
TSA21 205490 102782849
TSA22 23776 14252292
TSA23 157937 126687163
TSA24 173072 148399453
TSA25 214206 84411561
TSA26 107859 75824864
TSA27 170344 70732329
TSA28 221651 89477532
TSA29 29733 20452936
TSA3 74968 22652895
TSA30 203801 105213489
TSA31 180099 145440715
TSA32 69822 31097770
TSA33 187392 125238542
TSA34 147367 170573228
TSA35 162061 143463244
TSA36 151566 162792015
TSA37 167242 151938086
TSA38 140834 133825444
TSA39 170040 156652284
TSA4 197157 115804961
TSA40 69540 96684132
TSA41 171682 122074705
TSA42 189724 128201705
TSA43 179004 130074585
TSA44 75912 43109145
TSA45 179829 148956459
TSA46 157580 110411669
TSA47 134660 95403465
TSA48 183454 131877937
TSA49 208660 102956314
TSA5 214836 133894002
TSA50 80586 111968754
TSA51 191615 109275606
TSA52 179810 117228216
TSA53 113652 119320342
TSA54 155201 136003572
TSA55 161488 91817237
TSA56 130889 143855858
TSA57 137079 81286772
TSA58 155441 162401639
TSA59 162373 156460053
TSA6 19260 21470091
TSA60 193151 120607701
TSA61 58953 96808413
TSA62 173239 118026196
TSA63 151994 161916401
TSA64 61517 124800188
TSA65 201330 152320116
TSA66 185417 143496051
TSA67 162494 121036165
TSA68 181441 137352733
TSA69 171437 97550710
TSA7 193237 53106267
TSA70 41533 39009849
TSA71 119065 123313318
TSA72 131964 141438855
TSA73 151655 115933671
TSA74 830 251943
TSA75 153005 102368390
TSA76 156511 143520695
TSA77 40571 33632062
TSA78 176683 138455592
TSA79 161599 158562361
TSA8 156250 122191293
TSA80 11806 9816655
TSA81 185669 115791752
TSA82 143260 147547562
TSA83 177228 144669069
TSA84 158729 177360001
TSA85 18209 12701058
TSA86 168396 128972709
TSA87 156485 150537294
TSA88 194540 124973144
TSA89 32593 22930994
TSA9 101489 69225839
TSA90 195904 138162133
TSA91 113368 113467451
TSA92 98986 206634893
TSA93 87112 229168164
TSA94 77344 247719367
TSA95 30093 107285833
TSA96 141033 144555977
TSA97 106053 76615758
TSA98 74413 65471527
TSA99 33768 32853514
UNA1 768 4547018
VRL1 131616 138873953
VRL10 120963 144236376
VRL100 10099 221653946
VRL100 2464 73649255
VRL100 12081 361112133
VRL100 12144 363017548
VRL100 12243 365758146
VRL100 9064 270726767
VRL100 12253 365988387
VRL100 12191 364194554
VRL100 12193 364253756
VRL100 12192 364228103
VRL100 3904 116628647
VRL101 3403 89711037
VRL101 12199 364432918
VRL101 12194 364284949
VRL101 12195 364311625
VRL101 12196 364344136
VRL101 12206 364633281
VRL101 2531 75613725
VRL101 12190 364142810
VRL101 12194 364288192
VRL101 12198 364404453
VRL101 12197 364371943
VRL102 9650 221588341
VRL102 7501 224086702
VRL102 12170 363577169
VRL102 12171 363631709
VRL102 12071 360731545
VRL102 7688 229799096
VRL102 12099 361553960
VRL102 12036 358875297
VRL102 11949 355733738
VRL102 11972 356420071
VRL102 12097 360564261
VRL103 11736 218787170
VRL103 4354 129886834
VRL103 11949 355721224
VRL103 12094 355995729
VRL103 11981 356795341
VRL103 11967 356589000
VRL103 12306 363973009
VRL103 12241 365468026
VRL103 30387 51011311
VRL104 9455 221346363
VRL105 3888 111367896
VRL106 7740 222413091
VRL107 9253 221857005
VRL108 7809 221674567
VRL109 8275 198201474
VRL11 43853 307767131
VRL110 7547 222351449
VRL111 8008 221562610
VRL112 7869 221743555
VRL113 2191 65297472
VRL114 8465 221484293
VRL115 7710 221269212
VRL116 10236 220766080
VRL117 7766 222257182
VRL118 174 5185343
VRL119 7825 219494238
VRL12 115979 144607970
VRL120 7362 217947535
VRL121 8225 221898519
VRL122 3876 115020512
VRL123 7642 221204272
VRL124 7468 222605611
VRL125 8350 222718674
VRL126 7445 219700261
VRL127 158 4680085
VRL128 7991 218419087
VRL129 8949 221302258
VRL13 23230 82109795
VRL130 7510 220577264
VRL131 7362 217947263
VRL132 5506 161792265
VRL133 12345 369032529
VRL134 12370 369697978
VRL135 12372 369939371
VRL136 12364 369688221
VRL137 12362 369613714
VRL138 5694 170227962
VRL139 12371 369781020
VRL14 113806 144622991
VRL140 12373 369792803
VRL141 12375 369826375
VRL142 8053 240653467
VRL143 12388 370186985
VRL144 12383 370039801
VRL145 12371 369530068
VRL146 5929 175935992
VRL147 7438 221720425
VRL148 8140 222155693
VRL149 7436 221629084
VRL15 112142 147884285
VRL150 2915 82731417
VRL151 7942 222816613
VRL152 7470 221831146
VRL153 8023 221748161
VRL154 9140 220633913
VRL155 3899 115600600
VRL156 7575 220443196
VRL157 7401 219629478
VRL158 7406 219532528
VRL159 3637 104745014
VRL16 27074 44696963
VRL160 7431 218929276
VRL161 7906 222150305
VRL162 7706 219545819
VRL163 7640 222818655
VRL164 4272 119373144
VRL165 8010 221376536
VRL166 7446 221334576
VRL167 7356 217836218
VRL168 8076 221009370
VRL169 3657 102101919
VRL17 90447 158867991
VRL170 7436 221704344
VRL171 7410 220394033
VRL172 7571 220559196
VRL173 5270 151251118
VRL174 7594 221660605
VRL175 7478 221621778
VRL176 7577 219174838
VRL177 1997 59084201
VRL178 7585 221735125
VRL179 7825 221774298
VRL18 96108 150063120
VRL180 7427 220819814
VRL181 2346 68509657
VRL182 8076 222756930
VRL183 7940 222724721
VRL184 7838 223110568
VRL185 7628 218210704
VRL186 7357 217798071
VRL187 7526 221894920
VRL188 7628 222851047
VRL189 7935 222614504
VRL19 62212 101180385
VRL190 107 3187018
VRL191 7439 221651602
VRL192 7682 222021648
VRL193 7603 221247265
VRL194 2635 78589590
VRL195 7594 221755119
VRL196 7380 218829625
VRL197 7520 220151146
VRL198 7491 222632432
VRL199 4430 119383423
VRL2 126057 151020223
VRL20 92196 165753453
VRL200 7684 222455370
VRL201 7719 221869187
VRL202 8856 221767820
VRL203 7736 218194622
VRL204 4205 123969957
VRL205 8143 222118020
VRL206 7510 221460568
VRL207 7658 224114337
VRL208 9437 223791299
VRL209 4794 139175649
VRL21 90971 163598655
VRL210 7778 221939633
VRL211 8946 222539688
VRL212 7483 221572525
VRL213 7389 218445357
VRL214 4264 126966021
VRL215 7730 221768471
VRL216 8047 221847767
VRL217 8241 224040719
VRL218 7916 223157608
VRL219 4133 119188721
VRL22 54334 121537005
VRL220 7658 221726300
VRL221 7552 222964992
VRL222 7350 217830050
VRL223 8163 223063250
VRL224 4341 126389372
VRL225 7958 222343966
VRL226 9532 219763888
VRL227 8556 221891762
VRL228 7446 221412869
VRL229 4178 123763074
VRL23 83025 172215138
VRL230 7428 220433440
VRL231 7590 222296901
VRL232 7837 222380437
VRL233 7434 221582927
VRL234 4422 121896013
VRL235 7928 222170329
VRL236 7761 221641221
VRL237 7723 221883481
VRL238 7388 219609882
VRL239 3540 105091412
VRL24 85547 166897195
VRL240 7432 221490436
VRL241 7537 222032585
VRL242 8151 222521755
VRL243 7669 222610990
VRL244 3936 117093658
VRL245 7574 222770999
VRL246 8786 222559443
VRL247 7410 219746404
VRL248 7424 221266874
VRL249 3923 116943646
VRL25 70042 119974010
VRL250 7424 221004936
VRL251 8376 222237418
VRL252 7644 221172176
VRL253 7559 221906401
VRL254 4012 117094456
VRL255 7980 220734403
VRL256 7386 219283530
VRL257 7783 221314684
VRL258 2048 61046862
VRL259 9072 220397573
VRL26 82600 167343672
VRL260 8239 221769908
VRL261 8798 221892313
VRL262 2167 64556323
VRL263 7463 221769723
VRL264 7462 222264480
VRL265 7402 220051865
VRL266 7632 221540990
VRL267 8063 221905076
VRL268 7619 222827814
VRL269 3658 109021120
VRL27 83158 166424686
VRL270 7466 221888492
VRL271 8019 220951946
VRL272 7693 222343859
VRL273 7808 222313633
VRL274 3781 112702688
VRL275 7524 221455523
VRL276 7745 220864075
VRL277 7737 222384070
VRL278 7502 221857431
VRL279 4725 116944828
VRL28 50804 113091613
VRL280 7510 220262506
VRL281 7486 221844509
VRL282 7595 222163951
VRL283 7466 221334941
VRL284 6226 184574828
VRL285 7451 221948430
VRL286 7446 221941433
VRL287 7491 222054544
VRL288 2481 73963232
VRL289 7519 222265703
VRL29 90704 178555019
VRL290 7667 222371933
VRL291 7519 222801965
VRL292 3392 101114242
VRL293 7541 218788614
VRL294 7641 221623371
VRL295 7446 221429004
VRL296 4656 137549576
VRL297 7455 230678110
VRL298 7680 220306131
VRL299 7737 222841869
VRL3 93512 168073531
VRL30 36202 300527921
VRL300 4079 119577042
VRL301 7972 221579339
VRL302 7382 219925223
VRL303 7526 221517245
VRL304 5550 165290465
VRL305 7504 221885756
VRL306 8205 222928193
VRL307 7441 220245299
VRL308 5817 171715446
VRL309 7513 222403973
VRL31 78005 184697702
VRL310 7601 223191798
VRL311 7557 222966687
VRL312 7472 220369586
VRL313 376 11201677
VRL314 7865 220324747
VRL315 7514 220301134
VRL316 7492 222701928
VRL317 4238 120052508
VRL318 13126 228484419
VRL319 7415 219048485
VRL32 55580 139724381
VRL320 8319 221528474
VRL321 3745 111430642
VRL322 7778 222435572
VRL323 7586 221187505
VRL324 7516 220771676
VRL325 2506 73262197
VRL326 7801 221564442
VRL327 8142 221616306
VRL328 8611 221070665
VRL329 8711 220054015
VRL33 67599 181921633
VRL330 1047 31189289
VRL331 7853 220693310
VRL332 7435 219775426
VRL333 7416 220390680
VRL334 7248 203105310
VRL335 20449 210572516
VRL336 7440 220960934
VRL337 8440 219145488
VRL338 7683 220128958
VRL339 34 1013669
VRL34 77885 184796767
VRL340 7340 218437065
VRL341 7517 221971863
VRL342 7531 221073709
VRL343 10947 221157812
VRL344 2216 65973623
VRL345 9184 220799700
VRL346 7828 222148265
VRL347 7400 219474138
VRL348 3082 83056403
VRL349 7485 220684760
VRL35 66623 159492935
VRL350 7645 219868104
VRL351 7626 220669643
VRL352 6820 200050794
VRL353 7578 221737035
VRL354 7529 221550216
VRL355 7383 218633333
VRL356 3423 98618833
VRL357 7596 222361948
VRL358 7675 221563923
VRL359 7399 220313944
VRL36 74535 192208126
VRL360 5495 160014237
VRL361 7820 221568143
VRL362 7515 221058617
VRL363 7419 219871531
VRL364 8190 219579086
VRL365 2300 68510029
VRL366 8928 217968848
VRL367 7975 220787712
VRL368 7460 221243672
VRL369 7384 219133172
VRL37 83870 169589046
VRL370 7732 220641119
VRL371 7482 219844968
VRL372 7875 221134493
VRL373 7565 220521556
VRL374 9909 218782899
VRL375 7844 222143459
VRL376 7468 221413584
VRL377 4938 123750203
VRL378 7658 219781629
VRL379 7551 222101387
VRL38 73084 148505430
VRL380 8042 221512432
VRL381 4539 115826637
VRL382 7595 221636930
VRL383 8196 220498424
VRL384 8469 221317614
VRL385 3559 104595079
VRL386 8068 221144032
VRL387 9358 220011067
VRL388 8348 219961739
VRL389 4587 133487395
VRL39 78291 176649573
VRL390 7619 223791272
VRL391 8851 223142146
VRL392 8018 222816370
VRL393 3673 98908472
VRL394 8975 220382463
VRL395 7615 222726348
VRL396 7750 222515027
VRL397 2679 72369447
VRL398 8469 221665726
VRL399 7525 222865787
VRL4 14679 147021986
VRL40 69980 179595054
VRL400 8067 222910608
VRL401 3507 103582796
VRL402 8723 221584697
VRL403 7540 222593665
VRL404 8394 222166937
VRL405 6941 203099976
VRL406 8248 223292974
VRL407 7881 222952182
VRL408 7674 221779668
VRL409 6808 184459045
VRL41 44564 196875280
VRL410 7873 222439223
VRL411 7882 222344915
VRL412 7541 223579550
VRL413 2852 84712584
VRL414 7573 223520412
VRL415 8879 219519426
VRL416 7706 222082073
VRL417 3919 107635063
VRL418 7832 220656189
VRL419 7895 223377518
VRL42 20509 137918417
VRL420 7610 221168921
VRL421 3277 93635779
VRL422 11932 217475366
VRL423 7657 221038470
VRL424 7730 220705210
VRL425 6694 177718718
VRL426 8707 222109765
VRL427 7558 223852914
VRL428 7728 221143983
VRL429 4727 132388134
VRL43 25055 217763452
VRL430 7820 219976645
VRL431 7519 222458098
VRL432 7384 218780069
VRL433 5849 167601166
VRL434 10549 219333938
VRL435 7591 222440700
VRL436 8921 218462857
VRL437 7818 220557165
VRL438 1877 53921985
VRL439 8131 222993387
VRL44 15069 218715380
VRL440 8232 222778984
VRL441 7670 224466509
VRL442 3169 93693379
VRL443 8381 221312922
VRL444 7525 220205402
VRL445 7624 222511560
VRL446 7938 222521779
VRL447 9322 223621113
VRL448 5967 176855845
VRL449 10206 221711088
VRL45 33841 207430712
VRL450 7529 222833725
VRL451 7457 222233903
VRL452 4547 123529645
VRL453 7915 220684222
VRL454 7613 220134003
VRL455 7849 221232622
VRL456 2394 71159650
VRL457 7736 225046936
VRL458 10157 217494250
VRL459 7639 221673307
VRL46 11262 128866410
VRL460 6257 169526130
VRL461 9489 225067854
VRL462 7792 219926719
VRL463 8438 222670077
VRL464 9680 224015488
VRL465 4562 122996910
VRL466 7877 224461783
VRL467 7760 220225115
VRL468 10742 220175355
VRL469 4111 121987482
VRL47 18950 217639810
VRL470 8250 224652804
VRL471 7536 220510780
VRL472 7710 223822290
VRL473 5321 150192020
VRL474 8027 220514127
VRL475 9232 221182900
VRL476 9041 219045150
VRL477 4595 124876797
VRL478 9779 220259119
VRL479 8019 221725929
VRL48 25230 214680777
VRL480 8693 219189848
VRL481 6433 126369918
VRL482 11916 216602792
VRL483 7432 219819419
VRL484 7814 221849222
VRL485 7389 202638249
VRL486 8036 220710073
VRL487 8029 221219465
VRL488 7772 221210186
VRL489 8440 204917777
VRL49 17080 217698684
VRL490 10204 222165513
VRL491 7685 220889074
VRL492 7564 221290054
VRL493 7664 222476311
VRL494 7762 222852340
VRL495 7605 220205455
VRL496 3566 104949652
VRL497 11967 218775844
VRL498 9913 221515523
VRL499 8210 223548643
VRL5 93703 148000355
VRL50 10608 155743669
VRL500 7441 220447896
VRL501 5120 116303105
VRL502 7521 223085922
VRL503 8341 222435462
VRL504 8105 220203337
VRL505 4161 123792782
VRL506 8027 220700155
VRL507 6799 227673871
VRL508 8716 220736414
VRL509 2555 85996935
VRL51 13621 220385462
VRL510 7933 223239839
VRL511 7899 220985510
VRL512 8476 222600105
VRL513 3751 99730042
VRL514 10173 219553112
VRL515 6649 228067841
VRL516 8175 219907464
VRL517 2797 109969928
VRL518 7954 222587823
VRL519 7807 223126985
VRL52 10303 219273823
VRL520 7871 224500915
VRL521 8205 223205207
VRL522 4897 150235903
VRL523 7557 223200900
VRL524 10366 220207737
VRL525 11137 214728580
VRL526 12693 220155200
VRL527 5857 148074104
VRL528 9367 222210300
VRL529 7598 221954113
VRL53 10142 221054292
VRL530 8492 224576257
VRL531 9642 220691964
VRL532 6672 189186567
VRL533 8457 220384699
VRL534 8311 223228165
VRL535 14670 215631222
VRL536 5227 137270095
VRL537 8461 219880376
VRL538 6919 228228204
VRL539 9600 220521323
VRL54 5720 126140964
VRL540 5644 154513198
VRL541 8093 223088984
VRL542 11252 217741019
VRL543 11352 219834940
VRL544 8434 220992435
VRL545 3389 79611898
VRL546 8307 220965274
VRL547 9271 219802436
VRL548 7860 219535042
VRL549 3328 99143934
VRL55 8939 223188128
VRL550 7954 222408878
VRL551 7467 222210471
VRL552 8348 221265923
VRL553 5735 135068932
VRL554 7720 222543943
VRL555 11434 219473178
VRL556 9926 219004080
VRL557 3529 97852560
VRL558 11627 218243096
VRL559 11394 216965701
VRL56 9713 220570663
VRL560 13430 216435189
VRL561 4809 88371631
VRL562 7846 221968091
VRL563 8100 222309246
VRL564 8446 221796032
VRL565 2683 75908243
VRL566 11309 218140850
VRL567 8631 221595683
VRL568 8018 222755528
VRL569 3140 92936115
VRL57 8656 222018563
VRL570 7581 223845695
VRL571 8282 221116542
VRL572 11592 224255104
VRL573 2179 144258449
VRL574 7657 226038071
VRL575 8888 223396637
VRL576 7823 224105759
VRL577 6403 144447064
VRL578 8701 221502522
VRL579 7769 221354523
VRL58 10142 221362831
VRL580 8241 221990300
VRL581 3076 86697018
VRL582 18391 211412112
VRL583 9515 222339106
VRL584 11461 220866940
VRL585 9852 180614651
VRL586 8718 224237779
VRL587 8320 225286626
VRL588 15070 217153691
VRL589 9724 208263254
VRL59 3740 86774371
VRL590 8647 221773627
VRL591 7799 223450125
VRL592 7569 223568917
VRL593 2682 79222144
VRL594 9680 220516196
VRL595 22703 218120729
VRL596 15000 216387463
VRL597 10527 179701142
VRL598 8386 224616456
VRL599 12477 221635273
VRL6 86711 143039034
VRL60 10252 221317455
VRL600 10769 220893264
VRL601 8112 201205949
VRL602 12127 219886450
VRL603 9566 223506202
VRL604 10883 224500371
VRL605 8818 222864146
VRL606 809 18788073
VRL607 7466 222556773
VRL608 7466 222586657
VRL609 7463 222361587
VRL61 13552 217700285
VRL610 2160 62095968
VRL611 9068 224259219
VRL612 12008 220259108
VRL613 11687 223732257
VRL614 4601 83628998
VRL615 9204 221623569
VRL616 8114 222402713
VRL617 7713 221940670
VRL618 2578 73276287
VRL619 12045 218217165
VRL62 8966 220504594
VRL620 8239 222076120
VRL621 8459 222274473
VRL622 4945 146860034
VRL623 12227 365289108
VRL624 12325 368313892
VRL625 6297 188087927
VRL626 1904 56895892
VRL627 12391 370252025
VRL628 12593 375872798
VRL629 12622 376617188
VRL63 11192 219164886
VRL630 6402 190822693
VRL631 12618 376375108
VRL632 12711 378788647
VRL633 12720 379050405
VRL634 7071 210913275
VRL635 12683 378032374
VRL636 12621 376515872
VRL637 12463 372108084
VRL638 4385 130881012
VRL639 12487 372570636
VRL64 2911 82240417
VRL640 12526 373795899
VRL641 12566 374816528
VRL642 3672 109697863
VRL643 12471 372279880
VRL644 12411 370816826
VRL645 12385 370092114
VRL646 6455 192829868
VRL647 12399 370295335
VRL648 12384 370112732
VRL649 12372 369777172
VRL65 7481 220718827
VRL650 3505 104760027
VRL651 12444 371585092
VRL652 12422 371006390
VRL653 12188 367344437
VRL654 2967 88674279
VRL655 3626 108345075
VRL656 12533 374033673
VRL657 12394 370328985
VRL658 12135 361916853
VRL659 3077 91965120
VRL66 8116 221893665
VRL660 12402 370569546
VRL661 12241 365853241
VRL662 12364 369448773
VRL663 11636 347775069
VRL664 12354 368959500
VRL665 12405 369442689
VRL666 12361 369463608
VRL667 3562 106470947
VRL668 12270 366781694
VRL669 12489 372406490
VRL67 9175 219150853
VRL670 12347 368667305
VRL671 8901 266036794
VRL672 12350 368951698
VRL673 12383 369943743
VRL674 12538 374215279
VRL675 12350 369107637
VRL676 6907 206120230
VRL677 12335 368607449
VRL678 12414 370808444
VRL679 12350 369120146
VRL68 18463 212788176
VRL680 12418 370890906
VRL681 1404 41924092
VRL682 12281 367037689
VRL683 12355 369223656
VRL684 12353 369167640
VRL685 9985 298422907
VRL686 12385 370126990
VRL687 12335 368658957
VRL688 12334 368612870
VRL689 8841 264200894
VRL69 2444 68464306
VRL690 12372 369711446
VRL691 12344 368933144
VRL692 12353 369197678
VRL693 6111 182640523
VRL694 12070 360742551
VRL695 11865 354610114
VRL696 12257 366337685
VRL697 7774 232348838
VRL698 12389 370108432
VRL699 12352 369160805
VRL7 91434 144081888
VRL70 7825 220313598
VRL700 12237 365479875
VRL701 7117 212707893
VRL702 12336 368685684
VRL703 12269 366371284
VRL704 12367 369586431
VRL705 7148 213231773
VRL706 12621 376192384
VRL707 12392 370220839
VRL708 12483 372625354
VRL709 7201 215101258
VRL71 7777 220691622
VRL710 12378 369843501
VRL711 12246 365820026
VRL712 12456 371790520
VRL713 7139 213357797
VRL714 12340 368749870
VRL715 12344 368927014
VRL716 12421 370120372
VRL717 6907 206428316
VRL718 12296 367498256
VRL719 12248 366038633
VRL72 8144 220353623
VRL720 12442 372129165
VRL721 12540 373980303
VRL722 3409 101887034
VRL723 12366 369584171
VRL724 12381 370012499
VRL725 12359 369375604
VRL726 12363 369469223
VRL727 1948 58190281
VRL728 12281 366786435
VRL729 12528 373622973
VRL73 6587 182464490
VRL730 12531 373794912
VRL731 12516 373424280
VRL732 2472 73740642
VRL733 12511 373317579
VRL734 12417 370921926
VRL735 12411 370713753
VRL736 2932 87629297
VRL737 12414 370859460
VRL738 12239 365608522
VRL739 12281 366779971
VRL74 7893 221311927
VRL740 3198 95503906
VRL741 12389 370027978
VRL742 12463 371877239
VRL743 12458 371736014
VRL744 3210 95853682
VRL745 12484 372491339
VRL746 12389 369902373
VRL747 12421 370850328
VRL748 12416 370735519
VRL749 3864 115229529
VRL75 8408 220098191
VRL750 12385 369714210
VRL751 12340 368683545
VRL752 12363 369226423
VRL753 6420 191784589
VRL754 12374 369602677
VRL755 12344 368677922
VRL756 12362 369271877
VRL757 12423 370805020
VRL758 7875 235009520
VRL759 12407 370351983
VRL76 8627 218882918
VRL760 12364 369293567
VRL761 12265 366456082
VRL762 9827 293612294
VRL763 12287 367084198
VRL764 12314 367799365
VRL765 12265 366434093
VRL766 12309 367617260
VRL767 12336 368310951
VRL768 12367 369156641
VRL769 3173 94670275
VRL77 6092 160584138
VRL770 12421 370381742
VRL771 12471 372009482
VRL772 12371 369292216
VRL773 12387 369774056
VRL774 12324 368142839
VRL775 11775 351748607
VRL776 12329 368300282
VRL777 12323 368080815
VRL778 12313 367812242
VRL779 12336 368489238
VRL78 12595 218625028
VRL780 9671 288886614
VRL781 12345 368738853
VRL782 12367 369426509
VRL783 12332 368366126
VRL784 12404 370579163
VRL785 2016 60229555
VRL786 12486 371371422
VRL787 12587 376136321
VRL788 12343 368686816
VRL789 12364 369322928
VRL79 8520 219154612
VRL790 12404 370541402
VRL791 8130 242893704
VRL792 12496 373365842
VRL793 12432 371399948
VRL794 12347 368784251
VRL795 12345 368711538
VRL796 9089 271464899
VRL797 12336 368408718
VRL798 12339 368518437
VRL799 12359 369096817
VRL8 130923 139328689
VRL80 8507 221330859
VRL800 12364 369244387
VRL801 595 17768358
VRL802 12381 369696945
VRL803 12374 369501082
VRL804 12379 369644695
VRL805 12369 369361792
VRL806 559 16693996
VRL807 12369 369334319
VRL808 12319 367883423
VRL809 11977 357823472
VRL81 5225 145495902
VRL810 12189 364090905
VRL811 1157 34548722
VRL812 12410 370392096
VRL813 12353 368814433
VRL814 12368 369260664
VRL815 12369 369253976
VRL816 270 8061056
VRL817 12368 369226825
VRL818 12366 369159314
VRL819 12359 368944008
VRL82 7487 220569357
VRL820 6005 179251803
VRL821 12374 369400888
VRL822 12366 369123428
VRL823 12398 370174224
VRL824 12412 370600813
VRL825 1291 38537124
VRL826 12366 369127168
VRL827 12367 369150031
VRL828 12462 371495742
VRL829 12608 375399077
VRL83 7756 222081357
VRL830 1512 45062470
VRL831 12503 372903703
VRL832 12545 374851085
VRL833 12445 371631592
VRL834 4763 142249867
VRL835 12423 370936414
VRL836 12484 372907724
VRL837 12489 373040331
VRL838 4692 140179365
VRL839 12326 368003805
VRL84 7732 222582337
VRL840 12357 368963039
VRL841 12438 371485547
VRL842 4886 146029693
VRL843 12457 371960700
VRL844 12070 360256200
VRL845 11939 356294173
VRL846 5354 159780884
VRL847 12308 367394797
VRL848 12105 361326031
VRL849 11914 355237809
VRL85 803 19976110
VRL850 5524 163959206
VRL851 12538 371903410
VRL852 12591 375430613
VRL853 12558 374548591
VRL854 4880 144920184
VRL855 12639 376713378
VRL856 12655 376553425
VRL857 12555 374447869
VRL858 4942 147491721
VRL859 12541 374002589
VRL86 8446 221799654
VRL860 12655 376277562
VRL861 12646 376463564
VRL862 12651 376010820
VRL863 12587 375090299
VRL864 5286 157447544
VRL865 12554 373766796
VRL866 12634 376058990
VRL867 12672 376416507
VRL868 9395 280019540
VRL869 12589 375044030
VRL87 7785 221836855
VRL870 12627 376412349
VRL871 12616 375952502
VRL872 2976 88570591
VRL873 12667 377031073
VRL874 12460 371429938
VRL875 12367 369022583
VRL876 7720 230064788
VRL877 12689 377040785
VRL878 12696 377435664
VRL879 12564 375068053
VRL88 7414 220726434
VRL880 12421 370661452
VRL881 12556 374506757
VRL882 12559 375397390
VRL883 1985 59310040
VRL884 12563 375268346
VRL885 12493 373092601
VRL886 12529 376499599
VRL887 7192 214822798
VRL888 12208 364524330
VRL889 11870 354290693
VRL89 3109 82331903
VRL890 12426 366602335
VRL891 12465 372204456
VRL892 4809 143349099
VRL893 12575 375508602
VRL894 12547 374776214
VRL895 12526 374129811
VRL896 12453 371821049
VRL897 3728 111382956
VRL898 12536 374510811
VRL899 12522 373995879
VRL9 72927 93411253
VRL90 7987 221802828
VRL900 12553 375021905
VRL901 12550 374886399
VRL902 12515 373703906
VRL903 45 1343589
VRL904 12373 369521193
VRL905 12333 368446726
VRL906 12422 370851181
VRL907 10550 315017672
VRL908 12459 373079805
VRL909 12419 371360929
VRL91 9309 221496928
VRL910 12428 371345506
VRL911 4986 148899678
VRL912 12242 369489762
VRL913 12317 367592887
VRL914 12174 365156432
VRL915 4053 115032319
VRL916 12703 367485505
VRL917 12532 367814176
VRL918 12762 364368272
VRL919 12516 362023073
VRL92 7844 220504321
VRL920 10180 294970939
VRL921 12261 364246493
VRL922 11983 358129926
VRL923 11992 358281709
VRL924 11970 357626813
VRL925 8265 246937176
VRL926 11985 358078812
VRL927 11989 358195256
VRL928 12156 363313606
VRL929 6489 193956712
VRL93 3528 85483983
VRL930 12177 363892164
VRL931 12137 362742033
VRL932 12131 362591479
VRL933 3657 109292202
VRL934 12028 359490869
VRL935 12169 363409112
VRL936 12161 363033450
VRL937 12058 360081778
VRL938 12080 360896706
VRL939 12014 358872295
VRL94 9355 218778672
VRL940 2730 81547016
VRL941 12189 364192061
VRL942 12163 363192710
VRL943 12165 363203605
VRL944 12155 362921616
VRL945 12158 362938293
VRL946 12161 363091473
VRL947 2684 80138103
VRL948 12166 363165165
VRL949 12166 363241275
VRL95 8380 221630714
VRL950 12170 363353847
VRL951 12156 362931637
VRL952 12160 363069167
VRL953 12172 363405368
VRL954 4051 120940847
VRL955 12163 363155849
VRL956 12161 363080282
VRL957 12159 363040526
VRL958 12167 363291692
VRL959 8121 242458743
VRL96 8457 222847772
VRL960 12179 363588312
VRL961 12288 366296193
VRL962 12230 364766866
VRL963 12230 364839180
VRL964 7809 232891999
VRL965 12517 372202470
VRL966 12314 367044713
VRL967 12278 366328806
VRL968 12245 365344345
VRL969 11804 352066227
VRL97 4325 101855066
VRL970 12261 365697368
VRL971 12496 371789496
VRL972 12719 377385868
VRL973 12715 377344810
VRL974 1217 36116332
VRL975 12713 377392716
VRL976 12718 377715037
VRL977 12722 377819305
VRL978 3915 116278053
VRL979 12719 377541904
VRL98 10043 222280939
VRL980 12718 377586495
VRL981 12684 377060528
VRL982 8611 255698002
VRL983 12709 377317035
VRL984 12707 377302448
VRL985 12704 377157720
VRL986 6978 207185151
VRL987 12712 377452061
VRL988 12713 377484768
VRL989 12704 377383509
VRL99 9791 222911095
VRL990 11005 326905059
VRL991 12701 377344883
VRL992 12731 377820619
VRL993 12740 378056851
VRL994 13981 367611615
VRL995 2023 60413061
VRL996 12174 363492409
VRL997 12166 363174877
VRL998 12167 363247246
VRL999 12166 363224933
VRT1 70122 272314253
VRT10 37396 74041240
VRT100 2 330550494
VRT101 1 146904662
VRT102 3 319096504
VRT103 7 379783228
VRT104 11 374771935
VRT105 13 379441801
VRT106 3 70710155
VRT107 16 344076996
VRT108 10 385210617
VRT109 15 392781064
VRT11 18698 27611025
VRT110 22 370094349
VRT111 1 839681426
VRT112 1 825560060
VRT113 1 595904407
VRT114 1 486875112
VRT115 1 387033265
VRT116 1 371528181
VRT117 1 313513962
VRT118 1 277530821
VRT119 1 268302114
VRT12 5986 380511905
VRT120 3 319484498
VRT121 5 386368861
VRT122 7 393936069
VRT123 7 384166854
VRT124 1 46063367
VRT125 7 344525641
VRT126 6 384186008
VRT127 8 388949147
VRT128 332 334400544
VRT129 1 222115097
VRT13 3363 217068541
VRT130 3 377547369
VRT131 10 383496928
VRT132 33 389650655
VRT133 6 59236435
VRT134 1 772932187
VRT135 1 662004353
VRT136 1 535506559
VRT137 1 376147139
VRT138 1 364230008
VRT139 1 346409914
VRT14 4685 4674270
VRT140 1 311292523
VRT141 1 247732340
VRT142 1 228143320
VRT143 1 221182781
VRT144 2 321892640
VRT145 490 332426844
VRT146 12 378048109
VRT147 9 378909870
VRT148 6 345737823
VRT149 2 137693511
VRT15 1171 26255719
VRT150 7 385107928
VRT151 8 360581972
VRT152 10 364952837
VRT153 4 133261911
VRT154 8 359905961
VRT155 5 370674748
VRT156 9 378247816
VRT157 6 166907986
VRT158 14 379842153
VRT159 15 375595384
VRT16 293 13983146
VRT160 41 289507176
VRT161 11 366984719
VRT162 14 374291772
VRT163 10 185283047
VRT164 1 550518975
VRT165 1 529596002
VRT166 1 413748038
VRT167 1 326378286
VRT168 1 272612222
VRT169 1 260396842
VRT17 37 392789976
VRT170 1 197956435
VRT171 2 384149701
VRT172 2 288058306
VRT173 4 353983664
VRT174 461 371881983
VRT175 2 310725315
VRT176 2 280326572
VRT177 3 371471404
VRT178 3 354148189
VRT179 3 303679844
VRT18 13 392458500
VRT180 4 341249946
VRT181 382 371460784
VRT182 13 392880011
VRT183 13 164097178
VRT184 1 313568160
VRT185 1 289498315
VRT186 1 277254249
VRT187 1 244324502
VRT188 1 233859027
VRT189 1 225974235
VRT19 12 379958897
VRT190 1 211674833
VRT191 1 199962141
VRT192 2 390673241
VRT193 2 334991523
VRT194 2 324316137
VRT195 2 292002398
VRT196 1 133841611
VRT197 3 336899598
VRT198 28 389500106
VRT199 6 332993899
VRT2 72833 271627248
VRT20 11 316368323
VRT200 6 378599539
VRT201 1 47256133
VRT202 6 330076811
VRT203 7 362796652
VRT204 8 365387335
VRT205 20 273534543
VRT206 9 378632578
VRT207 11 392575991
VRT208 205 341394663
VRT209 7 347210350
VRT21 13 385338369
VRT210 7 370650631
VRT211 8 391548385
VRT212 6 385659507
VRT213 7 341110862
VRT214 1 55350661
VRT215 8 387616857
VRT216 3 259325358
VRT217 5 392602723
VRT218 41 394037361
VRT219 3 148003845
VRT22 14 372163844
VRT220 7 387415360
VRT221 7 365756282
VRT222 6 352657526
VRT223 5 346047628
VRT224 2 134650353
VRT225 5 356250620
VRT226 6 374573269
VRT227 6 364137996
VRT228 7 343458516
VRT229 2 121348818
VRT23 14 352781625
VRT230 7 358240592
VRT231 8 383435354
VRT232 8 365970383
VRT233 6 357597984
VRT234 7 355728138
VRT235 8 362648569
VRT236 7 390172982
VRT237 8 391413434
VRT238 8 377681388
VRT239 1 42933508
VRT24 19 384683297
VRT240 100 376541917
VRT241 20 391000381
VRT242 13 383659375
VRT243 58 386123281
VRT244 11 394338841
VRT245 11 274288418
VRT246 1 843366180
VRT247 1 842558404
VRT248 1 707956555
VRT249 1 635713434
VRT25 16 379729070
VRT250 1 567300182
VRT251 1 439630435
VRT252 1 236595445
VRT253 1 231667822
VRT254 2 382351630
VRT255 2 103223822
VRT256 1 690654357
VRT257 1 541439571
VRT258 1 495417988
VRT259 1 481763206
VRT26 16 381718727
VRT260 1 429350720
VRT261 1 224823088
VRT262 1 212589178
VRT263 2 374746477
VRT264 2 318111367
VRT265 32 270969991
VRT266 2 352563619
VRT267 7 386835620
VRT268 4317 352826229
VRT269 19 370712563
VRT27 2 51507477
VRT270 15986 152828107
VRT271 139089 132686264
VRT272 144383 126093501
VRT273 137647 133567340
VRT274 4627 5536791
VRT275 127992 142609090
VRT276 129898 142696456
VRT277 125762 135980432
VRT278 17695 57530909
VRT279 3 351846198
VRT28 6 344600068
VRT280 5 374381301
VRT281 16 387558511
VRT282 48 262478695
VRT283 14 376657571
VRT284 16 394062851
VRT285 16 377073984
VRT286 8 278699154
VRT287 13 345916081
VRT288 3 386677656
VRT289 5 363840571
VRT29 7 384846875
VRT290 25 336198071
VRT291 10 365551181
VRT292 392 383359217
VRT293 3 345650541
VRT294 4 347682430
VRT295 8 375481157
VRT296 12 376742698
VRT297 33 366827136
VRT298 11 349043615
VRT299 35 386781479
VRT3 9032 335126292
VRT30 7 359521465
VRT300 3 345588977
VRT301 4 349532575
VRT302 6 304738240
VRT303 7 374752607
VRT304 9 383055365
VRT305 13 380263163
VRT306 17 345430885
VRT307 9 382470915
VRT308 10 392600820
VRT309 9 279911807
VRT31 6 265537261
VRT310 9 254611438
VRT311 4 93451292
VRT312 92 46093787
VRT313 1 427870202
VRT314 1 378320336
VRT315 1 361305601
VRT316 1 335235059
VRT317 1 330123935
VRT318 1 263823987
VRT319 2 310916606
VRT32 2 352172328
VRT320 2 280963255
VRT321 2 253397968
VRT322 5 196338409
VRT323 14 353408674
VRT324 9 362327333
VRT325 12 386562662
VRT326 37 393359699
VRT327 1 197209046
VRT328 4 354626559
VRT329 14 388834320
VRT33 4 299372801
VRT330 19 380393320
VRT331 6 393746332
VRT332 3 88205163
VRT333 142 344732119
VRT334 5 347463485
VRT335 7 380950384
VRT336 7 382163289
VRT337 1 41123832
VRT338 1534 370418439
VRT339 13 372631033
VRT34 33 361630329
VRT340 17 382625440
VRT341 14 376221586
VRT342 27 384724785
VRT343 24 309028163
VRT344 1 359753992
VRT345 1 294454259
VRT346 2 339959923
VRT347 4 389503140
VRT348 17 386338679
VRT349 15 391956294
VRT35 2 87752637
VRT350 9 391549346
VRT351 8 381532502
VRT352 10 359729387
VRT353 16 366027269
VRT354 14 376088571
VRT355 7 235869622
VRT356 2 242903655
VRT357 1 103130777
VRT358 2 195276619
VRT359 3 251633161
VRT36 1 317477549
VRT360 5 300573695
VRT361 66 301934620
VRT362 25 392090725
VRT363 2 90346900
VRT364 10 381757438
VRT365 13 384001666
VRT366 18 378998104
VRT367 14 354514736
VRT368 15 389607510
VRT369 7 359846472
VRT37 1 272440768
VRT370 10 392276936
VRT371 11 351492602
VRT372 12 385397876
VRT373 11 360161366
VRT374 6 387856588
VRT375 6 342298758
VRT376 7 364180089
VRT377 6 278597912
VRT378 4 383566318
VRT379 4 341682881
VRT38 2 394160013
VRT380 5 369366758
VRT381 1 168556870
VRT382 4 366711607
VRT383 12 382161691
VRT384 28 370268341
VRT385 16 348486879
VRT386 8 306781019
VRT387 16 388050719
VRT388 11 367388364
VRT389 14 365878669
VRT39 2 283573173
VRT390 12 375095837
VRT391 1 25932624
VRT392 24 353612648
VRT393 6 369805903
VRT394 7 384607923
VRT395 8 368212165
VRT396 5 378213586
VRT397 5 365493039
VRT398 33 331537940
VRT399 2 361339847
VRT4 3 141387178
VRT40 7 391094812
VRT400 5 387184689
VRT401 27 349981705
VRT402 2 365371943
VRT403 3 264326299
VRT404 27 376036092
VRT405 12 388111625
VRT406 15 355427980
VRT407 9 359004013
VRT408 14 370674190
VRT409 6 357293315
VRT41 15 377074715
VRT410 9 392750267
VRT411 19 345301356
VRT412 2 270081366
VRT413 3 337747199
VRT414 4 372760969
VRT415 6 374441870
VRT416 2 91343234
VRT417 12 365458181
VRT418 14 381904327
VRT419 10 379659381
VRT42 16 378051631
VRT420 12 335882457
VRT421 9 338107238
VRT422 11 341554810
VRT423 6 306672347
VRT424 3 364841512
VRT425 1 78184682
VRT426 13 391321309
VRT427 29 394238386
VRT428 11 392187451
VRT429 12 390891610
VRT43 16 393985227
VRT430 4 124618305
VRT431 13 374791117
VRT432 7 346762788
VRT433 3 331274494
VRT434 5 372585365
VRT435 14 232250556
VRT436 2 330011643
VRT437 3 358143180
VRT438 11 388706206
VRT439 24 346842850
VRT44 14 383797256
VRT440 6 345978928
VRT441 7 376870570
VRT442 9 387109889
VRT443 11 379427132
VRT444 15 388456477
VRT445 5 157396317
VRT446 14 377957244
VRT447 8 345961660
VRT448 6 347102316
VRT449 7 364305083
VRT45 34 210837335
VRT450 11 385521663
VRT451 3 81529282
VRT452 19 381211211
VRT453 10 368005998
VRT454 14 324630407
VRT455 7 384040912
VRT456 7 235089840
VRT457 9 338687749
VRT458 3 346419818
VRT459 4 380278921
VRT46 147 10842596
VRT460 6 383580844
VRT461 7 343415827
VRT462 4 389369168
VRT463 11 380910127
VRT464 7 98500808
VRT465 19 254956808
VRT466 2 291755981
VRT467 3 360820401
VRT468 4 344804531
VRT469 6 391793029
VRT47 586 15797052
VRT470 8 391276700
VRT471 10 368423877
VRT472 6 157808144
VRT473 19 379169371
VRT474 16 364202069
VRT475 12 386705760
VRT476 13 306516285
VRT477 4 349398949
VRT478 2 133605418
VRT479 6 347628123
VRT48 2343 67436863
VRT480 9 341764128
VRT481 6 365068972
VRT482 6 342787609
VRT483 7 356927004
VRT484 12949 174546661
VRT49 19198 357652178
VRT5 8 354279535
VRT50 54122 304773229
VRT51 158596 137243191
VRT52 18242 13425152
VRT53 117670 200717774
VRT54 84318 68319943
VRT55 156210 129530018
VRT56 40550 26961217
VRT57 185408 123431248
VRT58 149927 106561516
VRT59 168303 113433956
VRT6 11 387350249
VRT60 8536 7320483
VRT61 133023 105741590
VRT62 156324 117904454
VRT63 142331 87481495
VRT64 188484 120061987
VRT65 103273 61403688
VRT66 157451 119331668
VRT67 160356 124684918
VRT68 6284 372332628
VRT69 326 389273252
VRT7 11 393947221
VRT70 1595 387372006
VRT71 93755 270827182
VRT72 145106 21008965
VRT73 75789 25336814
VRT74 13375 365641119
VRT75 20 379347618
VRT76 269 392772876
VRT77 3056 391160250
VRT78 3483 231235844
VRT79 6925 378855996
VRT8 30744 333424138
VRT80 16 388667304
VRT81 16 378559418
VRT82 12 379509384
VRT83 7 285874095
VRT84 12 385137967
VRT85 18 367776429
VRT86 16 386329687
VRT87 229 277860126
VRT88 17 367327734
VRT89 15 385834222
VRT9 74952 70630383
VRT90 7 149460915
VRT91 1 356776219
VRT92 1 350268637
VRT93 1 316334699
VRT94 1 337490635
VRT95 1 252032905
VRT96 1 217689105
VRT97 1 199443007
VRT98 1 198537509
VRT99 2 368166310
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 258.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:
Entries Bases Species
8348039 248354855328 Severe acute respiratory syndrome coronavirus 2
1943648 241122158385 Triticum aestivum
520 106587373982 Hordeum bulbosum
1347516 105141459259 Hordeum vulgare subsp. vulgare
164 93011095388 Viscum album
10042539 43634150919 Mus musculus
27744924 28268106518 Homo sapiens
170745 21192042977 Escherichia coli
29699 21127953780 Avena sativa
31214 14583259143 Klebsiella pneumoniae
2243230 13454519107 Bos taurus
2640326 13150105852 Arabidopsis thaliana
1732185 12313153016 Danio rerio
195 11554711366 Sambucus nigra
28754 11286167408 Vicia faba
14809 10342817950 Triticum monococcum
23125 9981580529 Triticum turgidum subsp. durum
4220203 9521201348 Zea mays
44 8798895087 Meconema thalassinum
507 8473880940 Aegilops umbellulata
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting. Also note that this table is limited
to 'traditional', non-set-based (WGS/TSA/TLS) GenBank records.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
187 Dec 2011 135117731375 146413798
188 Feb 2012 137384889783 149819246
189 Apr 2012 139266481398 151824421
190 Jun 2012 141343240755 154130210
191 Aug 2012 143081765233 156424033
192 Oct 2012 145430961262 157889737
193 Dec 2012 148390863904 161140325
194 Feb 2013 150141354858 162886727
195 Apr 2013 151178979155 164136731
196 Jun 2013 152599230112 165740164
197 Aug 2013 154192921011 167295840
198 Oct 2013 155176494699 168335396
199 Dec 2013 156230531562 169331407
200 Feb 2014 157943793171 171123749
201 Apr 2014 159813411760 171744486
202 Jun 2014 161822845643 173353076
203 Aug 2014 165722980375 174108750
204 Oct 2014 181563676918 178322253
205 Dec 2014 184938063614 179295769
206 Feb 2015 187893826750 181336445
207 Apr 2015 189739230107 182188746
208 Jun 2015 193921042946 185019352
209 Aug 2015 199823644287 187066846
210 Oct 2015 202237081559 188372017
211 Dec 2015 203939111071 189232925
212 Feb 2016 207018196067 190250235
213 Apr 2016 211423912047 193739511
214 Jun 2016 213200907819 194463572
215 Aug 2016 217971437647 196120831
216 Oct 2016 220731315250 197390691
217 Dec 2016 224973060433 198565475
218 Feb 2017 228719437638 199341377
219 Apr 2017 231824951552 200877884
220 Jun 2017 234997362623 201663568
221 Aug 2017 240343378258 203180606
222 Oct 2017 244914705468 203953682
223 Dec 2017 249722163594 206293625
224 Feb 2018 253630708098 207040555
225 Apr 2018 260189141631 208452303
226 Jun 2018 263957884539 209775348
227 Aug 2018 260806936411 208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
228 Oct 2018 279668290132 209656636
229 Dec 2018 285688542186 211281415
230 Feb 2019 303709510632 212260377
231 Apr 2019 321680566570 212775414
232 Jun 2019 329835282370 213383758
233 Aug 2019 366733917629 213865349
234 Oct 2019 386197018538 216763706
235 Dec 2019 388417258009 215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
236 Feb 2020 399376854872 216214215
237 Apr 2020 415770027949 216531829
238 Jun 2020 427823258901 217122233
239 Aug 2020 654057069549 218642238
240 Oct 2020 698688094046 219055207
241 Dec 2020 723003822007 221467827
242 Feb 2021 776291211106 226241476
243 Apr 2021 832400799511 227123201
244 Jun 2021 866009790959 227888889
245 Aug 2021 940513260726 231982592
246 Oct 2021 1014763752113 233642893
247 Dec 2021 1053275115030 234557297
248 Feb 2022 1173984081721 236338284
249 Apr 2022 1266154890918 237520318
250 Jun 2022 1395628631187 239017893
251 Aug 2022 1492800704497 239915786
252 Oct 2022 1562963366851 240539282
253 Dec 2022 1635594138493 241015745
254 Feb 2023 1731302248418 241830635
255 Apr 2023 1826746318813 242554936
256 Jun 2023 1966479976146 243560863
257 Aug 2023 2112058517945 246119175
258 Oct 2023 2433391164875 247777761
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
187 Dec 2011 239868309609 73729553
188 Feb 2012 261370512675 78656704
189 Apr 2012 272693351548 80905298
190 Jun 2012 287577367116 82076779
191 Aug 2012 308196411905 84020064
192 Oct 2012 333881846451 86480509
193 Dec 2012 356002922838 92767765
194 Feb 2013 390900990416 103101291
195 Apr 2013 418026593606 110509314
196 Jun 2013 453829752320 112488036
197 Aug 2013 500420412665 124812020
198 Oct 2013 535842167741 130203205
199 Dec 2013 556764321498 133818570
200 Feb 2014 591378698544 139725795
201 Apr 2014 621015432437 143446790
202 Jun 2014 719581958743 175779064
203 Aug 2014 774052098731 189080419
204 Oct 2014 805549167708 196049974
205 Dec 2014 848977922022 200301550
206 Feb 2015 873281414087 205465046
207 Apr 2015 969102906813 243779199
208 Jun 2015 1038937210221 258702138
209 Aug 2015 1163275601001 302955543
210 Oct 2015 1222635267498 309198943
211 Dec 2015 1297865618365 317122157
212 Feb 2016 1399865495608 333012760
213 Apr 2016 1452207704949 338922537
214 Jun 2016 1556175944648 350278081
215 Aug 2016 1637224970324 359796497
216 Oct 2016 1676238489250 363213315
217 Dec 2016 1817189565845 395301176
218 Feb 2017 1892966308635 409490397
219 Apr 2017 2035032639807 451840147
220 Jun 2017 2164683993369 487891767
221 Aug 2017 2242294609510 499965722
222 Oct 2017 2318156361999 508825331
223 Dec 2017 2466098053327 551063065
224 Feb 2018 2608532210351 564286852
225 Apr 2018 2784740996536 621379029
226 Jun 2018 2944617324086 639804105
227 Aug 2018 3204855013281 665309765
228 Oct 2018 3444172142207 722438528
229 Dec 2018 3656719423096 773773190
230 Feb 2019 4164513961679 945019312
231 Apr 2019 4421986382065 993732214
232 Jun 2019 4847677297950 1022913321
233 Aug 2019 5585922333160 1075272215
234 Oct 2019 5985250251028 1097629174
235 Dec 2019 6277551200690 1127023870
236 Feb 2020 6968991265752 1206720688
237 Apr 2020 7788133221338 1267547429
238 Jun 2020 8114046262158 1302852615
239 Aug 2020 8841649410652 1408122887
240 Oct 2020 9215815569509 1432874252
241 Dec 2020 11830842428018 1517995689
242 Feb 2021 12270717209612 1563938043
243 Apr 2021 12732048052023 1590670459
244 Jun 2021 13442974346437 1632796606
245 Aug 2021 13888187863722 1653427055
246 Oct 2021 14599101574547 1721064101
247 Dec 2021 14922033922302 1734664952
248 Feb 2022 15428122140820 1750505007
249 Apr 2022 16071520702170 1781374217
250 Jun 2022 16710373006600 1796349114
251 Aug 2022 17511809676629 2024099677
252 Oct 2022 18231960808828 2167900306
253 Dec 2022 19086596616569 2241439349
254 Feb 2023 20116642176263 2337838461
255 Apr 2023 20926504760221 2440470464
256 Jun 2023 21791125594114 2611654455
257 Aug 2023 22294446104543 2631493489
258 Oct 2023 23600199887231 2775205599
The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.
TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).
Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.
Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tsa
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.
Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.
Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.
Release Date Base Pairs Entries
201 Apr 2014 23632325832 29734989
202 Jun 2014 31707343431 38011942
203 Aug 2014 33676182560 40556905
204 Oct 2014 36279458440 43567759
205 Dec 2014 46056420903 62635617
206 Feb 2015 49765340047 66706014
207 Apr 2015 55796332435 71989588
208 Jun 2015 60697472570 76974601
209 Aug 2015 69360654413 87827013
210 Oct 2015 70917172944 81790031
211 Dec 2015 77583339176 87488539
212 Feb 2016 81932555094 92132318
213 Apr 2016 87811163676 98147566
214 Jun 2016 94413958919 104677061
215 Aug 2016 103399742586 113179607
216 Oct 2016 113209225762 124199597
217 Dec 2016 125328824508 142094337
218 Feb 2017 133517212104 151431485
219 Apr 2017 149038907599 165068542
220 Jun 2017 158112969073 176812130
221 Aug 2017 167045663417 186777106
222 Oct 2017 172909268535 192754804
223 Dec 2017 181394660188 201559502
224 Feb 2018 193940551226 214324264
225 Apr 2018 205232396043 227364990
226 Jun 2018 216556686631 238788334
227 Aug 2018 225520004678 249295386
228 Oct 2018 235875573598 259927414
229 Dec 2018 248592892188 274845473
230 Feb 2019 263936885705 294772430
231 Apr 2019 277118019688 311247136
232 Jun 2019 285390240861 319927264
233 Aug 2019 294727165179 331347807
234 Oct 2019 305371891408 342811151
235 Dec 2019 325433016129 367193844
236 Feb 2020 340994289065 386644871
237 Apr 2020 349692751528 396392280
238 Jun 2020 359947709062 409725050
239 Aug 2020 366968951160 417524567
240 Oct 2020 382996662270 435968379
241 Dec 2020 392206975386 446397378
242 Feb 2021 407605409948 463151000
243 Apr 2021 425076483459 481154920
244 Jun 2021 436594941165 494641358
245 Aug 2021 440578422611 498305045
246 Oct 2021 449891016597 508319391
247 Dec 2021 455870853358 514158576
248 Feb 2022 465013156502 524464601
249 Apr 2022 474421076448 534770586
250 Jun 2022 485056129761 546991572
251 Aug 2022 497501380386 560196830
252 Oct 2022 511476787957 574020080
253 Dec 2022 611850391049 649918843
254 Feb 2023 630615054587 672261981
255 Apr 2023 636291358227 678332682
256 Jun 2023 643127590034 683922756
257 Aug 2023 646176166908 686271945
258 Oct 2023 659924904311 701336089
The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.
Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
ftp://ftp.ncbi.nih.gov/genbank/tls
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.
Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.
Release Date Base Pairs Entries
217 Dec 2016 584697919 1268690
218 Feb 2017 636923295 1438349
219 Apr 2017 636923295 1438349 (unchanged)
220 Jun 2017 824191338 1628475
221 Aug 2017 824191338 1628475 (unchanged)
222 Oct 2017 2993818315 9479460
223 Dec 2017 4458042616 12695198
224 Feb 2018 4531966831 12819978
225 Apr 2018 5612769448 14782654
226 Jun 2018 5896511468 15393041
227 Aug 2018 6077824493 15822538
228 Oct 2018 8435112913 20752288
229 Dec 2018 8511829281 20924588
230 Feb 2019 9146836085 23259929
231 Apr 2019 9623321565 24240761
232 Jun 2019 10182427815 25530139
233 Aug 2019 10531800829 26363945
234 Oct 2019 10848455369 27460978
235 Dec 2019 11280596614 28227180
236 Feb 2020 13669678196 34037371
237 Apr 2020 24615270313 65521132
238 Jun 2020 27500635128 75063181
239 Aug 2020 27825059498 75682157
240 Oct 2020 28814798868 78177358
241 Dec 2020 33036509446 88039152
242 Feb 2021 33634122995 90130561
243 Apr 2021 37998534461 102395753
244 Jun 2021 38198113354 102662929
245 Aug 2021 39930167315 106995218
246 Oct 2021 40168874815 107569935
247 Dec 2021 41143480750 109379021
248 Feb 2022 41321107981 109809966
249 Apr 2022 41324192343 109820387
250 Jun 2022 41999358847 111142107
251 Aug 2022 43852280645 115103527
252 Oct 2022 43860512749 115123306
253 Dec 2022 44009657455 115552377
254 Feb 2023 46465508548 121067644
255 Apr 2023 46567924833 121186672
256 Jun 2023 47302831210 122798571
257 Aug 2023 48289699026 124421006
258 Oct 2023 50868407906 130654568
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
October 15 2023
NCBI-GenBank Flat File Release 258.0
Bacterial Sequences (Part 1)
51396 loci, 92682287 bases, from 51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.
NOTE : Presentation of GI sequence identifiers in the GenBank
flatfile format was discontinued as of March 2017.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, possibly 'LINEAGE'. But because changes like this can be
very disruptive for customers, implementation has not yet been scheduled.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
3.4.4.1 : Important notice about parsing the LOCUS line
Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.
Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.
Consider this LOCUS line for a typical complete bacterial genome:
LOCUS CP032762 5868661 bp DNA circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:
LOCUS AZZZAA02123456789 9999999999 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:
LOCUS AZZZAA0212345678910000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:
LOCUS AZZZAA02123456789 10000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.
3.4.4.2 : Data elements of the LOCUS line
The data elements of the LOCUS line format and their typical/historical
column positions are as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus Name (usually identical to the Accession Number)
29-29 space
30-40 Sequence Length, right-justified
41-41 space
42-43 'bp'
44-44 space
45-47 Strandedness : spaces (if not known), ss- (single-stranded),
ds- (double-stranded), or ms- (mixed-stranded)
48-53 Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), cRNA (viral cRNA)
Left justified.
54-55 space
56-63 Molecule Topology : 'linear' followed by two spaces,
or 'circular'
64-64 space
65-67 Division Code
68-68 space
69-79 Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.
The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :
LOCUS HUMPDNRC 273 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S125 polymorphic dinucleotide repeat.
ACCESSION L10620
LOCUS HUMPDNRG 169 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S114 polymorphic dinucleotide repeat.
ACCESSION L10624
But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:
LOCUS AF035771 1357 bp mRNA linear PRI 30-JUN-1998
DEFINITION Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
complete cds.
ACCESSION AF035771
The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :
PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags)
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites)
GSS - GSS sequences (Genome Survey Sequences)
HTG - HTGS sequences (High Throughput Genomic sequences)
HTC - HTC sequences (High Throughput cDNA sequences)
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences
The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1
^^^^^^^^^^
Compound
Accession.Version
Number
A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:
http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS ANHA01000001 503 bp DNA linear BCT 23-NOV-2012
DEFINITION Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION ANHA01000001 ANHA01000000
VERSION ANHA01000001.1
DBLINK BioProject: PRJNA177352
BioSample: SAMN01795900
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK BioProject:PRJNA174162,PRJNA999998,PRJNA999999
And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.
As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".
DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:
http://www.ncbi.nlm.nih.gov/bioproject
At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:
http://www.ncbi.nlm.nih.gov/books/NBK54016/
DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:
http://www.ncbi.nlm.nih.gov/assembly
At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:
http://www.ncbi.nlm.nih.gov/assembly/help/
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:
http://www.insdc.org/documents/feature-table
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.2
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
The list of valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.3
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, as of June 2022 the `/exception' qualifier has only four
allowed values: 'RNA editing', 'reasons given in citation', 'rearrangement
required for product', and 'annotated by transcript or proteomic data'.
These are known as controlled vocabulary qualifier values. Controlled
qualifier values are case sensitive.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS KZ271580 141308 bp DNA linear CON 17-AUG-2017
DEFINITION Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION KZ271580 LQNL01000000
VERSION KZ271580.1
DBLINK BioProject: PRJNA230512
BioSample: SAMN04226856
KEYWORDS WGS; HIGH_QUALITY_DRAFT.
...
mRNA complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/product="hypothetical protein"
CDS complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/codon_start=1
/product="hypothetical protein"
/protein_id="OZC04795.1"
/db_xref="GI:1233056989"
/translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Scaffold/CON-division join() sequence
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.
The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] .
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Sayers EW, Cavanaugh M, Clark K, Pruitt KD, Sherry ST, Yankie L,
Karsch-Mizrachi I, "GenBank 2023 update", Nucleic Acids Research,
Volume 51, Issue D1, January 2023, pp. D141-D144.
PMID: 36350640
PMCID: PMC9825519
DOI: 10.1093/nar/gkac1012
The following statement is an example of how one might cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'
(1) Sayers, EW. et al, Nucleic Acids Res. 51(D1):D141-D144 (2023)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: Simply direct your web browser of choice to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] .
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Genome Workbench can be used to submit revisions to
previous submissions. In addition, suggestions and corrections can
be sent by electronic mail to: [email protected]. Please be
certain to indicate the primary accession number of the entry to which
your comments apply; it is helpful if you also give the entry name and
the current contents of any data field for which you are recommending
a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
Vincent Calhoun, Andreina Castillo Siri, Larry Chlumsky, Karen Clark,
Scott Durkin, Michel Eschenbrenner, Michael Fetchko, Linda Frisse,
Andrea Gocke, Anjanette Johnston, Erica Lam,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Augustus Tilley,
Beverly Underwood, and Linda Yankie
Data Management and Preparation
Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
Sergiy Gotvyanskyy, Eugene Gribov, Sergei Kalashnikov, Jonathan Kans,
Leonid Khotomliansky, Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh,
Alex Kotliarov, Frank Ludwig, Vasuki Palanigobu, Anton Perkov,
Andriy Petrow, Sergey Petrunin, Dmitrii Saprykin, Wenyao Shi, Denis Sinyakov,
Thomas Smith, Vladimir Soussov, Vitaly Stakhovsky, Elena Starchenko,
Hanzhen Sun, Andrei Vereshchagin, Jewen Xiao, Liwei Zhou
Database Administration
Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
Benjamin Slade, Constantin Vasilyev
Customer Support
David Brodsky, Hanguan Liu, Cooper Park, Monica Romiti, Eric Sayers,
Majda Valjavec-Gratian
Project Direction/Leadership
Steve Sherry : Acting Director, NLM
Kim Pruitt : Acting Director, NCBI
Valerie Schneider : Acting Branch Chief, NCBI/IEB
Eugene Yaschenko : Chief Technology Officer, NCBI/IRB
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
